RPSBLAST alignment for GI: 254780771 and conserved domain: PRK14359

>gnl|CDD|184645 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 430
 Score = 50.4 bits (121), Expect = 7e-07
 Identities = 49/160 (30%), Positives = 66/160 (41%), Gaps = 20/160 (12%)

Query: 159 SVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIG 217
             +  GVRI     I   S I + S+I  S+I +S V        + R  S+I K  HIG
Sbjct: 266 CELEEGVRILGKSKI-ENSHIKAHSVIEESIIENSDV----GPLAHIRPKSEI-KNTHIG 319

Query: 218 RVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG-S 276
             +     ++    A     + D  I E T            +IG G I  +  G     
Sbjct: 320 NFVETKNAKLNGVKAGHLSYLGDCEIDEGT------------NIGAGTITCNYDGKKKHK 367

Query: 277 TYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAG 316
           T IG NV IG    +   + I DNV IA+ S V KD+P G
Sbjct: 368 TIIGKNVFIGSDTQLVAPVNIEDNVLIAAGSTVTKDVPKG 407