RPSBLAST alignment for GI: 254780771 and conserved domain: COG1044

>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]. Length = 338
 Score =  302 bits (775), Expect = 1e-82
 Identities = 145/331 (43%), Positives = 191/331 (57%), Gaps = 9/331 (2%)

Query: 10  HKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASA 69
                L +LAQ +GA L  +  G+R+I  ++P+  A  GDIS++ + K+   ++  +A A
Sbjct: 1   MPSYTLAELAQQLGAELRGD--GDRVITGVAPLDEAQPGDISFLANPKYRKELKTSRAGA 58

Query: 70  IICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDV 129
           +I S     F P     L+   P ++FA    + Y         +   GI P A +    
Sbjct: 59  VIVSAKDAAFAPAKKNALVVKDPYLAFAKVAQLFYR------PFNPAAGIHPTAVIDPTA 112

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSV 188
            I   V I P  V+  GV IG    +G G+VIG  V+IG    I    +IY   +IGN+V
Sbjct: 113 TIGKNVSIGPNVVIGAGVVIGENVVIGAGAVIGENVKIGDGTVIHPNVTIYHNVVIGNNV 172

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           I+HSG  IG DGFGYA       KI  IGRVII D VEIGAN+ IDRG +DDT+IGE  K
Sbjct: 173 IIHSGAVIGADGFGYAGTAIGWVKIPQIGRVIIGDDVEIGANTTIDRGALDDTVIGEGVK 232

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDN VQIGHNV IG  CII  QVGIAGS  IG  V+IGGQ GIAG+L+IGD V I ++SG
Sbjct: 233 IDNLVQIGHNVRIGEHCIIAGQVGIAGSVKIGKYVIIGGQVGIAGHLEIGDGVTIGARSG 292

Query: 309 VLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           V+  I      GG+PA+PI E+L+   ++ +
Sbjct: 293 VMASITEPGYSGGIPAQPIKEWLKTAALIRR 323