RPSBLAST alignment for GI: 254780771 and conserved domain: COG1207

>gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]. Length = 460
 Score = 94.9 bits (236), Expect = 3e-20
 Identities = 57/192 (29%), Positives = 80/192 (41%), Gaps = 15/192 (7%)

Query: 127 EDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGN 186
               I   V I    V+ P V +   T +G   VIG G  I ++  IG  + I +  +  
Sbjct: 261 ATTYIRGDVEIGRDVVIEPNVILEGNTVIGDNVVIGPGSVI-KDSVIGDNAVIKAYSVIE 319

Query: 187 SVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
              +  G  +G   F   R  + +   VHIG  +   K  IG  S         T +G+ 
Sbjct: 320 GSTVGEGATVGP--FARLRPGAVLGADVHIGNFVEVKKATIGKGSKAGH----LTYLGD- 372

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGS-TYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
                  +IG NV+IG G I  +  G     T IGDNV IG    +   + IGD   IA+
Sbjct: 373 ------AEIGENVNIGAGTITCNYDGKNKFKTIIGDNVFIGSNSQLVAPVTIGDGATIAA 426

Query: 306 KSGVLKDIPAGQ 317
            S + KD+P G 
Sbjct: 427 GSTITKDVPEGA 438