RPSBLAST alignment for GI: 254780771 and conserved domain: KOG4750

>gnl|CDD|39947 KOG4750, KOG4750, KOG4750, Serine O-acetyltransferase [Amino acid transport and metabolism]. Length = 269
 Score = 59.3 bits (143), Expect = 1e-09
 Identities = 40/110 (36%), Positives = 51/110 (46%), Gaps = 6/110 (5%)

Query: 219 VIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTY 278
           V I    +IG    +D  T    +IGE   + + V I H V +G         G      
Sbjct: 149 VDIHPAAKIGKGILLDHAT--GVVIGETAVVGDNVSILHPVTLGG---TGKGSG-DRHPK 202

Query: 279 IGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           IGDNVLIG    I G + IG+   IA+ S VLKD+P      G PA+ IG
Sbjct: 203 IGDNVLIGAGVTILGNVTIGEGAVIAAGSVVLKDVPPNTLAVGNPAKLIG 252