HHsearch results for GI: 254780772 and protein with PDBid: 2qdf_A

>2qdf_A OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A
Probab=100.00  E-value=0  Score=470.52  Aligned_cols=329  Identities=25%  Similarity=0.447  Sum_probs=310.9

Q ss_pred             HHCCCCEEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEEEECCEEEEE
Q ss_conf             51146526858999665007988999974878988268899999999999679800389998699899999936536579
Q gi|254780772|r   40 VYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHL  119 (781)
Q Consensus        40 ~~~~~~~~i~~I~i~G~~~i~~~~i~~~~~~~~G~~~~~~~i~~~i~~l~~~g~F~~v~~~~~~~~l~~~v~e~p~i~~i  119 (781)
                      .++|++++|++|+|+||+++++++|++.+++++|++++++.+++++++||+||+|+||++..++..|+++|+|+|.|.+|
T Consensus         2 ~~~a~~~~I~~I~i~G~~~v~~~~i~~~~~~~~G~~~~~~~i~~~ik~L~~tg~F~dV~v~~~g~~l~i~v~e~p~i~~i   81 (335)
T 2qdf_A            2 SHMAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASI   81 (335)
T ss_dssp             --CCCCEECCEEEEESCSSSCHHHHHHTSSCCTTCEECHHHHHHHHHHHHTTSCEEEEEEEEETTEEEEEEEECCEEEEE
T ss_pred             CCCCCCCEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCEEEEEEEECCCCCCC
T ss_conf             76567748979999998327999999746899999279999999999999769942489997288899988864531111


Q ss_pred             EEECCCCCCHHHHHHHH---HHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCEEEEEEEECCCCEEE
Q ss_conf             99565436988998873---005786379999999999999999972970017998764338984258898603663246
Q gi|254780772|r  120 FFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKI  196 (781)
Q Consensus       120 ~~~Gn~~~~~~~l~~~~---~~~~g~~~~~~~~~~~~~~i~~~y~~~Gy~~a~V~~~~~~~~~~~v~i~~~I~EG~~~~I  196 (781)
                      .|+||+.++++.|++.+   +++.|.+|++..+++++++|+++|+++||++|.|+++.++.+.+++.|+|.|+||++++|
T Consensus        82 ~~~Gn~~~~~~~l~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~Y~~~Gy~~a~V~~~~~~~~~~~~~v~~~I~EG~~~~I  161 (335)
T 2qdf_A           82 TFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEI  161 (335)
T ss_dssp             EEESCCSSCHHHHHHHHHTTTCCTTSBCCTTSHHHHHHHHHHHGGGGTBSSCEEEEEEEEETTTEEEEEEEEECCCBCEE
T ss_pred             EEECCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEEEEEEECCCCCCCEEEEEECCCCEEE
T ss_conf             26644423335554544320223456554345688999999999863725678877777657776313688512654179


Q ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCCEE
Q ss_conf             77875044311012222111001221124-456664310233334578888887542322100123-1012455554101
Q gi|254780772|r  197 NSIRFVGNKNYSHARLERVISIRTSGYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQ-VLFDKQKSGYVLI  274 (781)
Q Consensus       197 ~~I~f~Gn~~f~~~~L~~~~~~k~~~~~~-~~~~~~~~~~~l~~D~~~l~~~Y~~~GY~d~~V~~~-~~~~~~~~~~~i~  274 (781)
                      ++|.|+||+.|++++|++.|.+++..||+ +..++.|+++.++.|+++|++||+++||+|++|... +...+++..+.|+
T Consensus       162 ~~I~f~Gn~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~l~~~y~~~Gy~d~~v~~~~~~~~~d~~~~~i~  241 (335)
T 2qdf_A          162 QQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVT  241 (335)
T ss_dssp             EEEEEESCCSSCHHHHHGGGSCC--------------CCSCHHHHHHHHHHHHHTTTCTTCEEEEEEEEECTTSSEEEEE
T ss_pred             EEEEECCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCCEEEEECCCCCEEEE
T ss_conf             99763166543045655433310122122223454200567777787766777430101110133168885066440588


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCEECCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             22022221000001233344455767777532116996211210000000000002344564201123322343440466
Q gi|254780772|r  275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVD  354 (781)
Q Consensus       275 ~~I~EG~~y~i~~i~i~g~~~~~~~~~l~~~~~~k~G~~~~~~~~~~~~~~i~~~y~~~GY~fa~v~~~~~~d~~~~~vd  354 (781)
                      +.|+||+||++++|.|.||. .++.++|++.+++++|++||...++++.++|.+.|.++||+|++|.|.++.+.++++|+
T Consensus       242 ~~i~EG~~y~v~~i~i~Gn~-~~~~~~l~~~~~~k~G~~y~~~~i~~~~~~i~~~y~~~GY~~~~V~~~~~~~~~~~~vd  320 (335)
T 2qdf_A          242 VNITEGDQYKLSGVEVSGNL-AGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVK  320 (335)
T ss_dssp             EEEECCCCCEEEEEEEEEEC-TTCHHHHHHHTCCCTTEECCHHHHHHHHHHHHHHHHTTTBSSCEEEEEEEEETTTTEEE
T ss_pred             EEECCCCEEEEEEEEEECCC-CCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCEEE
T ss_conf             73136845998511897244-33146799874578999509999999999999999867984148997778848899898


Q ss_pred             EEEECCCCCCCEEEC
Q ss_conf             554123332201100
Q gi|254780772|r  355 IEYLIDQGSPLYVKR  369 (781)
Q Consensus       355 i~~~I~eg~~~~i~~  369 (781)
                      |+|.|+||+|+||++
T Consensus       321 v~~~I~eg~~~~V~r  335 (335)
T 2qdf_A          321 LRVNVDAGNRFYVRK  335 (335)
T ss_dssp             EEEEEECCCBCCCCC
T ss_pred             EEEEEEECCCEEECC
T ss_conf             999997289558549