HHsearch alignment of GI: 254780772 and MMDB domain: 3efc_A_1-73

>3efc_A (A:1-73) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}
Probab=99.14  E-value=1e-11  Score=93.50  Aligned_cols=72  Identities=26%  Similarity=0.306  Sum_probs=65.1

Q ss_pred             CCCCCCEEECCCCCCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3332201100333343200332100100100000001234445666776510123445332544356543102332211
Q gi|254780772|r  360 DQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ  438 (781)
Q Consensus       360 ~eg~~~~i~~I~I~GN~~T~d~VIrrel~~~~Gd~~~~~~i~~s~~~L~~lg~F~~V~i~~~~~~~~~~~vdl~i~v~E  438 (781)
                      .+|++++|++|.|.||.++++.+|++.+.++||++|+..++++++++|+++|+|++|.+.+.       ..+|.++|+|
T Consensus         2 ~~g~~~~i~~I~i~G~~~~~~~~i~~~l~~k~G~~~s~~~i~~~~~~L~~~g~F~~V~v~~~-------~~~l~i~V~E   73 (73)
T 3efc_A            2 AMAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRD-------GDTLLVQVKE   73 (73)
T ss_dssp             ----CCCEEEEECSCCSSSCHHHHHHTCSCCTTSCCCTHHHHHHHHHHHHHCCEEEEEEECC-------SSEEEEEEEE
T ss_pred             CCCCCCEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEC-------CCEEEEEEEE
T ss_conf             87777189799999983569999997469999992798999999999996799568999963-------9999999995