RPSBLAST alignment for GI: 254780771 and conserved domain: KOG1461

>gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]. Length = 673
 Score = 48.0 bits (114), Expect = 4e-06
 Identities = 39/119 (32%), Positives = 51/119 (42%), Gaps = 17/119 (14%)

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGNSVILHSGVRIGNDGFGYARGVSD 209
           R  Y  P  V+   V +G N  IGAG+ I   S I NSVI  +  RIG++          
Sbjct: 314 RNIYKSPDVVLSHSVIVGANVVIGAGTKIGSGSKISNSVI-GANCRIGSN---------- 362

Query: 210 IHKIVHIGRVIIQDKVEIGANSAIDRGTI-DDTIIGENTKIDNQVQIGHNVHIGCGCII 267
               V I    I + V IG N  ID   I DD  IGE   +     +G  V +G   ++
Sbjct: 363 ----VRIKNSFIWNNVTIGDNCRIDHAIICDDVKIGEGAILKPGSVLGFGVVVGRNFVL 417