RPSBLAST alignment for GI: 254780771 and conserved domain: PRK14352

>gnl|CDD|184641 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 482
 Score = 50.7 bits (122), Expect = 6e-07
 Identities = 41/199 (20%), Positives = 78/199 (39%), Gaps = 40/199 (20%)

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI- 189
           I+  V I    V++PG ++  +T +G  +V+G    +  + ++G G+S+  +    S I 
Sbjct: 268 IDVDVTIGRDVVIHPGTQLLGRTTIGEDAVVGPDTTL-TDVTVGEGASVVRTHGSESEIG 326

Query: 190 ----------LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGT-I 238
                     L  G  +G +G               +G  +      IG  + +   T +
Sbjct: 327 AGATVGPFTYLRPGTVLGEEG--------------KLGAFVETKNATIGRGTKVPHLTYV 372

Query: 239 DDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGS-TYIGDNVLIGGQCGIAGYLKI 297
            D  IGE++            +IG   + V+  G+    T IG +V  G        + +
Sbjct: 373 GDADIGEHS------------NIGASSVFVNYDGVNKHRTTIGSHVRTGSDTMFVAPVTV 420

Query: 298 GDNVQIASKSGVLKDIPAG 316
           GD     + + + +D+P G
Sbjct: 421 GDGAYTGAGTVIREDVPPG 439