HHsearch alignment of GI: 254780772 and MMDB domain: 3efc_A_156-247

>3efc_A (A:156-247) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}
Probab=99.19  E-value=1.9e-11  Score=91.83  Aligned_cols=80  Identities=19%  Similarity=0.307  Sum_probs=70.7

Q ss_pred             CCEEEEEEEECCCCCCHHHHHHHHHHCC---------CCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEE-EEE-CCCCC
Q ss_conf             6536579995654369889988730057---------863799999999999999999729700179987-643-38984
Q gi|254780772|r  113 RKIINHLFFSGNNNLKDDQLKMIVRSRS---------AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQ-HHS-ISPTT  181 (781)
Q Consensus       113 ~p~i~~i~~~Gn~~~~~~~l~~~~~~~~---------g~~~~~~~~~~~~~~i~~~y~~~Gy~~a~V~~~-~~~-~~~~~  181 (781)
                      +|.|.+|.|+||+.+++++|++.+..++         +.+|++.++++++++|+++|.++||++|.|+.. +.. .+.+.
T Consensus         2 r~~I~~I~f~Gn~~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~l~~D~~~i~~~Y~~~GY~~a~V~~~~~~~~~~~~~   81 (92)
T 3efc_A            2 SAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKG   81 (92)
T ss_dssp             CCCCCCCEEESCCSSCTTTTGGGCCCCSSCCSCCSCTTTHHHHHHHHHHHHHHHHHHHHTTCTTCEEEECCCEECTTSCS
T ss_pred             CCEEEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHCHHHHHHHHHHHCCEEEEEEECCEEEEECCCCC
T ss_conf             31058984226533320777766542000000001456643310010208899888723675899971224798056774


Q ss_pred             EEEEEEEECCC
Q ss_conf             25889860366
Q gi|254780772|r  182 LNITYVIEEGV  192 (781)
Q Consensus       182 v~i~~~I~EG~  192 (781)
                      ++|+|.|+||.
T Consensus        82 v~i~~~I~EGe   92 (92)
T 3efc_A           82 IYVTVNITEGD   92 (92)
T ss_dssp             EECEEEEECCC
T ss_pred             EEEEECCCCCC
T ss_conf             04620133341