HHsearch alignment of GI: 254780772 and MMDB domain: 3efc_A_248-395

>3efc_A (A:248-395) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}
Probab=99.70  E-value=1.2e-17  Score=132.26  Aligned_cols=134  Identities=17%  Similarity=0.253  Sum_probs=107.1

Q ss_pred             EEEEEEEECCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEE-EECCCCCEEEEEEEECCCC
Q ss_conf             365799956543698899887300578637999999999999999997297001799876-4338984258898603663
Q gi|254780772|r  115 IINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQH-HSISPTTLNITYVIEEGVK  193 (781)
Q Consensus       115 ~i~~i~~~Gn~~~~~~~l~~~~~~~~g~~~~~~~~~~~~~~i~~~y~~~Gy~~a~V~~~~-~~~~~~~v~i~~~I~EG~~  193 (781)
                      .|++|.|+|+..++.++|.+.+.++.|++|+...+++++++|.++|+++||++|.|.+.. ...+.+.+.|.+.|+||++
T Consensus         3 ~i~~I~i~G~~~~~~~~l~~~~~~~~g~~~~~~~i~~~~~~l~~~y~~~Gy~~a~v~~~~~~~~~~~~~~i~~~v~~g~~   82 (148)
T 3efc_A            3 KLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNR   82 (148)
T ss_dssp             EEEEECCBSCCTTCHHHHHHTCCCCSSCBCCHHHHHHHHHHHHHHHHHTTCSSCEEEEEEEEETTTTEEEEEEEEECCCC
T ss_pred             EEEEEEEECCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCCCEEEEEEEECCCCC
T ss_conf             88776640573233201222210100111025666556678899998607542113552044267868999999843881


Q ss_pred             EEEEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH-HHHCCC
Q ss_conf             2467787504431101222211100122112445666431023333457888888754232-210012
Q gi|254780772|r  194 AKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYA-AVKVSS  260 (781)
Q Consensus       194 ~~I~~I~f~Gn~~f~~~~L~~~~~~k~~~~~~~~~~~~~~~~~l~~D~~~l~~~Y~~~GY~-d~~V~~  260 (781)
                      ++|.+|.+.||..++++.+++.+..++..        .|+...++.++++|.+    .||+ +++|..
T Consensus        83 ~~i~~i~i~G~~~~~~~~i~~~~~~~~g~--------~~~~~~i~~~~~~l~~----~~~f~~v~v~~  138 (148)
T 3efc_A           83 FYVRKIRFEGNDTSKDAVLRREMRQMEGA--------WLGSDLVDQGKERLNR----LGFFETVDTDT  138 (148)
T ss_dssp             CCC-----------------------------------------------------------------
T ss_pred             EEEEEEEEECCCCCCCHHHHHCCCCCCCC--------CCCHHHHHHHHHHHHH----CCCCCCEEEEE
T ss_conf             89999999898857555412100369985--------4799999999999984----79976104464