RPSBLAST alignment for GI: 254780771 and conserved domain: PRK10092

>gnl|CDD|182235 PRK10092, PRK10092, maltose O-acetyltransferase; Provisional. Length = 183
 Score = 54.0 bits (130), Expect = 5e-08
 Identities = 31/87 (35%), Positives = 42/87 (48%), Gaps = 18/87 (20%)

Query: 259 VHIGCGCIIVSQVGIAGSTY------------------IGDNVLIGGQCGIAGYLKIGDN 300
           + IG  C++   V I  +T+                  IG+NV IGG+  I   + IGDN
Sbjct: 94  IRIGDNCMLAPGVHIYTATHPLDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDN 153

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPI 327
           V +AS + V KD+P     GG PAR I
Sbjct: 154 VVVASGAVVTKDVPDNVVVGGNPARII 180