HHsearch alignment of GI: 254780772 and MMDB domain: 2vh1_A_1-71

>2vh1_A (A:1-71) FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli}
Probab=96.89  E-value=0.0062  Score=36.04  Aligned_cols=66  Identities=14%  Similarity=0.224  Sum_probs=57.1

Q ss_pred             EEEEEEECC-CCCCHHHHHHH-CCCCCCCCCCHHHHHHHHHHHHH-CCCCCEEEEEEE-CCEEEEEEEEC
Q ss_conf             858999665-00798899997-48789882688999999999996-798003899986-99899999936
Q gi|254780772|r   48 VRRIEIRGA-TNVGKEVILSR-IPVVVGQSISDADLDHAVKNIYA-MGYFSNVKIKIV-DSVLIIDLIER  113 (781)
Q Consensus        48 i~~I~i~G~-~~i~~~~i~~~-~~~~~G~~~~~~~i~~~i~~l~~-~g~F~~v~~~~~-~~~l~~~v~e~  113 (781)
                      |++|.|.|+ ++++.+.|+.. .++..|+.+-.-++++.-.+|-+ ..+.++|+|... .+.|.+.|+|+
T Consensus         1 I~~i~V~G~~~~v~~~~I~~~i~~~~~~~~~~~~d~~~i~~~l~~~lpwV~~v~V~r~~P~~l~I~v~Er   70 (71)
T 2vh1_A            1 MSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEY   70 (71)
T ss_dssp             -CEEEEESCCSSCCHHHHHHHHHTTSCTTCGGGSCHHHHHHHHHHHCTTEEEEEEEEETTTEEEEEEEEC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHCCCCCCEEECHHHHHHHHHHCCCHHHEEEEEEECCCCEEEEEEEE
T ss_conf             9579996987108899999998732478860451799999999853985239999952899569999952