BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780772|ref|YP_003065185.1| surface antigen (D15)
[Candidatus Liberibacter asiaticus str. psy62]
         (781 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|61619822|gb|AAX47433.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|254040449|gb|ACT57245.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|255957733|dbj|BAH96734.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743937|dbj|BAJ23896.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743949|dbj|BAJ23905.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
          Length = 781

 Score = 1583 bits (4099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 781/781 (100%), Positives = 781/781 (100%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


>gi|61619810|gb|AAX47431.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|255957765|dbj|BAH96758.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743941|dbj|BAJ23899.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743945|dbj|BAJ23902.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743953|dbj|BAJ23908.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
          Length = 781

 Score = 1582 bits (4096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/781 (99%), Positives = 781/781 (100%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


>gi|61619816|gb|AAX47432.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 781

 Score = 1580 bits (4092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/781 (99%), Positives = 780/781 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRA LAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRACLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


>gi|255957541|dbj|BAH96605.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957721|dbj|BAH96725.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957725|dbj|BAH96728.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957729|dbj|BAH96731.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957737|dbj|BAH96737.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957741|dbj|BAH96740.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957745|dbj|BAH96743.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957749|dbj|BAH96746.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957753|dbj|BAH96749.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957757|dbj|BAH96752.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957761|dbj|BAH96755.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957769|dbj|BAH96761.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957773|dbj|BAH96764.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957777|dbj|BAH96767.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957781|dbj|BAH96770.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957785|dbj|BAH96773.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957789|dbj|BAH96776.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957793|dbj|BAH96779.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957797|dbj|BAH96782.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957801|dbj|BAH96785.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957805|dbj|BAH96788.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957809|dbj|BAH96791.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957813|dbj|BAH96794.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957817|dbj|BAH96797.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957821|dbj|BAH96800.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957825|dbj|BAH96803.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957829|dbj|BAH96806.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957833|dbj|BAH96809.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957837|dbj|BAH96812.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
          Length = 781

 Score = 1580 bits (4091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 779/781 (99%), Positives = 780/781 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSA LYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSANLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


>gi|61619801|gb|AAX47430.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 781

 Score = 1578 bits (4087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 779/781 (99%), Positives = 780/781 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISE+EKI SIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEREKILSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


>gi|158906315|gb|ABW82728.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 781

 Score = 1573 bits (4074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 776/781 (99%), Positives = 778/781 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI+DLIE+K INHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLILDLIEKKNINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAK NSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKKNSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT INRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTGINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


>gi|55380591|gb|AAV50034.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
          Length = 781

 Score = 1571 bits (4067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 774/781 (99%), Positives = 778/781 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNI+QAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIEQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYF SGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFLSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEV+ISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVSISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NY LRGFAY+GIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYCLRGFAYEGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLG MGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGTMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


>gi|165882007|gb|ABY71267.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 781

 Score = 1565 bits (4052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 772/781 (98%), Positives = 774/781 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIE RGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIETRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVIL RIPVVV QS SDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILFRIPVVVRQSFSDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSI PT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSIFPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGY+LIFQIDEGEIYTVGNI IQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYLLIFQIDEGEIYTVGNIFIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT INRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTGINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLIS+
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLIST 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


>gi|209916651|gb|ACI96017.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 624

 Score = 1267 bits (3278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/624 (99%), Positives = 623/624 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRAFY DRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYRDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVY
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVY 600

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
           YGIPLRHREGDKIQQFGFRIGNRM
Sbjct: 601 YGIPLRHREGDKIQQFGFRIGNRM 624


>gi|209916666|gb|ACI96025.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|209916668|gb|ACI96026.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1178 bits (3047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/581 (100%), Positives = 581/581 (100%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 581


>gi|209916672|gb|ACI96028.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1177 bits (3045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/581 (99%), Positives = 581/581 (100%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEA+RAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAVRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 581


>gi|209916670|gb|ACI96027.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1175 bits (3040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/581 (99%), Positives = 580/581 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQF VSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFPVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 581


>gi|209916662|gb|ACI96023.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1173 bits (3034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/581 (99%), Positives = 579/581 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVK QHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKAQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           V VKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VWVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 581


>gi|209916654|gb|ACI96019.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/581 (99%), Positives = 580/581 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRV+VKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVNVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGML+SSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLVSSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           MPLVPE AGLRGAFFVDSATLYANHVALGADKLEGNDSFWR
Sbjct: 541 MPLVPEGAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 581


>gi|209916656|gb|ACI96020.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1171 bits (3029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/581 (99%), Positives = 579/581 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTT NITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTPNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSF KTDVYSKERM+FDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFDKTDVYSKERMNFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 581


>gi|209916660|gb|ACI96022.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/581 (99%), Positives = 578/581 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPT LNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTALNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRA YHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRASYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIR+RSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRVRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQ HRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQCHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           MPLVPERAGLRGAFFVDSATLYANHVALGAD+LEGNDSFWR
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADRLEGNDSFWR 581


>gi|209916658|gb|ACI96021.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1167 bits (3020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/581 (99%), Positives = 577/581 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLS IRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSSIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIE LIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIECLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMA GYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKG G
Sbjct: 241 SMIERAKRRIMAAGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGTG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 581


>gi|209916664|gb|ACI96024.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1165 bits (3015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/578 (99%), Positives = 577/578 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRAFY DRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYRDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAA+RMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAIRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS 735
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS 578


>gi|209916674|gb|ACI96029.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 581

 Score = 1165 bits (3014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/578 (99%), Positives = 577/578 (99%)

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS
Sbjct: 1   QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 60

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
           IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI
Sbjct: 61  IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 120

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
           DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERP 
Sbjct: 121 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPS 180

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
           VRV+TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY
Sbjct: 181 VRVRTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 240

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG
Sbjct: 241 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 300

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS
Sbjct: 301 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 360

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
           LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI
Sbjct: 361 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 420

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR
Sbjct: 421 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 480

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 697
           FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP
Sbjct: 481 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFP 540

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS 735
           MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS
Sbjct: 541 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS 578


>gi|55380587|gb|AAV50031.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           africanus]
          Length = 779

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/783 (58%), Positives = 602/783 (76%), Gaps = 7/783 (0%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           M++ T+ F    +LL++ F R   +GF +  Y  F +S VYGS++ +V  I+IRGA NV 
Sbjct: 1   MYRKTKYFCGFHKLLKRSFSRPL-VGFFVFSYVFFAVSVVYGSDSFVVNDIKIRGAVNVS 59

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           K++ILS IP+  G+S S+ DLD +VKN+YA+GYFSNVKI +V+SVLII+L+E++IINHLF
Sbjct: 60  KQIILSHIPITAGKSFSEEDLDSSVKNLYAIGYFSNVKINVVNSVLIINLVEKQIINHLF 119

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
            SGN+NLKDD L++++ SR +  YDE TV  DV  IK+AYAS GYLNV+V V+ +SISPT
Sbjct: 120 LSGNDNLKDDNLRLLIHSRDSFGYDEYTVKDDVRIIKEAYASRGYLNVVVNVKKYSISPT 179

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
            +N+TY I+EG K  I+SIRF GN +YS ARL+ VIS++TSG+F FG+ DVYSKERMS+D
Sbjct: 180 RINLTYAIDEGFKTTIDSIRFKGNNSYSQARLKSVISLKTSGFFLFGEEDVYSKERMSYD 239

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EE+IR FY+DRGYAAVKVSS+  FDK K+ Y ++F IDEG IY VGNI+I+STLQ+  K 
Sbjct: 240 EESIRKFYYDRGYAAVKVSSRAFFDKAKNSYSILFDIDEGRIYRVGNITIKSTLQDFTKD 299

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
            LLSL++ RSG++Y+P++I+ES+E ISK  F   + FVR  +RINRDFAK IVDIEY+I+
Sbjct: 300 MLLSLVQTRSGDVYDPRKIEESTENISKNLFFKGKYFVRTNSRINRDFAKGIVDIEYIIN 359

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
             SPLY++RIEIEGN QS+DSVIRREL+ SEGDPI+ +MIERAKRRIMATGYFS+VNI +
Sbjct: 360 YDSPLYIERIEIEGNSQSHDSVIRRELDFSEGDPISLAMIERAKRRIMATGYFSKVNILK 419

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPAN V D V+LRV V+QLS+GS+G++TNY V++G G+EG + DNNFFG+GYRAR++ G 
Sbjct: 420 LPAN-VEDRVVLRVIVEQLSSGSIGLSTNYTVNEGTGIEGFVADNNFFGRGYRARISLGV 478

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           G + ++NY FS E+PYFLGS IS+GFD++++   +G L    +  +V    PITE IST+
Sbjct: 479 GHYRLRNYVFSFENPYFLGSRISSGFDIRRSSFMEGFLATEGKYGSVYFTFPITEKISTT 538

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
             Y+ + L+Y + S  E I  I   L+ HG+FS HSISQ I+YNTLD+ ++PR+G+ + S
Sbjct: 539 SSYNYKALKYSSSSMGE-IHEIEKMLVNHGEFSGHSISQDIVYNTLDSQVIPREGIFMKS 597

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
            YDYAG  GDS+YH I   ASYF LLSD+ DIVGSL+FGY  VIP +KNLQ+F Q S SS
Sbjct: 598 MYDYAGLRGDSKYHLIKYGASYFNLLSDNYDIVGSLKFGYSRVIPVDKNLQVFGQLSTSS 657

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           +  LRGFA +GIGPRV+  YAIGG    SASA+VSFPMP++  + GLRG FFVDSATLY 
Sbjct: 658 D-VLRGFADRGIGPRVN-GYAIGGNTSFSASASVSFPMPIINPQVGLRGVFFVDSATLYG 715

Query: 721 N--HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           N  H+ +  +KLEGNDSFWRV+TG EI W+SP+G + +YYGIPLR +  D   ++G +IG
Sbjct: 716 NDFHLDISKNKLEGNDSFWRVATGAEIAWDSPIGAISLYYGIPLRKQSYDTTMRWGIQIG 775

Query: 779 NRM 781
           NR 
Sbjct: 776 NRF 778


>gi|315121989|ref|YP_004062478.1| surface antigen (D15) [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495391|gb|ADR51990.1| surface antigen (D15) [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 776

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/783 (55%), Positives = 577/783 (73%), Gaps = 14/783 (1%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           M K  +D    K  L++YFP   +MGF +LF +I  +SAV+G+N   V +IE++GAT++G
Sbjct: 1   MGKDKKDSYGGKEQLKQYFPIYLRMGFFLLFCSIISVSAVHGANAFSVSKIEVQGATDIG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           ++++LSRIP+VVG+  SD DLD +VK IY+ GYFS+VKIK++DS L IDL+E KIIN L 
Sbjct: 61  RKLVLSRIPIVVGKYFSDNDLDDSVKLIYSTGYFSDVKIKVIDSTLFIDLVENKIINGLV 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           F GNNN+K+  L+ +VRSR   AYD+  V++DV  IKQAYASIGYLNV V VQ + +SPT
Sbjct: 121 FIGNNNVKNTYLERLVRSRPTTAYDKGIVSSDVVRIKQAYASIGYLNVSVDVQANVVSPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
            +++ Y I+EGVK KIN+I FVGNK YS+ RLER+IS++ SGYFS G  D+Y+++++ FD
Sbjct: 181 MVSLVYTIQEGVKTKINTISFVGNKAYSNTRLERIISMKKSGYFSSGGVDIYNEDKLRFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           E AIR FY++RGYA +KVSSQ + D +K+ Y LIF+IDEGEIY VGN++I+S+L+E + +
Sbjct: 241 ENAIRQFYYNRGYAGIKVSSQAILDNKKNLYDLIFKIDEGEIYRVGNVTIRSSLEEAKDE 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
            LL LI+ +SG +YNPQ I+++   ISKYF S  + FVR+ +RINRD AK IVD+EYLID
Sbjct: 301 KLLRLIQAKSGAVYNPQWIEKTINNISKYFLSIGKSFVRMDSRINRDVAKGIVDVEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           Q SP+Y+ RIEIEGND S+D VIRREL  SEGDPIN  MIERAKRRI  TG+FSEVN+ Q
Sbjct: 361 QDSPVYIARIEIEGNDVSHDFVIRRELGFSEGDPINAMMIERAKRRIKNTGFFSEVNVFQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG-VEGHIDDNNFFGQGYRARLAAG 479
           LP  DV D V+L++ VKQL + S+GI+ NY  +K    +E    DNN FG+GY+  +A  
Sbjct: 421 LPT-DVPDRVVLKIHVKQLDSTSIGISLNYGSNKNSSDLEVFFSDNNLFGRGYKQSIAL- 478

Query: 480 FGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESIST 539
               ++ N  +S E+PYFLGS I+AGFDL ++ L +   +++ +  +  + +PITE+IS 
Sbjct: 479 ----SLTNKAYSFENPYFLGSRIAAGFDLGQSKLTESFGNVDKQLHSAHVTLPITETISA 534

Query: 540 SFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLIS 599
           +  Y  R LQY +   KE + S+Y +LI   KF +H+ISQ  +Y+TLDN I+PR+G+++ 
Sbjct: 535 TSSYSYRSLQYQSAPGKE-VSSVYKSLINGKKFITHAISQHFVYSTLDNQIMPREGLMMV 593

Query: 600 SSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
           SSYDY GFGGDS+YHRIG ++S F+LLSD+ DI+GSL+ GYG +IP+NK LQ+FDQFS+ 
Sbjct: 594 SSYDYGGFGGDSRYHRIGFKSSLFHLLSDNLDIIGSLKLGYGYIIPTNKYLQIFDQFSID 653

Query: 660 SNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           ++  LRGFA KGIGPRVD   AIGGKI  SASAA+SFPMP +P   GLRG+FFVDSA LY
Sbjct: 654 TD-DLRGFADKGIGPRVDGD-AIGGKISLSASAAISFPMPFIPPSIGLRGSFFVDSANLY 711

Query: 720 ANHV---ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFR 776
            N+     +G + LEG++ F R+STG+ I W+      GVYYGIPLR +  DK  + GF 
Sbjct: 712 GNNFPWRTVGGN-LEGSEGFLRISTGIGISWDLSYVTAGVYYGIPLRKKSYDKSMRIGFY 770

Query: 777 IGN 779
           IGN
Sbjct: 771 IGN 773


>gi|289600169|gb|ADD13032.1| outer membrane protein [Candidatus Liberibacter solanacearum]
          Length = 752

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/759 (55%), Positives = 564/759 (74%), Gaps = 14/759 (1%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           MGF +LF +I  +SAV+G+N   V +IE++GAT++G++++LSRIP+VVG+  SD DLD +
Sbjct: 1   MGFFLLFCSIISVSAVHGANAFSVSKIEVQGATDIGRKLVLSRIPIVVGKYFSDNDLDDS 60

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAY 144
           VK IY+ GYFS+VKIK++DS L IDL+E KIIN L F GNNN+K+  L+ +VRSR   AY
Sbjct: 61  VKLIYSTGYFSDVKIKVIDSTLFIDLVENKIINGLVFIGNNNVKNTYLERLVRSRPTTAY 120

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D+  V++DV  IKQAYASIGYLNV V VQ + +SPT +++ Y I+EGVK KIN+I FVGN
Sbjct: 121 DKGIVSSDVVRIKQAYASIGYLNVSVDVQANVVSPTMVSLVYTIQEGVKTKINTISFVGN 180

Query: 205 KNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLF 264
           K YS+ RLER+IS++ SGYFS G  D+Y+++++ FDE AIR FY++RGYA +KVSSQ + 
Sbjct: 181 KAYSNTRLERIISMKKSGYFSSGGVDIYNEDKLRFDENAIRQFYYNRGYAGIKVSSQAIL 240

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
           D +K+ Y LIF+IDEGEIY VGN++I+S+L+E + + LL LI+ +SG +YNPQ I+++  
Sbjct: 241 DNKKNLYDLIFKIDEGEIYRVGNVTIRSSLEEAKDEKLLRLIQAKSGAVYNPQWIEKTIN 300

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
            ISKYF S  + FVR+ +RINRD AK IVD+EYLIDQ SP+Y+ RIEIEGND S+D VIR
Sbjct: 301 NISKYFLSIGKSFVRMDSRINRDVAKGIVDVEYLIDQDSPVYIARIEIEGNDVSHDFVIR 360

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           REL  SEGDPIN  MIERAKRRI  TG+F EVN+ QLP  DV D V+L++ VKQL + S+
Sbjct: 361 RELGFSEGDPINAMMIERAKRRIKNTGFFXEVNVFQLPT-DVPDRVVLKIHVKQLDSTSI 419

Query: 445 GIATNYEVDKGMG-VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPIS 503
           GI+ NY  +K    +E    DNN FG+GY+  +A      ++ N  +S E+PYFLGS I+
Sbjct: 420 GISLNYGSNKNSSDLEVFFSDNNLFGRGYKQSIAL-----SLTNKAYSFENPYFLGSRIA 474

Query: 504 AGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIY 563
           AGFDL ++ L +   +++ +  +  + +PITE+IS +  Y  R LQY +   KE + S+Y
Sbjct: 475 AGFDLGQSKLTESFGNVDKQLHSAHVTLPITETISATSSYSYRSLQYQSXPGKE-VSSVY 533

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
            +LI   KF +H+ISQ  +Y+TLDN I+PR+G+++ SSYDY GFGGDS+YHRIG ++S F
Sbjct: 534 KSLINGKKFITHAISQHFVYSTLDNQIMPREGLMMVSSYDYGGFGGDSRYHRIGFKSSLF 593

Query: 624 YLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIG 683
           +LLSD+ DI+GSL+ GYG +IP+NK LQ+FDQFS+ ++  LRGFA KGIGPRVD   AIG
Sbjct: 594 HLLSDNLDIIGSLKLGYGYIIPTNKYLQIFDQFSIDTD-DLRGFADKGIGPRVDGD-AIG 651

Query: 684 GKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHV---ALGADKLEGNDSFWRVS 740
           GKI  SASAA+SFPMP +P   GLRG+FFVDSA LY N+     +G + LEG++ F R+S
Sbjct: 652 GKISLSASAAISFPMPFIPPSIGLRGSFFVDSANLYGNNFPWRTVGGN-LEGSEGFLRIS 710

Query: 741 TGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
           TG+ I W+      GVYYGIPLR +  DK  + GF IGN
Sbjct: 711 TGIGISWDLSYVTAGVYYGIPLRKKSYDKSMRIGFYIGN 749


>gi|325974864|gb|ADZ47883.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 303

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 300/303 (99%), Positives = 301/303 (99%)

Query: 41  YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIK 100
           YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIK
Sbjct: 1   YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIK 60

Query: 101 IVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAY 160
           IVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVN DVHNIKQAY
Sbjct: 61  IVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNVDVHNIKQAY 120

Query: 161 ASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRT 220
           ASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRT
Sbjct: 121 ASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRT 180

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG
Sbjct: 181 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 240

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF SGERPFVRV
Sbjct: 241 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFLSGERPFVRV 300

Query: 341 KTR 343
           KTR
Sbjct: 301 KTR 303


>gi|325974862|gb|ADZ47882.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 303

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 300/303 (99%), Positives = 301/303 (99%)

Query: 41  YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIK 100
           YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIK
Sbjct: 1   YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIK 60

Query: 101 IVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAY 160
           IVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAY
Sbjct: 61  IVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAY 120

Query: 161 ASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRT 220
           ASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRT
Sbjct: 121 ASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRT 180

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           SGYFSFGKTDVYSKERM FDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG
Sbjct: 181 SGYFSFGKTDVYSKERMGFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 240

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF SGERPFVRV
Sbjct: 241 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFLSGERPFVRV 300

Query: 341 KTR 343
           KTR
Sbjct: 301 KTR 303


>gi|150396357|ref|YP_001326824.1| surface antigen (D15) [Sinorhizobium medicae WSM419]
 gi|150027872|gb|ABR59989.1| surface antigen (D15) [Sinorhizobium medicae WSM419]
          Length = 777

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 300/743 (40%), Positives = 463/743 (62%), Gaps = 13/743 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  +++ R+E+RGAT V  E + + I +V G+S S+AD+D +VK +YA GYFS+V I + 
Sbjct: 36  AQAAVINRVEVRGATRVSAETVRANITIVPGKSFSNADIDASVKRLYATGYFSDVSITVS 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L++ + E +++N + F+GN  +KDD+L+ IVR++    Y E TV  D+  I+ AY++
Sbjct: 96  GGSLVVSVSENQLVNQVVFNGNRKIKDDKLQGIVRTQPLGPYSEATVETDIQAIRDAYSA 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
           IG  +V V  Q   I+   +N+ +VI EG + KI  I FVGN+ YS  RL+ VI+ + SG
Sbjct: 156 IGRSDVTVTTQVVPIAEGRVNLAFVINEGERTKITQINFVGNEAYSDGRLQSVIATKESG 215

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
            FSF  + DVY+ +++  DEE +R FY++RG+A  + VSS+   ++  + Y +   ++EG
Sbjct: 216 IFSFLTRKDVYNPDKLRADEELLRQFYYNRGFADFQVVSSEAALNEATNEYTVTITVEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
             Y  G ++I+ST++ +  + L  L++   G++Y  ++I+ +  +ISK   S   PF RV
Sbjct: 276 PRYDFGPVNIESTVEGVDAEELRGLVQSHEGSVYKAKDIQSTMSEISKRVASEGYPFARV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD A   + ++YL+DQG   YV+RIEI GN ++ D VIRRE ++ EGD  N  M+
Sbjct: 336 TPRGNRDLANHTIAVDYLVDQGERAYVERIEIRGNTRTRDYVIRREFDVGEGDAFNQEMV 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG--V 458
            RAKRR+ A GYFS VNIS  P +  +D VI+ V V+  S GS GI   Y    G G  V
Sbjct: 396 ARAKRRLEALGYFSSVNISTTPGS-AADRVIIVVDVQDQSTGSFGIGAGYSAGDGGGFLV 454

Query: 459 EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTH--LEDG 516
           E  I++ NF G+G   RLAAG G  + Q Y  S  +PYFLG  ++AGFDL K     +D 
Sbjct: 455 EASIEEKNFLGRGQYIRLAAGKGEDS-QTYNVSFTEPYFLGYRLAAGFDLFKNENDFDDD 513

Query: 517 SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHS 576
           +   ND+  ++R+  PITE++ST+ +Y+   L+Y    + +++ S Y  +++ G ++  S
Sbjct: 514 NYSYNDQGFSLRVTAPITENLSTTLRYNYTELEY--FGDTDELSSPYDRVVDGGTWTRSS 571

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           ISQSI YNTLD+  +P +G+L S + ++AG GG S ++++  +A ++Y L D++DI+GSL
Sbjct: 572 ISQSITYNTLDDAQLPHEGILASVTQEFAGLGGTSDFYKLTGKAKWYYTLHDEADIIGSL 631

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSF 696
               G +  ++  L++FDQF + SN  +RGF   G+GPRV+   A+GG  Y +ASA  +F
Sbjct: 632 AGSAGHLFKTSGTLEVFDQFQLGSN-DIRGFERNGVGPRVNNGDALGGTTYFTASAEATF 690

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVALG--ADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           P+P +P  +G RGA FVD+ TLY N + L    + + GND+  R S GV ++W SP G +
Sbjct: 691 PLPGLPRDSGFRGALFVDAGTLYDNDLELTGPGESVRGNDASLRASVGVSLIWASPFGPL 750

Query: 755 GVYYGIPLRHREGDKIQQFGFRI 777
            V Y +P+   + D+IQ F F I
Sbjct: 751 RVDYAVPVAKEDFDEIQNFKFGI 773


>gi|116251984|ref|YP_767822.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256632|emb|CAK07720.1| putative outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 780

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 299/746 (40%), Positives = 468/746 (62%), Gaps = 11/746 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++++RI++RGA+ VG E + S + +  G+S S++D+D +VK +Y  GYFS+VKI + 
Sbjct: 39  AEAAVIQRIDVRGASRVGAEAVRSNLTIAPGKSFSNSDIDASVKQLYGTGYFSDVKISVS 98

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
            S L++++ E +++N + F+GN  +KDD+L  IV++ +A  Y +  + AD+ +IK+AYA+
Sbjct: 99  GSTLVVNVQEAQLVNQVVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQADIQSIKEAYAA 158

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G   V V  Q   +    +N+ +VI EG + KI+SI FVGN  YS  RL  VI+ + S 
Sbjct: 159 TGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDSINFVGNNAYSAGRLAAVIATKRSN 218

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
           + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD   + Y L F I+EG
Sbjct: 219 FLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDATFDDATNKYTLTFNIEEG 278

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  G +++QST++ +  + L  L+R R G +YN +E+++S E IS    S   PF RV
Sbjct: 279 QRYDFGPVTVQSTVEGVGSEQLQPLVRTREGQVYNAKEVQKSIEAISDQVASAGYPFARV 338

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD     + +EYL+DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N  MI
Sbjct: 339 TPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMI 398

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS-VGIATNYEVDKGMGVE 459
            +AKRR+ A GYFS VNIS  P +   D V++ V V+  S GS    A       G+ +E
Sbjct: 399 TKAKRRLEALGYFSSVNISTQPGSS-PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLE 457

Query: 460 GHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL-EDGSL 518
             I++ NF G+G   R++AG G+   + Y  S  +PYFLG  ++AGFD+ ++    +   
Sbjct: 458 ASIEEKNFLGRGQYIRISAGGGQEGSRAYGVSFTEPYFLGYRLAAGFDVNRSETSSNDDY 517

Query: 519 DINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSIS 578
           D  + S  +R+  PITE ++T+F+Y+ + ++Y    +   + + Y  L++   ++  S+S
Sbjct: 518 DYEETSVVLRVTAPITEDLATTFRYNYKQMKYDG--DTSDLSATYANLVDESPWTRSSVS 575

Query: 579 QSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRF 638
           Q++ YNTLD+ ++PR+G+  +++++ AG GGDSQ+++I  +A Y++LL+DD+DI+GSL  
Sbjct: 576 QTLTYNTLDDTVLPREGIYATATHELAGLGGDSQFYKIYGKARYYHLLADDADIIGSLSA 635

Query: 639 GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV--DKKYAIGGKIYSSASAAVSF 696
             G V+P   +L +FDQF++ +N  +RGF  KGIGPR+  D    +GG  Y +ASA  +F
Sbjct: 636 SAGYVVPLGDHLNVFDQFTL-TNGDIRGFENKGIGPRIRGDNDDPLGGTTYFTASAEATF 694

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVA-LGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           PMP  P    LRGA F D+ TL+ N V  LG+D+ +G  +  R S GV ++W SP G + 
Sbjct: 695 PMPGFPRDFNLRGAVFADAGTLFGNDVELLGSDQADGTSASLRASVGVGVVWQSPFGALR 754

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNRM 781
           + Y IP+   + DK Q F F I N+ 
Sbjct: 755 LDYAIPVLKEDFDKTQNFKFGINNQF 780


>gi|241204511|ref|YP_002975607.1| outer membrane protein assembly complex, YaeT protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858401|gb|ACS56068.1| outer membrane protein assembly complex, YaeT protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 780

 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 298/746 (39%), Positives = 468/746 (62%), Gaps = 11/746 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++++RI++RGA+ VG E + S + +  G+S S++D+D +VK +Y  GYFS+VKI + 
Sbjct: 39  AEAAVIQRIDVRGASRVGAEAVRSNLTIAPGKSFSNSDIDASVKQLYGTGYFSDVKISVS 98

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
            S L++++ E +++N + F+GN  +KDD+L  IV++ +A  Y +  + AD+ +IK+AYA+
Sbjct: 99  GSTLVVNVQEAQLVNQVVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQADIQSIKEAYAA 158

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G   V V  Q   +    +N+ +VI EG + KI+SI FVGN  YS  RL  VI+ + S 
Sbjct: 159 TGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDSINFVGNNAYSAGRLAAVIATKRSN 218

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
           + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD   + Y L F I+EG
Sbjct: 219 FLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDATFDDATNKYTLTFNIEEG 278

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  G +++QST++ +  + L  L+R R G +YN +E+++S E IS    S   PF RV
Sbjct: 279 QRYDFGPVTVQSTVEGVGSEQLQPLVRTREGQVYNAKEVQKSIEAISDQVASAGYPFARV 338

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD     + +EYL+DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N  MI
Sbjct: 339 TPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMI 398

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS-VGIATNYEVDKGMGVE 459
            +AKRR+ A GYFS VNIS  P +   D V++ V V+  S GS    A       G+ +E
Sbjct: 399 TKAKRRLEALGYFSSVNISTQPGSS-PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLE 457

Query: 460 GHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL-EDGSL 518
             I++ NF G+G   R++AG G+   + Y  S  +PYFLG  ++AGFD+ ++    +   
Sbjct: 458 ASIEEKNFLGRGQYIRISAGGGQEGSRAYGVSFTEPYFLGYRLAAGFDVNRSETSSNDDY 517

Query: 519 DINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSIS 578
           D  + S  +R+  PITE ++T+F+Y+ + ++Y    +   + + Y  L++   ++  S+S
Sbjct: 518 DYEETSVVLRVTAPITEDLATTFRYNYKQMKYDG--DTSDLSATYANLVDESPWTRSSVS 575

Query: 579 QSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRF 638
           Q++ YNTLD+ ++PR+G+  +++++ AG GGDSQ+++I  +A Y++LL+DD+DI+GS+  
Sbjct: 576 QTLTYNTLDDTVLPREGIYATATHELAGLGGDSQFYKIYGKARYYHLLADDADIIGSVSA 635

Query: 639 GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV--DKKYAIGGKIYSSASAAVSF 696
             G V+P   +L +FDQF++ +N  +RGF  KGIGPR+  D    +GG  Y +ASA  +F
Sbjct: 636 SAGYVVPLGDHLNVFDQFTL-TNGDIRGFENKGIGPRIRGDHDDPLGGTTYFTASAEATF 694

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVA-LGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           PMP  P    LRGA F D+ TL+ N V  LG+D+ +G  +  R S GV ++W SP G + 
Sbjct: 695 PMPGFPRDFNLRGAVFADAGTLFGNDVELLGSDQADGTSASLRASVGVGVVWQSPFGALR 754

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNRM 781
           + Y IP+   + DK Q F F I N+ 
Sbjct: 755 LDYAIPVLKEDFDKTQNFKFGINNQF 780


>gi|307317020|ref|ZP_07596461.1| outer membrane protein assembly complex, YaeT protein
           [Sinorhizobium meliloti AK83]
 gi|306897108|gb|EFN27853.1| outer membrane protein assembly complex, YaeT protein
           [Sinorhizobium meliloti AK83]
          Length = 776

 Score =  572 bits (1473), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 301/742 (40%), Positives = 466/742 (62%), Gaps = 12/742 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  +++ R+E+RGAT V  E + + I +V G+S S+AD+D +VK +YA GYFS+V I + 
Sbjct: 36  AQAAVINRVEVRGATRVSAETVRANITIVPGKSFSNADIDASVKRLYATGYFSDVSITVS 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L++ + E +++N + F+GN  +KDD+L+ +VR++    Y E TV  D+  I+ AYA+
Sbjct: 96  GGSLVVSVSENQLVNQVVFNGNRKIKDDKLQGVVRTQPLGPYSEATVETDIQAIRDAYAA 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
           IG  +V V  Q   I+   +N+ +VI EG + KI  I FVGN+ YS  RL+ VI+ + SG
Sbjct: 156 IGRSDVTVTTQVAPIAEGRVNLAFVINEGERTKITQINFVGNEVYSDGRLQSVIATKESG 215

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
            FSF  + DVY+ +++  DEE +R FY++RGYA  + VSS+   ++  + Y +   I+EG
Sbjct: 216 IFSFLTRKDVYNPDKLRADEEFLRQFYYNRGYADFQVVSSEAALNEATNEYTVTITIEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
             Y  G ++I+ST++ I  + L  L++ R G +Y  ++I+ +  +ISK   S   PF RV
Sbjct: 276 PRYDFGPVNIESTVEGIDAEELRGLVQSREGTVYKAKDIQSTMSEISKRVASEGYPFARV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD A   + ++YL+DQG   YV+RIEI GN ++ D VIRRE ++ EGD  N  M+
Sbjct: 336 TPRGNRDLANHTIAVDYLVDQGERAYVERIEIRGNTRTRDYVIRREFDVGEGDAFNQEMV 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG--V 458
            RAKRR+ A GYFS VNIS  P +  +D V++ V V+  S GS GI   Y    G G  V
Sbjct: 396 ARAKRRLEALGYFSSVNISTQPGS-AADRVVIVVDVQDQSTGSFGIGAGYSAGDGGGFLV 454

Query: 459 EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTH--LEDG 516
           E  I++ NF G+G   RLAAG G  + Q Y  S  +PYFLG  ++AGFDL K     +D 
Sbjct: 455 EASIEEKNFLGRGQYIRLAAGKGEDS-QTYNVSFTEPYFLGYRLAAGFDLFKNENDFDDD 513

Query: 517 SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHS 576
           +   ND+  ++R+  PITE++ST+ +Y+   L+Y    +++++ S Y  +I+   ++  S
Sbjct: 514 NYSYNDQGFSLRVTAPITENLSTTLRYNYTELEY--FGDRDELSSPYDRVIDGSPWTRSS 571

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           ISQSI YNTLD+  +P +G+L S + ++AG GG S ++++  +A ++Y L D++DI+GSL
Sbjct: 572 ISQSITYNTLDDAQLPHEGILASVTQEFAGLGGTSDFYKLTGKAKWYYTLHDEADIIGSL 631

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSF 696
               G +  ++ +L++FDQF ++SN  +RGF   G+GPR++   A+GG  Y +ASA  +F
Sbjct: 632 SGSAGHLFETSGSLEVFDQFQLNSN-DIRGFERNGLGPRMNNGDALGGTTYFTASAEATF 690

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVALG-ADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           P+P +P  +G RGA FVD+ TLY N V +G  + + G+D+  R S GV ++W SP G + 
Sbjct: 691 PLPGLPRDSGFRGALFVDAGTLYGNDVEIGPGESVRGDDASLRASVGVSLIWASPFGPLR 750

Query: 756 VYYGIPLRHREGDKIQQFGFRI 777
           V Y +P+   + D++Q F F I
Sbjct: 751 VDYAVPVAKEDFDEVQNFKFGI 772


>gi|15965255|ref|NP_385608.1| putative outer membrane transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307309278|ref|ZP_07588946.1| outer membrane protein assembly complex, YaeT protein
           [Sinorhizobium meliloti BL225C]
 gi|15074435|emb|CAC46081.1| Putative outer membrane transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306900279|gb|EFN30896.1| outer membrane protein assembly complex, YaeT protein
           [Sinorhizobium meliloti BL225C]
          Length = 776

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 300/742 (40%), Positives = 466/742 (62%), Gaps = 12/742 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  +++ R+E+RGAT V  E + + I +V G+S S+AD+D +VK +YA GYFS+V I + 
Sbjct: 36  AQAAVINRVEVRGATRVSAETVRANITIVPGKSFSNADIDASVKRLYATGYFSDVSITVS 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L++ + E +++N + F+GN  +KDD+L+ +VR++    Y E TV  D+  I+ AYA+
Sbjct: 96  GGSLVVSVSENQLVNQVVFNGNRKIKDDKLQGVVRTQPLGPYSEATVETDIQAIRDAYAA 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
           IG  +V V  Q   I+   +N+ +VI EG + KI  I FVGN+ YS  RL+ VI+ + SG
Sbjct: 156 IGRSDVTVTTQVVPIAEGRVNLAFVINEGERTKITQINFVGNEVYSDGRLQSVIATKESG 215

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
            FSF  + DVY+ +++  DEE +R FY++RGYA  + VSS+   ++  + Y +   I+EG
Sbjct: 216 IFSFLTRKDVYNPDKLRADEELLRQFYYNRGYADFQVVSSEAALNEATNEYTVTITIEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
             Y  G ++I+ST++ I  + L  L++ R G +Y  ++I+ +  +ISK   S   PF RV
Sbjct: 276 PRYDFGPVNIESTVEGIDAEELRGLVQSREGTVYKAKDIQSTMSEISKRVASEGYPFARV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD A   + ++YL+DQG   YV+RIEI GN ++ D VIRRE ++ EGD  N  M+
Sbjct: 336 TPRGNRDLANHTIAVDYLVDQGERAYVERIEIRGNTRTRDYVIRREFDVGEGDAFNQEMV 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG--V 458
            RAKRR+ A GYFS VNIS  P +  +D V++ V V+  S GS GI   Y    G G  V
Sbjct: 396 ARAKRRLEALGYFSSVNISTQPGS-AADRVVIVVDVQDQSTGSFGIGAGYSAGDGGGFLV 454

Query: 459 EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTH--LEDG 516
           E  I++ NF G+G   RLAAG G  + Q Y  S  +PYFLG  ++AGFDL K     +D 
Sbjct: 455 EASIEEKNFLGRGQYIRLAAGKGEDS-QTYNVSFTEPYFLGYRLAAGFDLFKNENDFDDD 513

Query: 517 SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHS 576
           +   ND+  ++R+  PITE++ST+ +Y+   L+Y    +++++ S Y  +I+   ++  S
Sbjct: 514 NYSYNDQGFSLRVTAPITENLSTTLRYNYTELEY--FGDRDELSSPYDRVIDGSPWTRSS 571

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           ISQSI YNTLD+  +P +G+L S + ++AG GG S ++++  +A ++Y L D++DI+GSL
Sbjct: 572 ISQSITYNTLDDAQLPHEGILASVTQEFAGLGGTSDFYKLTGKAKWYYTLHDEADIIGSL 631

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSF 696
               G +  ++ +L++FDQF ++SN  +RGF   G+GPR++   A+GG  Y +ASA  +F
Sbjct: 632 SGSAGHLFETSGSLEVFDQFQLNSN-DIRGFERNGLGPRMNNGDALGGTTYFTASAEATF 690

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVALG-ADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           P+P +P  +G RGA FVD+ TLY N V +G  + + G+++  R S GV ++W SP G + 
Sbjct: 691 PLPGLPRDSGFRGALFVDAGTLYGNDVEIGPGESVRGDNASLRASVGVSLIWASPFGPLR 750

Query: 756 VYYGIPLRHREGDKIQQFGFRI 777
           V Y +P+   + D++Q F F I
Sbjct: 751 VDYAVPVAKEDFDEVQNFKFGI 772


>gi|86357541|ref|YP_469433.1| outer membrane lipoprotein [Rhizobium etli CFN 42]
 gi|86281643|gb|ABC90706.1| outer membrane lipoprotein [Rhizobium etli CFN 42]
          Length = 779

 Score =  567 bits (1462), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 299/746 (40%), Positives = 467/746 (62%), Gaps = 9/746 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++++RI++RGA+ VG E + S + +  G+S S+ D+D++VK +Y  GYFS+VKI + 
Sbjct: 36  AEAAVIQRIDVRGASRVGAEAVRSNLTITPGKSFSNTDIDNSVKQLYGTGYFSDVKISVS 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L++++ E +++N + F+GN  +KDD+L  IV++ +A  Y +  + +D+  IK AYA+
Sbjct: 96  GGTLVVNVQEAQLVNQVVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQSDIQAIKDAYAA 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G   V V  Q   +    +N+ +VI EG + KI+SI FVGN  YS  RL  VI+ + S 
Sbjct: 156 TGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSN 215

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
           + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD+  + Y L F I+EG
Sbjct: 216 FLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDASFDEATNKYTLTFNIEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  G +++QST++ +    LL L+R + G++Y+ +E+++S E IS    S   PF RV
Sbjct: 276 QRYDFGPVTVQSTVEGVGSDQLLPLVRTKEGHVYSAKEVQKSIEAISDQVASAGYPFARV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD     + +EYL+DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N  MI
Sbjct: 336 TPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMI 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS-VGIATNYEVDKGMGVE 459
            +AKRR+ A GYFS VNIS  P +   D V++ V V+  S GS    A       G+ +E
Sbjct: 396 TKAKRRLEALGYFSSVNISTQPGSS-PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLE 454

Query: 460 GHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL-EDGSL 518
             I++ NF G+G   R++AG G+   + Y  S  +PYFLG  ++AGFD+  +    + + 
Sbjct: 455 ASIEEKNFLGRGQYIRISAGGGQEGSRAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNY 514

Query: 519 DINDESAAVRMIVPITESISTSFKYDLRFLQYGAI-SEKEKIPSIYTTLIEHGKFSSHSI 577
           D  + S  +R+  PITE ++T+F+Y+ + ++Y A  S+   + + Y  L+E   ++  S+
Sbjct: 515 DYEETSVVLRVTAPITEDLATTFRYNYKQMKYDADNSDLSDLSAPYQHLVEDSPWTRSSV 574

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQ++ YNTLD+ ++PR+G+  +++ + AG GGDSQ+++I  +A Y++LL+DD+DI+GS+ 
Sbjct: 575 SQTLTYNTLDDTVLPREGIYATATQEIAGLGGDSQFYKIYGKARYYHLLADDADIIGSVS 634

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV--DKKYAIGGKIYSSASAAVS 695
              G V+   ++L +FDQF++ +N  +RGF  KGIGPRV  D    +GG  Y +ASA  +
Sbjct: 635 ASAGYVVGFGEHLNVFDQFTL-TNGDIRGFENKGIGPRVRGDNDDPLGGTTYFTASAEAT 693

Query: 696 FPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           FPMP  P    LRGA F D+ TL+ N V L  D +EG D+  R S GV ++W SP G + 
Sbjct: 694 FPMPGFPRDFNLRGAVFADAGTLFGNDVDLRGDGIEGEDASLRASVGVGVVWQSPFGSLR 753

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNRM 781
           + Y IP+   + DK Q F F I N+ 
Sbjct: 754 LDYAIPVLKEDFDKTQNFKFGINNQF 779


>gi|190891614|ref|YP_001978156.1| outer membrane lipoprotein [Rhizobium etli CIAT 652]
 gi|190696893|gb|ACE90978.1| outer membrane lipoprotein [Rhizobium etli CIAT 652]
          Length = 779

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 299/746 (40%), Positives = 466/746 (62%), Gaps = 9/746 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++++RI++RGA+ VG E + S + +  G+S S+ D+D++VK +Y  GYFS+VKI + 
Sbjct: 36  AEAAVIQRIDVRGASRVGAEAVRSNLTITPGKSFSNTDIDNSVKQLYGTGYFSDVKISVS 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L+++L E +++N + F+GN  +KDD+L  IV++ +A  Y +  + +D+  IK+AYA+
Sbjct: 96  GGTLVVNLQEAQLVNQVVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQSDIQAIKEAYAA 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G   V V  Q   +    +N+ +VI EG + KI+SI FVGN  YS  RL  VI+ + S 
Sbjct: 156 TGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSN 215

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
           + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD+  + Y L F I+EG
Sbjct: 216 FLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDASFDEATNKYTLTFNIEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  G +++QST++ +    LL L+R + G++Y+ +E+++S E IS    S   PF RV
Sbjct: 276 QRYDFGPVTVQSTVEGVGSDQLLPLVRTKEGHVYSAKEVQKSIEAISDQVASAGYPFARV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD     + +EYL+DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N  MI
Sbjct: 336 TPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMI 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS-VGIATNYEVDKGMGVE 459
            +AKRR+ A GYFS VNIS  P +   D V++ V V+  S GS    A       G+ +E
Sbjct: 396 TKAKRRLEALGYFSSVNISTQPGSS-PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLE 454

Query: 460 GHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL-EDGSL 518
             I++ NF G+G   R++AG G+   + Y  S  +PYFLG  ++AGFD+  +    + + 
Sbjct: 455 ASIEEKNFLGRGQYIRISAGGGQEGSRAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNY 514

Query: 519 DINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK-EKIPSIYTTLIEHGKFSSHSI 577
           D  + S  +R+  PITE ++T+F+Y+ + ++Y A +     + + Y  L+E   ++  SI
Sbjct: 515 DYEETSVVLRVTAPITEDLATTFRYNYKQMKYDADNNDLSDLSAPYQHLVEDSPWTRSSI 574

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQ++ YNTLD+ ++PR+G+  +++ + AG GGDSQ+++I  +A Y++LL+DD+DI+GS+ 
Sbjct: 575 SQTLTYNTLDDTVLPREGIYATATQEIAGLGGDSQFYKIYGKARYYHLLADDADIIGSVS 634

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV--DKKYAIGGKIYSSASAAVS 695
              G V+   ++L +FDQF++ +N  +RGF  KGIGPRV       +GG  Y +ASA  +
Sbjct: 635 ASAGYVVGFGEHLNVFDQFTL-TNGDIRGFENKGIGPRVAGTNDDPLGGTTYFTASAEAT 693

Query: 696 FPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           FPMP  P    LRGA F D+ TL+ N V L  D +EG D+  R S GV ++W SP G + 
Sbjct: 694 FPMPGFPRDFNLRGAVFADAGTLFGNDVDLRGDGIEGEDASLRASVGVGVVWQSPFGSLR 753

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNRM 781
           + Y IP+   + DK Q F F I N+ 
Sbjct: 754 LDYAIPVLKEDFDKTQNFKFGINNQF 779


>gi|327189229|gb|EGE56408.1| outer membrane lipoprotein [Rhizobium etli CNPAF512]
          Length = 779

 Score =  565 bits (1456), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 298/746 (39%), Positives = 466/746 (62%), Gaps = 9/746 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++++RI++RGA+ VG E + S + +  G+S S+ D+D++VK +Y  GYFS+VKI + 
Sbjct: 36  AEAAVIQRIDVRGASRVGAEAVRSNLTITPGKSFSNTDIDNSVKQLYGTGYFSDVKISVS 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L++++ E +++N + F+GN  +KDD+L  IV++ +A  Y +  + +D+  IK+AYA+
Sbjct: 96  GGTLVVNVQEAQLVNQIVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQSDIQAIKEAYAA 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G   V V  Q   +    +N+ +VI EG + KI+SI FVGN  YS  RL  VI+ + S 
Sbjct: 156 TGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSN 215

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
           + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD+  + Y L F I+EG
Sbjct: 216 FLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDASFDEATNKYTLTFNIEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  G +++QST++ +    LL L+R + G++Y+ +E+++S E IS    S   PF RV
Sbjct: 276 QRYDFGPVTVQSTVEGVGSDQLLPLVRTKEGHVYSAKEVQKSIEAISDQVASAGYPFARV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD     + +EYL+DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N  MI
Sbjct: 336 TPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMI 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS-VGIATNYEVDKGMGVE 459
            +AKRR+ A GYFS VNIS  P +   D V++ V V+  S GS    A       G+ +E
Sbjct: 396 TKAKRRLEALGYFSSVNISTQPGSS-PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLE 454

Query: 460 GHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL-EDGSL 518
             I++ NF G+G   R++AG G+   + Y  S  +PYFLG  ++AGFD+  +    + + 
Sbjct: 455 ASIEEKNFLGRGQYIRISAGGGQEGSRAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNY 514

Query: 519 DINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK-EKIPSIYTTLIEHGKFSSHSI 577
           D  + S  +R+  PITE ++T+F+Y+ + ++Y A +     + + Y  L+E   ++  SI
Sbjct: 515 DYEETSVVLRVTAPITEDLATTFRYNYKQMKYDADNNDLSDLSAPYQHLVEDSPWTRSSI 574

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQ++ YNTLD+ ++PR+G+  +++ + AG GGDSQ+++I  +A Y++LL+DD+DI+GS+ 
Sbjct: 575 SQTLTYNTLDDTVLPREGIYATATQEIAGLGGDSQFYKIYGKARYYHLLADDADIIGSVS 634

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV--DKKYAIGGKIYSSASAAVS 695
              G V+   ++L +FDQF++ +N  +RGF  KGIGPRV       +GG  Y +ASA  +
Sbjct: 635 ASAGYVVGFGEHLNVFDQFTL-TNGDIRGFENKGIGPRVAGTNDDPLGGTTYFTASAEAT 693

Query: 696 FPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           FPMP  P    LRGA F D+ TL+ N V L  D +EG D+  R S GV ++W SP G + 
Sbjct: 694 FPMPGFPRDFNLRGAVFADAGTLFGNDVDLRGDGIEGEDASLRASVGVGVVWQSPFGSLR 753

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNRM 781
           + Y IP+   + DK Q F F I N+ 
Sbjct: 754 LDYAIPVLKEDFDKTQNFKFGINNQF 779


>gi|209549189|ref|YP_002281106.1| outer membrane protein assembly complex, YaeT protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534945|gb|ACI54880.1| outer membrane protein assembly complex, YaeT protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 779

 Score =  565 bits (1455), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 300/746 (40%), Positives = 463/746 (62%), Gaps = 9/746 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++++RI++RGA+ VG E + S + +  G+S S+ D+D +VK +Y  GYFS+VKI + 
Sbjct: 36  AEAAVIQRIDVRGASRVGAEAVRSNLTIAPGKSFSNTDIDESVKQLYGTGYFSDVKISVS 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
            S L++++ E +++N + F+GN  +KDD+L  IV++ +A  Y +  + +D+ +IK AYA+
Sbjct: 96  GSTLVVNVQEAQLVNQVVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQSDIQSIKDAYAA 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G   V V  Q   +    +N+ +VI EG + KI+SI FVGN  YS  RL  VI+ + S 
Sbjct: 156 TGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSN 215

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
           + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD   + Y L F I+EG
Sbjct: 216 FLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDATFDDATNKYTLTFNIEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  G +++QST++ +  + L  L+R   G++YN +E+++S E IS    S   PF RV
Sbjct: 276 QRYDFGPVTVQSTVEGVGSEQLQPLVRTHEGHVYNAKEVQKSIEAISDQVASAGYPFARV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD     + +EYL+DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N  MI
Sbjct: 336 TPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMI 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS-VGIATNYEVDKGMGVE 459
            +AKRR+ A GYFS VNIS  P +   D V++ V V+  S GS    A       G+ +E
Sbjct: 396 TKAKRRLEALGYFSSVNISTQPGSS-PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLE 454

Query: 460 GHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL-EDGSL 518
             I++ NF G+G   R++AG G+   + Y  S  +PYFLG  ++AGFD+  +    + + 
Sbjct: 455 ASIEEKNFLGRGQYIRISAGGGQEGSRAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNY 514

Query: 519 DINDESAAVRMIVPITESISTSFKYDLRFLQYGA-ISEKEKIPSIYTTLIEHGKFSSHSI 577
           D  + S  +R+  PITE ++T+F+Y+ + ++Y A  S+   + + Y  L+E   ++  SI
Sbjct: 515 DYEETSVVLRVTAPITEDLATTFRYNYKQMKYDADSSDLSDLSAPYQHLVEDSPWTRSSI 574

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
           SQ++ YNTLD+ ++PR+G+  +++ + AG GGDSQ+++I  +A Y+ LL+DD+DI+GS+ 
Sbjct: 575 SQTLTYNTLDDTVLPREGIYATATQELAGLGGDSQFYKIYGKARYYRLLADDADIIGSVS 634

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD--KKYAIGGKIYSSASAAVS 695
              G VI    +L +FDQF++ +N  +RGF  KGIGPRV       +GG  Y +ASA  +
Sbjct: 635 ASAGYVIGLGDHLNVFDQFTL-TNGDIRGFENKGIGPRVSGTNDDPLGGTTYFTASAEAT 693

Query: 696 FPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           FPMP  P    LRGA F D+ TL+ N V L  D ++G D+  R S GV ++W SP G + 
Sbjct: 694 FPMPGFPRDFNLRGAVFADAGTLFGNDVDLRGDGIDGEDASLRASVGVGVVWQSPFGSLR 753

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNRM 781
           + Y IP+   + DK Q F F I N+ 
Sbjct: 754 LDYAIPVLKEDFDKTQNFKFGINNQF 779


>gi|227821904|ref|YP_002825874.1| group 1 outer membrane protein precursor [Sinorhizobium fredii
           NGR234]
 gi|227340903|gb|ACP25121.1| group 1 outer membrane protein precursor [Sinorhizobium fredii
           NGR234]
          Length = 777

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 305/743 (41%), Positives = 469/743 (63%), Gaps = 13/743 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  +++ R+E+RGAT V  E + + I +V G+S S+AD+D +VK +YA GYFS+V I I 
Sbjct: 36  AQAAVISRVEVRGATRVSPETVRANITIVPGKSFSNADIDASVKRLYATGYFSDVSISIS 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L++++ E +++N + F+GN  +KDD+L+ +VR++    Y E TV  D+  IK AYA+
Sbjct: 96  GGTLVVNVSENQLVNQVVFNGNRKIKDDKLQGVVRTQPLGPYSEATVETDIQAIKDAYAA 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
           IG  +V V  Q   I+   +N+ +VI EG + KI  I FVGN+ YS  RL+ VI+ + SG
Sbjct: 156 IGRSDVTVTTQVVPIAEGRVNLAFVINEGERTKITQINFVGNEAYSDGRLQSVIATKESG 215

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
            FSF  + DVY+ +++  DEE +R FY++RGYA    +SS+   ++  + Y +   ++EG
Sbjct: 216 IFSFLTRKDVYNPDKLRADEELLRQFYYNRGYADFNIISSEATLNEATNEYTVTITVEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
             Y  G I+++ST++ +  + L  L++ R G++Y  ++I+++  +ISK   S   PF RV
Sbjct: 276 PRYDFGAINVESTVEGVNAEELKGLVQSREGSVYKAKDIQDTMSEISKRVASAGYPFARV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD A   + ++YL+DQG   YV+RIEI GN ++ D VIRRE ++ EGD  N  MI
Sbjct: 336 TPRGNRDLANHTIAVDYLVDQGERAYVERIEIRGNTRTRDYVIRREFDVGEGDAFNQEMI 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG--V 458
            RAKRR+ A GYFS VNI+  P +  +D VI+ V V+  S GS GI   Y    G G  V
Sbjct: 396 ARAKRRLEALGYFSSVNITTAPGS-AADRVIVVVDVQDQSTGSFGIGAGYAAGSGGGFLV 454

Query: 459 EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTH--LEDG 516
           E  I++ NF G+G   RLAAG G  + Q Y  S  +PYFLG  ++AGFDL K     +D 
Sbjct: 455 EASIEEKNFLGRGQYIRLAAGKGEDS-QTYNVSFTEPYFLGYRLAAGFDLFKNEHDFDDD 513

Query: 517 SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHS 576
           +   ND+  ++R+  PITE++ST+ +Y+   L+Y    +++++ S Y  ++E   ++  S
Sbjct: 514 NYSYNDQGFSLRVTAPITENLSTTLRYNYTELEY--FGDQDELSSPYDRVVEDSPWTRSS 571

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           +SQS+ YNTLD+  +P +G+L S + ++AG GG S ++++  +A ++Y ++D++DI+ SL
Sbjct: 572 VSQSVTYNTLDDAQLPHEGILASVTQEFAGLGGTSDFYKLTGKAKWYYTVNDEADIIASL 631

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSF 696
               G +  ++ ++++FDQF + SN  +RGF   GIGPRV+   A+GG  Y +ASA  SF
Sbjct: 632 AGSAGHLFKTSGSMEVFDQFQLGSN-DIRGFERNGIGPRVNNGDALGGTTYFTASAEASF 690

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVAL-GADKL-EGNDSFWRVSTGVEIMWNSPLGMM 754
           P+P +P  +G RGA FVD+ TLY N VAL GA +  EG D+  RVS GV ++W SP G +
Sbjct: 691 PLPGIPRDSGFRGALFVDAGTLYGNDVALTGAGEFAEGTDASLRVSVGVSLIWASPFGPL 750

Query: 755 GVYYGIPLRHREGDKIQQFGFRI 777
            V Y +P+   + D+IQ F F I
Sbjct: 751 RVDYAVPVAKEDFDEIQNFKFGI 773


>gi|222085864|ref|YP_002544395.1| outer membrane lipoprotein [Agrobacterium radiobacter K84]
 gi|221723312|gb|ACM26468.1| outer membrane lipoprotein [Agrobacterium radiobacter K84]
          Length = 777

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 293/740 (39%), Positives = 458/740 (61%), Gaps = 9/740 (1%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++RI++RGA  VG + +   + +  G+S S  D+D++VK +YA GYFS+V + +    L+
Sbjct: 41  IQRIDVRGAERVGVDAVRDNLTIKPGKSFSPGDIDNSVKQLYATGYFSDVHVTVSGGTLV 100

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + + E ++IN + F+GN  +KDD+L+ +V++ +A  Y E  V AD+  IK AYA+IG  +
Sbjct: 101 VSVKENQLINAVVFNGNRKIKDDKLQGVVQTHAAGPYSETQVQADIKTIKDAYAAIGRND 160

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
           V V  Q   ++   +N+ +VI EG + KI+ I F GN+ Y+  RL  VIS + + + SF 
Sbjct: 161 VQVTTQTVPVAQGRINVAFVINEGDRTKIDKINFSGNQAYNSGRLASVISTKKTNFMSFL 220

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEGEIYTV 285
            + DVYS +R   D++A+R FY++ GYA  + VS+    ++Q + Y L F +DEG  YT 
Sbjct: 221 TRKDVYSADRQQADQDALRQFYYNHGYADFRIVSADATLNEQNNEYTLNFSVDEGPRYTY 280

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G+I++ ST+  +  + L SL+  + GN+Y+ ++I+ S E ISK   S   PF R+  R N
Sbjct: 281 GDINVVSTVDGVNAEDLKSLVITQKGNVYSAKDIQTSIENISKRVASAGYPFARITPRGN 340

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           RD +   + IEYL+DQG   YV+RIEI GN ++ D VIRRE +++EGD  N  MI RAKR
Sbjct: 341 RDLSGHTIGIEYLVDQGERAYVERIEIRGNTRTRDYVIRREFDINEGDAFNQEMISRAKR 400

Query: 406 RIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV--DKGMGVEGHID 463
           R+ A GYF++V+IS  P +   D V++ V+V+    GS GI   Y V  + G+ +E  ++
Sbjct: 401 RLDALGYFTKVDISTAPGS-APDRVVVVVNVEDQPTGSFGIGAGYAVGNNGGLLLEASVE 459

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL-EDGSLDIND 522
           + NF G+G   R+AAG G    + Y  S  +PYFLG  ++AGFD+ K     D   D ++
Sbjct: 460 EKNFLGRGQYIRIAAGAGTEGNRTYNISFTEPYFLGYRLAAGFDIFKNQTSSDDYYDYSE 519

Query: 523 ESAAVRMIVPITESISTSFKYDLRFLQYGAISEKE-KIPSIYTTLIEHGKFSSHSISQSI 581
           E  ++R+  PITE+++T+ +Y+ + L Y   ++ E  + + Y  L+ +G +   +ISQ+ 
Sbjct: 520 EGFSLRVTAPITENLATTLRYNYKRLTYDGTNDWEDNLSAPYQNLVLNGPWIQSTISQTF 579

Query: 582 IYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYG 641
            YNTLD+  +PR+G++   +++YAG GGDS ++++  +A Y+ ++SD++DI+GSL  G G
Sbjct: 580 TYNTLDDQNLPREGIIAKFTHEYAGLGGDSDFYKLSGKARYYKMISDEADIIGSLTVGAG 639

Query: 642 CVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLV 701
            V+P++  L +FDQF++     +RGF   GIGPR      +GG  Y +ASA  S PMP V
Sbjct: 640 YVMPTDGKLNVFDQFTLGGR-EIRGFENAGIGPRTSNGDPLGGTTYVTASAEASMPMPGV 698

Query: 702 PERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
           P+  GLR A F D+ TLY N   L  D L  NDS  R S G  ++W+SP G++ V Y +P
Sbjct: 699 PQDIGLRLAAFADAGTLYGNKANLFGDVLH-NDSSIRASLGAGLIWSSPFGVIRVDYAVP 757

Query: 762 LRHREGDKIQQFGFRIGNRM 781
           +   + DK++ F F I N+ 
Sbjct: 758 VLKEDYDKVENFRFGIANQF 777


>gi|325292744|ref|YP_004278608.1| group 1 outer membrane protein precursor [Agrobacterium sp. H13-3]
 gi|325060597|gb|ADY64288.1| group 1 outer membrane protein precursor [Agrobacterium sp. H13-3]
          Length = 774

 Score =  552 bits (1422), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/743 (39%), Positives = 456/743 (61%), Gaps = 11/743 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +N +++ +I++RGA   G + + S I +  G++ S++D+D +VK +YA GYFSNV +++ 
Sbjct: 35  ANAAVISKIDVRGAERSGADSVRSNITIAPGKNFSNSDIDESVKRLYATGYFSNVSMRVS 94

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
            S L++ + E +++N + F+GN  +KDD+L  +V+++    +++  V AD+  IK+AY++
Sbjct: 95  GSTLVVTVNENQLVNQVVFNGNRKIKDDKLAGVVQTQPLGPFNQAIVTADIARIKEAYSA 154

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
           IG  +V +  Q  S+    +NI +VI EG + KI  I FVGN +YS  RL  VI+ + S 
Sbjct: 155 IGRSDVEITTQTVSVGQGRVNIAFVINEGERTKIGRIDFVGNNSYSDGRLAAVINTKKSN 214

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
             SF  + DVY+++++  DEEA+R FY++RGYA  + VSS  + D+ K+ Y +   +DEG
Sbjct: 215 MLSFLTRKDVYNEDKLRADEEALRQFYYNRGYADFRVVSSDAVLDESKNEYTISITVDEG 274

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  GN++++ST+  I    L  L+  R G  Y+ +E+++S E ISK       PF RV
Sbjct: 275 KKYDFGNVAVESTVPGIDGSELQGLVETRQGASYSAKEVQQSMEAISKRVAGEGYPFARV 334

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R +RD +   + + Y++DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N ++I
Sbjct: 335 TPRGDRDMSGNTIGVTYIVDQGERAYVERIEIRGNTRTRDYVIRREFDISEGDAFNQTVI 394

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             AKRR+ A GYFS+VN+S        D V++ V V+  S GS GI   Y  + G+ +E 
Sbjct: 395 TAAKRRLEALGYFSKVNVS-TAGGSAPDRVVIVVDVEDQSTGSFGIGAGYSQNDGVLLEA 453

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTH-LEDGSLD 519
            I++ NF G+G   RLAAG G    ++YT S  +PYFLG  ++AGFDL K+    +   D
Sbjct: 454 SIEEKNFLGRGQYIRLAAGAGEDDARSYTLSFTEPYFLGYRLAAGFDLFKSQSRSEDYYD 513

Query: 520 INDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKE---KIPSIYTTLIEHGKFSSHS 576
            +++  A+R+  PITE++ST+FKY  + L Y    + E    +   Y  LI  G ++   
Sbjct: 514 YDEQGFALRVTAPITENLSTTFKYTYKQLNYDGEGDWETGSNLAEPYKALIRGGDWTQSI 573

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           IS ++ YNTLD+  +PR+G   + + ++AG GGDS+Y++I ++A ++Y LSD+ D++GSL
Sbjct: 574 ISNTLNYNTLDDRNMPREGWQAALTNEFAGLGGDSEYYKIYAKARFYYTLSDEYDVIGSL 633

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSF 696
               G V+P+  NL +FDQF       +RGF   GIGPR+    +IGG  Y +ASA V+ 
Sbjct: 634 TGQAGHVVPTGDNLLVFDQFKFGGR-QVRGFKNDGIGPRIGSD-SIGGTTYFAASAEVTA 691

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGV 756
           PMP VPE  GLR A FVD+ TLY N VA      +  D+  R S G+ +MW SP G + V
Sbjct: 692 PMPGVPEDFGLRLAGFVDAGTLYGNKVANSTGVKD--DNSIRASAGIGVMWASPFGPIRV 749

Query: 757 YYGIPLRHREGDKIQQFGFRIGN 779
            Y +P+   + D+ Q+F F + N
Sbjct: 750 DYAVPIAKEDYDEEQRFRFGMSN 772


>gi|222148855|ref|YP_002549812.1| group 1 outer membrane protein precursor [Agrobacterium vitis S4]
 gi|221735841|gb|ACM36804.1| group 1 outer membrane protein precursor [Agrobacterium vitis S4]
          Length = 778

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 286/742 (38%), Positives = 447/742 (60%), Gaps = 10/742 (1%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +++RI++RGAT VG E + S + +  G++ S++D+D +VK +YA GYFS+VKI +  S L
Sbjct: 40  LIQRIDVRGATRVGTEAVRSNLTIQPGKAFSNSDIDDSVKRLYATGYFSDVKISVSGSAL 99

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYL 166
           ++ + E +++N + F+GN  +KDD+L  +V+++    Y ++ + AD++ IKQAYA+IG  
Sbjct: 100 VVTVNENQLVNQVVFNGNRKIKDDKLTTVVQTQPLGPYSQELIQADINRIKQAYAAIGRS 159

Query: 167 NVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF 226
            V V  Q   + P  +N+ +VI EG + KI +I FVGN  Y  +RL  VIS + S   SF
Sbjct: 160 EVEVTTQTAPVGPGRVNLAFVINEGDRTKIAAINFVGNHAYGDSRLAAVISTKKSNPLSF 219

Query: 227 -GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYT 284
             + DVY+ +++  DEEA+R FY++ GYA  ++ SS    ++Q + Y +   +DEG+ Y 
Sbjct: 220 LTRKDVYNDDKLKADEEALRQFYYNHGYADFRITSSDASLNEQTNEYTVNITVDEGQRYK 279

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
             +I+++S+++ +    L  L+    G +Y+ +EI++S E I +   +   PF RV  R 
Sbjct: 280 FSDINVESSVEGVDPTELKGLVTTSPGGVYSAREIQKSMEAIQQRVSAKGYPFARVVPRG 339

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAK 404
           NRD     + + Y++DQG   YV+RIE++GN ++ D VIRRE ++SEGD  N  +I RAK
Sbjct: 340 NRDMGNGTIGVTYMVDQGERAYVERIEVKGNTRTRDYVIRREFDISEGDAFNQEVITRAK 399

Query: 405 RRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV-DKGMGVEGHID 463
           RR+ A GYFS VNI+    +   D VI+ V+V+  S GS GI   Y V   G+ +E  ++
Sbjct: 400 RRLEALGYFSSVNITTAQGS-APDRVIIVVNVEDQSTGSFGIGAGYSVGGDGLILEASVE 458

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS-LDIND 522
           + NF G+G   R+AAG G    Q Y  S  +PYFLG  ++ GFDL K+        D N+
Sbjct: 459 EKNFLGRGQYIRIAAGAGTDDSQTYNLSFTEPYFLGYRLAVGFDLFKSSTSSNDYYDYNE 518

Query: 523 ESAAVRMIVPITESISTSFKYDLRFLQYGAISE-KEKIPSIYTTLIEHGKFSSHSISQSI 581
           +   +R+  PITE ++T+F+Y  + ++Y  + +    +   Y  LI    +   S+SQ++
Sbjct: 519 QGGTLRVTAPITEDLATTFRYTYKQIKYKGVDDWTTSLSQPYQDLINGSPWVVSSVSQTL 578

Query: 582 IYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYG 641
            YNTLD+  +P +G+  + ++++AG GGDS+Y+++  +A  F  LSD+ DI+GSL FG G
Sbjct: 579 TYNTLDDKNLPHEGIYATFTHEFAGLGGDSEYYKLYGKARIFKSLSDEQDIIGSLSFGAG 638

Query: 642 CVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY--AIGGKIYSSASAAVSFPMP 699
            V+ +  NL +FDQF +     +RGF   GIG R+  +   ++GG  Y +ASA  S P+P
Sbjct: 639 HVMATGDNLNVFDQFQIGGK-EIRGFENNGIGVRMPNRNDDSLGGTTYFTASAEASMPIP 697

Query: 700 LVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            VP+ AG R A F D+ TLY N V   +   +G D  WR S G  I+W SP G +   Y 
Sbjct: 698 GVPQDAGFRIAVFSDAGTLYGNDVK-NSGGAQGEDMAWRASVGAGIVWASPFGPLRFDYA 756

Query: 760 IPLRHREGDKIQQFGFRIGNRM 781
            P+   + DK+QQF F I N+ 
Sbjct: 757 QPILKEDYDKVQQFRFSIANQF 778


>gi|15888707|ref|NP_354388.1| group 1 outer membrane protein precursor [Agrobacterium tumefaciens
           str. C58]
 gi|15156447|gb|AAK87173.1| group 1 outer membrane protein precursor [Agrobacterium tumefaciens
           str. C58]
          Length = 774

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 288/743 (38%), Positives = 454/743 (61%), Gaps = 11/743 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +N +++ +I++RGA   G + + S I +  G++ S++D+D +VK +YA GYFSNV +++ 
Sbjct: 35  ANAAVISKIDVRGAERSGADSVRSNITIAPGKNFSNSDIDESVKRLYATGYFSNVSMRVS 94

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
            S L++ + E +++N + F+GN  +KDD+L  IV+++    +++  V AD+  IK+AY++
Sbjct: 95  GSTLVVTVNENQLVNQVVFNGNRKIKDDKLAGIVQTQPMGPFNQAIVTADIARIKEAYSA 154

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
           IG  +V +  Q  S+    +NI +VI EG + KI  I F+GN +YS  RL  VI+ + S 
Sbjct: 155 IGRSDVEITTQTVSVGQGRVNIAFVINEGERTKIGRIDFIGNNSYSDGRLAAVINTKKSN 214

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
             SF  + DVY+++++  DEEA+R FY++RGYA  + VSS  + D+ K+ Y +   +DEG
Sbjct: 215 MLSFLTRKDVYNEDKLRADEEALRQFYYNRGYADFRVVSSDAVLDESKNEYTISITVDEG 274

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  GN++++ST+  +    L  L+  R G  Y+ +E+++S E ISK       PF RV
Sbjct: 275 KKYDFGNVAVESTVPGVDGSELQGLVETRQGASYSAKEVQQSMEAISKRVAGEGYPFARV 334

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R +RD +   + + Y++DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N ++I
Sbjct: 335 TPRGDRDMSGNTIGVTYIVDQGERAYVERIEIRGNTRTRDYVIRREFDISEGDAFNQTII 394

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             AKRR+ A GYFS+VNIS        D V++ V V+  S GS GI   Y  + G+ +E 
Sbjct: 395 TAAKRRLEALGYFSKVNIS-TAGGSAPDRVVIVVDVEDQSTGSFGIGAGYSQNDGVLLEA 453

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLE-DGSLD 519
            +++ NF G+G   R+AAG G    + Y+ S  +PYFLG  ++AGFDL K   + +   +
Sbjct: 454 SVEEKNFLGRGQYIRVAAGAGEDDARTYSLSFTEPYFLGYRLAAGFDLFKNQSKSEDYYN 513

Query: 520 INDESAAVRMIVPITESISTSFKYDLRFLQY---GAISEKEKIPSIYTTLIEHGKFSSHS 576
            +++  A+R+  PITE++ST+FKY  + + Y   G       +   Y  LI    ++   
Sbjct: 514 YDEQGFALRVTAPITENLSTTFKYTYKQINYEGKGDWQNNANLAEPYQALIRGEDWTQSI 573

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           +S ++ YNTLD+  +PR+G   + + ++AG GGDS+Y++I ++A Y+Y LSD+ D++GSL
Sbjct: 574 LSNTLNYNTLDDRNMPREGWQAALTNEFAGLGGDSEYYKIYAKARYYYTLSDEYDVIGSL 633

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSF 696
               G V+P+  NL +FDQF       +RGF   GIGPR+    +IGG  Y +ASA V+ 
Sbjct: 634 TGQAGHVMPTGDNLLVFDQFKFGGR-QVRGFKNDGIGPRIGSD-SIGGTTYFAASAEVTA 691

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGV 756
           PMP VPE  GLR A FVD+ T+Y N V+    +   +D+  R S G+ +MW SP G + V
Sbjct: 692 PMPGVPEDFGLRLAGFVDAGTMYGNKVS--TSQTVKDDNSIRASAGIGVMWASPFGPIRV 749

Query: 757 YYGIPLRHREGDKIQQFGFRIGN 779
            Y IP+   + D+ Q+F F + N
Sbjct: 750 DYAIPIAKEDYDEEQRFRFGMSN 772


>gi|239832041|ref|ZP_04680370.1| outer membrane protein assembly complex, YaeT protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239824308|gb|EEQ95876.1| outer membrane protein assembly complex, YaeT protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 808

 Score =  502 bits (1293), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 280/763 (36%), Positives = 439/763 (57%), Gaps = 17/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A   L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 49  AALSLASVNVAGAAVVSRIEVRGNTRVDAQSIRDNIDIRPGKAFTSADIDAAVKRLFAMG 108

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S L++++ ER ++N++ F GN  +KD  L   V+ ++ + YD  T+ AD
Sbjct: 109 LFSDVRINQSGSTLVVNVTERSVVNNVLFQGNKKIKDPDLARAVQLKARSPYDAATMEAD 168

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
           V  IK AYA IG  +  V  +   +    +N+ Y I EG + KI ++ FVGN+ +S  RL
Sbjct: 169 VEAIKGAYAHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANVDFVGNQAFSARRL 228

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 229 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVISSNAVLDPSTNE 288

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG+ YT GN+S++S +  +  + L  L++ RSG  Y+ +EI++S   +++  
Sbjct: 289 YTITITVDEGQRYTFGNVSVESNVAGVDGQALDHLVKTRSGKPYSAKEIEDSVLAVTENV 348

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +RDF  R + + Y +D+G   Y++RIEI GND++ D VIRRE +++
Sbjct: 349 AGSGYAFAKVEPRGDRDFENRTISVVYSVDEGPRAYIQRIEIRGNDKTRDFVIRREFDVN 408

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 409 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 467

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 468 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 527

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++T+  +   D+      +R  +PIT++ S    Y+L   ++  + A ++    P++ 
Sbjct: 528 VFRRTYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRADADNYYAPALL 587

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               EH  +   SIS S+ YN++D+   P  G+    + ++AG GGD++Y +   + +Y+
Sbjct: 588 EAA-EHSPWLRSSISYSLTYNSIDDMKNPHDGLYGKFTQEFAGLGGDAKYIKTTFKGNYY 646

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  +S+  +RGF + GIGP  D    K
Sbjct: 647 KTLSQEADIVGMLGIGGGYIHEFGDDGVRIFDLFKNNSD-IIRGFKFNGIGPYQDAANGK 705

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y + +A V FPMPLVPE  G+RGA F D+ATLY N  + G   + G+D   R
Sbjct: 706 RYWMGGTTYINGTAEVQFPMPLVPESLGIRGAVFADAATLYGNDSSQGGSPIYGDDKKLR 765

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 766 ASAGVSLMWASPFGPLRFDYAFPIAKADTDKVQNFNFGVSTKF 808


>gi|153009366|ref|YP_001370581.1| surface antigen (D15) [Ochrobactrum anthropi ATCC 49188]
 gi|151561254|gb|ABS14752.1| surface antigen (D15) [Ochrobactrum anthropi ATCC 49188]
          Length = 785

 Score =  498 bits (1282), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 277/763 (36%), Positives = 436/763 (57%), Gaps = 17/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A   L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AALSLASVNVAEAAVVSRIEVRGNTRVDAQSIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S L++++ ER ++N++ F GN  +KD  L   V+ +  + YD  T+ AD
Sbjct: 86  LFSDVRINQSGSTLVVNVSERSVVNNVLFQGNKKIKDPDLTRAVQLKPRSPYDAATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
           V  IK AYA IG  +  V  +   +    +N+ Y I EG + KI ++ FVGN+ +   RL
Sbjct: 146 VEAIKGAYAHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANVDFVGNQAFGSRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVISSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG+ YT GN+S++S +  +  + L  L++ RSG  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGQRYTFGNVSVESNVDGVDGQALDHLVKTRSGKPYSAKEIEDSVLAVTENV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +RDF    + + Y +D+G   Y++RIEI GND++ D VIRRE +++
Sbjct: 326 AGSGYAFAKVEPRGDRDFENHTISVVYSVDEGPRAYIQRIEIRGNDKTRDFVIRREFDMN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++T+  +   D+      +R  +PIT++ S    Y+L   ++  + A ++    P++ 
Sbjct: 505 VFRRTYRVNDDYDVEQTGGTIRFGLPITDNFSAGLAYNLVQEKYDLFRADADNYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               EH  +   SIS S+ YN++D+   P  G+    + ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AEHSPWLRSSISYSLTYNSIDDMKNPHDGLYGKFTQEFAGLGGDAKYIKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  +S+  +RGF + GIGP  D    K
Sbjct: 624 KTLSQEADIVGMLGIGGGYIHEFGDDGVRIFDLFKNNSD-IIRGFKFNGIGPYQDAANGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y + +A V FPMPLVPE  G+RGA F D+ATLY N  + G   + G+D   R
Sbjct: 683 RYWMGGTTYINGTAEVQFPMPLVPESLGIRGALFADAATLYGNDSSQGGSPIYGDDKKLR 742

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S G+ +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 743 ASAGISLMWASPFGPLRFDYAFPIAKADTDKVQNFNFGVSTKF 785


>gi|62290067|ref|YP_221860.1| surface antigen [Brucella abortus bv. 1 str. 9-941]
 gi|82699993|ref|YP_414567.1| surface antigen [Brucella melitensis biovar Abortus 2308]
 gi|189024307|ref|YP_001935075.1| surface antigen [Brucella abortus S19]
 gi|254689378|ref|ZP_05152632.1| Bacterial surface antigen (D15) [Brucella abortus bv. 6 str. 870]
 gi|254730408|ref|ZP_05188986.1| Bacterial surface antigen (D15) [Brucella abortus bv. 4 str. 292]
 gi|256257624|ref|ZP_05463160.1| Bacterial surface antigen (D15) [Brucella abortus bv. 9 str. C68]
 gi|260546618|ref|ZP_05822357.1| bacterial surface antigen [Brucella abortus NCTC 8038]
 gi|260754896|ref|ZP_05867244.1| surface antigen [Brucella abortus bv. 6 str. 870]
 gi|260758113|ref|ZP_05870461.1| surface antigen [Brucella abortus bv. 4 str. 292]
 gi|260883908|ref|ZP_05895522.1| OMP1 [Brucella abortus bv. 9 str. C68]
 gi|297248466|ref|ZP_06932184.1| outer membrane protein assembly complex, YaeT protein [Brucella
           abortus bv. 5 str. B3196]
 gi|62196199|gb|AAX74499.1| bacterial surface antigen [Brucella abortus bv. 1 str. 9-941]
 gi|82616094|emb|CAJ11132.1| Bacterial surface antigen (D15) [Brucella melitensis biovar Abortus
           2308]
 gi|189019879|gb|ACD72601.1| Bacterial surface antigen (D15) [Brucella abortus S19]
 gi|260095668|gb|EEW79545.1| bacterial surface antigen [Brucella abortus NCTC 8038]
 gi|260668431|gb|EEX55371.1| surface antigen [Brucella abortus bv. 4 str. 292]
 gi|260675004|gb|EEX61825.1| surface antigen [Brucella abortus bv. 6 str. 870]
 gi|260873436|gb|EEX80505.1| OMP1 [Brucella abortus bv. 9 str. C68]
 gi|297175635|gb|EFH34982.1| outer membrane protein assembly complex, YaeT protein [Brucella
           abortus bv. 5 str. B3196]
          Length = 781

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 277/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P +D  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSD-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|237815574|ref|ZP_04594571.1| outer membrane protein assembly complex, YaeT protein [Brucella
           abortus str. 2308 A]
 gi|237788872|gb|EEP63083.1| outer membrane protein assembly complex, YaeT protein [Brucella
           abortus str. 2308 A]
          Length = 813

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 277/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 58  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 117

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 118 LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 177

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 178 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 237

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 238 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 297

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 298 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 357

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 358 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 417

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P +D  D VIL V V + S G   I   Y
Sbjct: 418 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSD-PDQVILVVDVVEKSTGEFSIGGGY 476

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 477 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 536

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 537 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 596

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 597 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 655

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 656 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 714

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 715 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 770

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 771 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 813


>gi|306844018|ref|ZP_07476613.1| outer membrane protein assembly complex, YaeT protein [Brucella sp.
           BO1]
 gi|306275773|gb|EFM57497.1| outer membrane protein assembly complex, YaeT protein [Brucella sp.
           BO1]
          Length = 781

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 277/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ RSG  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRSGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|163760890|ref|ZP_02167969.1| putative outer membrane transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162281934|gb|EDQ32226.1| putative outer membrane transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 786

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 277/787 (35%), Positives = 445/787 (56%), Gaps = 26/787 (3%)

Query: 14  LLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVG 73
           LL      +   G ++    +   + V  +  +++ R+++RG + V    +   + +  G
Sbjct: 7   LLNAVSAIALSAGIVVAGAGVVSFATVTVAEAAVISRVDVRGNSRVDASTVRGNLTITPG 66

Query: 74  QSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLK 133
              ++ D+D +VK +++ G FS+V+I +  S LI+++ E +IIN + F+GN  LKD  LK
Sbjct: 67  AQFNNNDIDESVKRLFSTGLFSDVRISVSGSTLIVEVEENQIINQVVFNGNKKLKDADLK 126

Query: 134 MIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVK 193
            +V+SR   AY++ ++ ADV  I+ AY++IG  +  V  +   ++   +N+ + I EG +
Sbjct: 127 QVVQSRQLGAYNDLSLQADVQAIRDAYSAIGRSDATVTTRLVPVAGGRVNVAFEINEGDR 186

Query: 194 AKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRG 252
            KI SI FVGN+ +   RL  VI+ + SG  SF  + DVY ++++  DEE +R FY++RG
Sbjct: 187 TKIASINFVGNQAFGDGRLADVITTKRSGMLSFLTRKDVYDEDKLRADEELLRRFYYNRG 246

Query: 253 YAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSG 311
           YA  +V SS    D+  + YV+   ++EGE Y  G++SI+ST+  I   +L  LI  RSG
Sbjct: 247 YADFRVISSFAELDETNNEYVVTITVEEGERYVFGDVSIESTVPGIDSDSLKGLIETRSG 306

Query: 312 NLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIE 371
            +Y+ ++++++   IS    +   PF ++  R +RD+  R + + YL+D+G+  YV+RIE
Sbjct: 307 AVYSAKDVEDTILAISDRVATQGYPFAQITPRGDRDYNNRTISVVYLVDEGTRAYVERIE 366

Query: 372 IEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVI 431
           I GN ++ D VIRRE +LSEGD  N  ++ RAK R+ A  +F+ VNIS  P +   D V+
Sbjct: 367 IRGNTRTRDYVIRREFDLSEGDAFNQVLVRRAKERLEALKFFTSVNISTQPGSQ-PDRVV 425

Query: 432 LRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFS 491
           L V V+  S G  G+   +    G      I + NF G+G   R + G G  + ++Y+ S
Sbjct: 426 LIVDVQDDSTGEFGVGGGFSNSDGFSATVDITERNFLGRGQFIRASVGGGEDS-RDYSLS 484

Query: 492 VEDPYFLGSPISAGFDL-QKTHLEDGSLDINDESAAVRMIVPITESI--STSFKY----- 543
             +PYFLG  ++AGFDL + T       DI+++   +R+  PITE+I  ST+F+Y     
Sbjct: 485 FTEPYFLGYRLAAGFDLFKNTDSSYDGFDIDNQGINLRIGAPITENIYLSTAFRYTQTEY 544

Query: 544 -DLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
            D+      ++ E+  +       I +G     S+S ++ Y+TLDN  +PR+G+    + 
Sbjct: 545 SDVTLTSITSMPERNAVQR----AINNGGHDVASLSYTLSYSTLDNRTLPREGVSAYLTQ 600

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSN 661
           +YAGFGGDS+Y +  ++A+YF++LS+ +D++G +  G G V    + NL++FD   V   
Sbjct: 601 EYAGFGGDSEYIKTTAKANYFHMLSESADMIGQVSVGAGHVTGVGDDNLRVFDHLFVGQK 660

Query: 662 YYLRGFAYKGIGPRV----DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSAT 717
             +RGF  +GIGPRV     +  A GG  Y + +  VS PMPL+    GLR   F D+AT
Sbjct: 661 -IIRGFDTRGIGPRVFNGTTEVGAAGGTTYFNGTVEVSSPMPLISRDMGLRFNVFADAAT 719

Query: 718 LYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
           LY N ++    G   L G+D  WR S G  + W SP G + VYY  P+     D I++FG
Sbjct: 720 LYGNDISAADFGTQTLVGSDMEWRASIGAGVSWASPFGPLRVYYAEPVVKESFDDIKKFG 779

Query: 775 FRIGNRM 781
           F    R 
Sbjct: 780 FGASTRF 786


>gi|254693862|ref|ZP_05155690.1| Bacterial surface antigen (D15) [Brucella abortus bv. 3 str. Tulya]
 gi|261214148|ref|ZP_05928429.1| surface antigen [Brucella abortus bv. 3 str. Tulya]
 gi|260915755|gb|EEX82616.1| surface antigen [Brucella abortus bv. 3 str. Tulya]
          Length = 781

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 277/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S+LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSMLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P +D  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSD-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +       +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGGDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|254719217|ref|ZP_05181028.1| Outer membrane protein assembly factor yaeT precursor [Brucella sp.
           83/13]
 gi|265984212|ref|ZP_06096947.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306837965|ref|ZP_07470823.1| outer membrane protein assembly complex, YaeT protein [Brucella sp.
           NF 2653]
 gi|264662804|gb|EEZ33065.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306406889|gb|EFM63110.1| outer membrane protein assembly complex, YaeT protein [Brucella sp.
           NF 2653]
          Length = 781

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGCSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|254714225|ref|ZP_05176036.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           ceti M644/93/1]
 gi|254717661|ref|ZP_05179472.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           ceti M13/05/1]
 gi|261219502|ref|ZP_05933783.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261321997|ref|ZP_05961194.1| surface antigen [Brucella ceti M644/93/1]
 gi|260924591|gb|EEX91159.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294687|gb|EEX98183.1| surface antigen [Brucella ceti M644/93/1]
          Length = 781

 Score =  485 bits (1248), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKSGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|161619106|ref|YP_001592993.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           canis ATCC 23365]
 gi|225627622|ref|ZP_03785659.1| outer membrane protein assembly complex, YaeT protein [Brucella
           ceti str. Cudo]
 gi|254704441|ref|ZP_05166269.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           suis bv. 3 str. 686]
 gi|254710229|ref|ZP_05172040.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           pinnipedialis B2/94]
 gi|256031723|ref|ZP_05445337.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           pinnipedialis M292/94/1]
 gi|256255123|ref|ZP_05460659.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           ceti B1/94]
 gi|256369579|ref|YP_003107089.1| bacterial surface antigen [Brucella microti CCM 4915]
 gi|260168856|ref|ZP_05755667.1| bacterial surface antigen [Brucella sp. F5/99]
 gi|260566312|ref|ZP_05836782.1| bacterial surface antigen [Brucella suis bv. 4 str. 40]
 gi|261222321|ref|ZP_05936602.1| OMP1 [Brucella ceti B1/94]
 gi|261317788|ref|ZP_05956985.1| OMP1 [Brucella pinnipedialis B2/94]
 gi|261755119|ref|ZP_05998828.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|261758344|ref|ZP_06002053.1| bacterial surface antigen [Brucella sp. F5/99]
 gi|265988819|ref|ZP_06101376.1| OMP1 [Brucella pinnipedialis M292/94/1]
 gi|161335917|gb|ABX62222.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           canis ATCC 23365]
 gi|225617627|gb|EEH14672.1| outer membrane protein assembly complex, YaeT protein [Brucella
           ceti str. Cudo]
 gi|255999741|gb|ACU48140.1| bacterial surface antigen [Brucella microti CCM 4915]
 gi|260155830|gb|EEW90910.1| bacterial surface antigen [Brucella suis bv. 4 str. 40]
 gi|260920905|gb|EEX87558.1| OMP1 [Brucella ceti B1/94]
 gi|261297011|gb|EEY00508.1| OMP1 [Brucella pinnipedialis B2/94]
 gi|261738328|gb|EEY26324.1| bacterial surface antigen [Brucella sp. F5/99]
 gi|261744872|gb|EEY32798.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|264661016|gb|EEZ31277.1| OMP1 [Brucella pinnipedialis M292/94/1]
          Length = 781

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|23502032|ref|NP_698159.1| surface antigen [Brucella suis 1330]
 gi|23347986|gb|AAN30074.1| bacterial surface antigen [Brucella suis 1330]
          Length = 781

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVEERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|148559910|ref|YP_001259073.1| outer membrane protein assembly complex protein YaeT [Brucella ovis
           ATCC 25840]
 gi|148371167|gb|ABQ61146.1| outer membrane protein assembly complex, YaeT protein [Brucella
           ovis ATCC 25840]
          Length = 803

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 48  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 107

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 108 LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 167

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 168 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 227

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 228 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 287

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 288 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 347

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 348 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 407

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 408 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 466

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 467 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 526

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 527 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 586

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 587 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 645

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 646 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 704

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 705 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 760

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 761 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 803


>gi|254706663|ref|ZP_05168491.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           pinnipedialis M163/99/10]
 gi|261314123|ref|ZP_05953320.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261303149|gb|EEY06646.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
          Length = 781

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 275/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T +  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRIDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|163843419|ref|YP_001627823.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           suis ATCC 23445]
 gi|163674142|gb|ABY38253.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           suis ATCC 23445]
          Length = 781

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/763 (36%), Positives = 432/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+       +AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQKFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|256061236|ref|ZP_05451387.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           neotomae 5K33]
 gi|261325244|ref|ZP_05964441.1| OMP1 [Brucella neotomae 5K33]
 gi|261301224|gb|EEY04721.1| OMP1 [Brucella neotomae 5K33]
          Length = 781

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 276/763 (36%), Positives = 433/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YKITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVGLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|17987113|ref|NP_539747.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|225852652|ref|YP_002732885.1| outer membrane protein assembly complex protein YaeT [Brucella
           melitensis ATCC 23457]
 gi|256044810|ref|ZP_05447714.1| outer membrane protein assembly complex, YaeT protein [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256113715|ref|ZP_05454519.1| outer membrane protein assembly complex, YaeT protein [Brucella
           melitensis bv. 3 str. Ether]
 gi|256263854|ref|ZP_05466386.1| bacterial surface antigen [Brucella melitensis bv. 2 str. 63/9]
 gi|260565590|ref|ZP_05836074.1| bacterial surface antigen [Brucella melitensis bv. 1 str. 16M]
 gi|265991234|ref|ZP_06103791.1| OMP1 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995070|ref|ZP_06107627.1| OMP1 [Brucella melitensis bv. 3 str. Ether]
 gi|17982775|gb|AAL52011.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|225641017|gb|ACO00931.1| outer membrane protein assembly complex, YaeT protein [Brucella
           melitensis ATCC 23457]
 gi|260151658|gb|EEW86752.1| bacterial surface antigen [Brucella melitensis bv. 1 str. 16M]
 gi|262766183|gb|EEZ11972.1| OMP1 [Brucella melitensis bv. 3 str. Ether]
 gi|263002018|gb|EEZ14593.1| OMP1 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093985|gb|EEZ17919.1| bacterial surface antigen [Brucella melitensis bv. 2 str. 63/9]
 gi|326409173|gb|ADZ66238.1| outer membrane protein assembly complex protein YaeT [Brucella
           melitensis M28]
 gi|326538883|gb|ADZ87098.1| outer membrane protein assembly complex, YaeT protein [Brucella
           melitensis M5-90]
          Length = 781

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 275/763 (36%), Positives = 431/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+    +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEVLDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYSLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 565 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 623

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 624 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 682

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 683 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 738

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 739 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 781


>gi|294852494|ref|ZP_06793167.1| outer membrane protein assembly complex [Brucella sp. NVSL 07-0026]
 gi|294821083|gb|EFG38082.1| outer membrane protein assembly complex [Brucella sp. NVSL 07-0026]
          Length = 799

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 274/763 (35%), Positives = 431/763 (56%), Gaps = 21/763 (2%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 44  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 103

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 104 LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 163

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 164 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 223

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R  Y++ GYA  +V SS  + D   + 
Sbjct: 224 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRLYYNHGYADFRVLSSNAVLDPSTNE 283

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 284 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 343

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 344 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 403

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 404 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 462

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 463 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 522

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 523 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 582

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
               E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +   + +Y+
Sbjct: 583 EA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTTFKGNYY 641

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD----K 678
             LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  D    K
Sbjct: 642 QTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQDAKNGK 700

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
           +Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G+D   R
Sbjct: 701 RYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISGDDKKLR 756

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 757 ASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 799


>gi|154466683|gb|ABS82497.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 235

 Score =  479 bits (1232), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 235/235 (100%), Positives = 235/235 (100%)

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
           VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV
Sbjct: 1   VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 60

Query: 486 QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
           QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL
Sbjct: 61  QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 120

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
           RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA
Sbjct: 121 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 180

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 181 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 235


>gi|49474290|ref|YP_032332.1| Outer membrane protein [Bartonella quintana str. Toulouse]
 gi|49239794|emb|CAF26184.1| Outer membrane protein [Bartonella quintana str. Toulouse]
          Length = 798

 Score =  479 bits (1232), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 281/782 (35%), Positives = 439/782 (56%), Gaps = 28/782 (3%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           MG I    A   ++ V     S+VR IE+RG   V  + I   I + VG+S S  D+D A
Sbjct: 18  MGVIAPTTAFMSIAMVGEVQASVVRSIEVRGNKFVSAQAIRDNIGIKVGKSFSSGDIDFA 77

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAY 144
           VK ++ +G F +VKI  V   L++ + E +I+N + F GN +LKD  LK  +  +   ++
Sbjct: 78  VKRLFGLGLFYDVKINQVGDKLVVLVKEYEIVNQVLFQGNKSLKDPDLKRFISLKPNESF 137

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           +   ++ADV+ I +AY ++G  NV V VQ  ++    +N+ + I EG K KI++I F GN
Sbjct: 138 NSAKLSADVNVICEAYKTVGRNNVAVTVQTINLGKGRVNVVFNIVEGRKTKISNITFKGN 197

Query: 205 KNYSHARLERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
             +  +RL  VIS + SG  S   + DVYS+ER++ DEEA+R FY++ GYA  +V SS+ 
Sbjct: 198 NAFRSSRLRDVISTKPSGILSLLLRGDVYSEERLAADEEALRRFYYNHGYADFRVISSKA 257

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
           +FD+ ++ Y + F +DEG  Y + ++ ++S +  I   ++  +++ R G++YN + I++S
Sbjct: 258 VFDEARNAYKIDFVLDEGMRYKIADVQVESDIDGIDVHSMKGILKTRPGDVYNAENIEQS 317

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
              I+         F +V+ R NRD A   + I Y I+QG   YV+RIEI GN+++ D +
Sbjct: 318 VAIINNKAADSGYAFAKVEPRGNRDLANHTISILYNIEQGPRAYVQRIEIRGNEKTRDYI 377

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           IRRE++L+EGD  N ++++RAKRR+ + G+F  VNIS +P  D SD +IL + V +   G
Sbjct: 378 IRREIDLNEGDAYNQTLVQRAKRRLESLGFFKAVNISMVPT-DQSDQIILVIDVLEAPTG 436

Query: 443 SVGIATNYE---VDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
            +  +  Y       GM +E  + + N  G+G   RL  G G+   +NY  +  DPYFLG
Sbjct: 437 DLSFSGGYTTGGTSPGMSLEVSVTERNLGGRGQYVRLGLGAGQEKSRNYNLAFVDPYFLG 496

Query: 500 SPISAGFDL-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG------- 551
             +SAG D+ + T+  D + D+     A+R  +PI + +S +  Y     +Y        
Sbjct: 497 YHLSAGVDIFRSTYRADKAYDVRQTGGALRFGLPINDQLSANLSYSYVQEEYDFGEDYDF 556

Query: 552 -AISEKEKIPSIYTTLI----EHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
              S+ +K+   Y+  I     H  +   SIS  + YNT+D+   P  G  +    +YAG
Sbjct: 557 TKPSDLQKLYEKYSGAIVQAARHSPWKRSSISYGLTYNTIDDMKNPHNGWYMRVLQEYAG 616

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLR 665
            GG++++ +   +A  +  LSD  D+VG L FG G +     + +++FD F V+S+  +R
Sbjct: 617 LGGNAKFLKTTGKAMMYKTLSDQMDLVGLLSFGAGYIHEIGREGVRIFDMFKVNSD-MIR 675

Query: 666 GFAYKGIGPR-VDKK---YAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN 721
           GF Y GIGPR V  K   Y +GG  Y +A+A + FP+P+VPE  G RGA F D ATLY N
Sbjct: 676 GFKYNGIGPRQVSNKGEVYFLGGTTYMNATAELQFPIPVVPEGLGFRGALFADVATLYGN 735

Query: 722 H---VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           +      G   +    S WR S GV +MW+SP G +   Y  P+  +EGD++QQ  F I 
Sbjct: 736 NYKPTLQGEMPVTNLKSAWRSSAGVSLMWDSPFGPLRFDYAWPITKQEGDRLQQLNFGIS 795

Query: 779 NR 780
            +
Sbjct: 796 TK 797


>gi|163868107|ref|YP_001609311.1| outer membrane protein [Bartonella tribocorum CIP 105476]
 gi|161017758|emb|CAK01316.1| outer membrane protein [Bartonella tribocorum CIP 105476]
          Length = 798

 Score =  478 bits (1230), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 277/784 (35%), Positives = 443/784 (56%), Gaps = 28/784 (3%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            +MG I        ++AV     S+VR IE+RG   V  + I   + +  GQ +S  D+D
Sbjct: 16  LKMGMIAPAAVFMSIAAVGEIQASVVRSIEVRGNKFVSSQAIRDNMGIKAGQGVSGGDVD 75

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA 142
           HAVKN++ +G F +VKI  V   L++ + E +++N + F GN + KD  LK  +  +   
Sbjct: 76  HAVKNLFELGLFYDVKINQVGDKLVVFVKEYEVVNQILFQGNKSFKDPDLKRFISLKPNE 135

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            ++   ++AD++ I++AY ++G  N+ V VQ  ++    +N+ + + EG K KI  I F 
Sbjct: 136 PFNSAKLSADINTIREAYKTLGRNNITVNVQTINLGKGRVNVVFNVVEGQKTKIGDITFK 195

Query: 203 GNKNYSHARLERVISIRTSGYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSS 260
           GN  ++  RL  VIS ++SG FS     DVYS+ER++ DEEA+R FY++RGYA  + VSS
Sbjct: 196 GNSVFASRRLRDVISTKSSGIFSKLLGGDVYSEERLAADEEALRRFYYNRGYADFRVVSS 255

Query: 261 QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIK 320
           + +FD   + Y + F +DEG  Y + +I ++S +  I  +++  +++ + GN+Y+ ++I+
Sbjct: 256 KAIFDAASNTYKISFILDEGARYKISDIQVESDVDGIDVQSVKGMLKTQPGNVYSAEDIE 315

Query: 321 ESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYD 380
           +S   I+         F +V+ R NR+ A   + I Y I+QG+  Y++RI+I GN+++ D
Sbjct: 316 QSVAIINNKVADSGYAFAKVEPRGNRNLANHTISILYNIEQGTRAYIQRIDIRGNEKTRD 375

Query: 381 SVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLS 440
            VIRRE++L+EGD  N ++++RAKRR+ + G+F  VNIS +P  + SD V+L + V + S
Sbjct: 376 YVIRREIDLNEGDAYNQTLLQRAKRRLESLGFFKAVNISMVPT-EQSDQVVLVIDVVEAS 434

Query: 441 AGSVGIATNYE---VDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
            G + ++  Y       GM +E  + + N  G+G   RL  G G+   +NY  S  DPYF
Sbjct: 435 TGDLSLSGGYTTGGTSPGMSLEVSVTERNLGGRGQYVRLGLGAGQEKSRNYNLSFVDPYF 494

Query: 498 LGSPISAGFDL-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG----- 551
           LG  +SAG D+ + T+  D + D+     ++R  +PI   +S +  Y     +Y      
Sbjct: 495 LGYRLSAGVDVFRSTYRADKAYDVRQTGGSLRFSLPINNKLSANVAYSYVQEEYDFGGEY 554

Query: 552 AISEKEKIPSIY----TTLIEHGK---FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
             +++  I  +Y      +++  K   +   SIS  + YNT+D+   P  G  +    +Y
Sbjct: 555 DFNKESDIIELYGKYSGAIVQAAKQSPWKRSSISYGLTYNTIDDMRNPHDGWYVHLLQEY 614

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNK-NLQLFDQFSVSSNYY 663
           AG GG +++ +   +A  +  LSD  DIVG L FG G +    K  +++FD F  +++  
Sbjct: 615 AGLGGSAKFLKTTGKAMMYKTLSDQKDIVGLLSFGGGYIHEIGKEGVRIFDMFKANTD-M 673

Query: 664 LRGFAYKGIGPR-VDKK---YAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           +RGF Y GIGPR V  K   Y +GG  Y +A+A V FP+P+VPE  GLRGA F D ATLY
Sbjct: 674 IRGFKYNGIGPRQVSSKGEVYFLGGTTYMNATAEVQFPIPVVPEGFGLRGALFADIATLY 733

Query: 720 ANH---VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFR 776
            N+   V  G   +    + WR S GV +MW+SP G +   Y  P+  REGD++QQ  F 
Sbjct: 734 GNNYKAVFKGEPPVTNTKNAWRSSAGVSLMWDSPFGPLRFDYAWPITKREGDRLQQLNFG 793

Query: 777 IGNR 780
           I  +
Sbjct: 794 ISTK 797


>gi|49475416|ref|YP_033457.1| Outer membrane protein [Bartonella henselae str. Houston-1]
 gi|18252649|gb|AAL66374.1|AF461795_2 Omp89 [Bartonella henselae]
 gi|49238222|emb|CAF27432.1| Outer membrane protein [Bartonella henselae str. Houston-1]
          Length = 798

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 275/774 (35%), Positives = 443/774 (57%), Gaps = 28/774 (3%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A   ++ V     S+VR IE+ G   V  +V+   I + VG+S S  D+D AVK ++A+G
Sbjct: 26  AFVSIAMVEEVQASVVRSIEVHGNKFVSAQVVRDNIDIKVGKSFSSGDVDFAVKRLFALG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            F +VKI  V   L++ + E +++N + F GN +LKD  LK  +  +    ++   ++AD
Sbjct: 86  LFYDVKINQVGDRLVVLVKEYEVVNQVLFQGNKSLKDPDLKRFISLKPNEPFNSAKLSAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
           V+ I++AY ++G  ++ V +Q  ++    +N+ + I EG + KI++I F GN  +  +RL
Sbjct: 146 VNVIREAYKTVGRNDIAVTIQTINLGKGRVNVVFNIVEGRRTKISNITFKGNHAFGSSRL 205

Query: 213 ERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + SG  S   + DVYS+ER++ DEEA+R FY++RGYA  +V SS+ +FD+ ++ 
Sbjct: 206 RDVISTKPSGILSLLLRGDVYSEERLAADEEALRRFYYNRGYADFRVISSKAVFDEARNA 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y + F +DEG  Y +G++ I+S +  I  +++  +++ RSG++Y+ + I++S   I+   
Sbjct: 266 YEIDFVLDEGVRYKIGDVQIESDIDGIDVQSMKGILKTRSGDVYSAENIEQSVAIINNKA 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R NRD A   + I Y I+QG   YV+RIEI GN+++ D VIRRE++L+
Sbjct: 326 ADSGYAFAKVEPRGNRDLANHTISILYNIEQGPRAYVQRIEIRGNEKTRDYVIRREIDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N ++++RAKRR+ + G+F  VNIS +P  D  D +IL V V +   G +  +  Y
Sbjct: 386 EGDAYNQTLVQRAKRRLESLGFFKAVNISMVPT-DQPDQIILVVDVLEAPTGDLSFSGGY 444

Query: 451 E---VDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G+ +E  + + N  G+G   RL  G G+   +NY  S  DPYFLG  +SAG D
Sbjct: 445 TTGGTSPGVSLEVSVTERNLGGRGQYVRLGLGAGQEKSRNYNLSFVDPYFLGYRLSAGVD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKY-----DLRFLQYGAISEKEKIPS 561
           + + T+  D + D+     ++R  VPI + +S +  Y     +  F +   +S++  I  
Sbjct: 505 IFRSTYRADKAYDVRQTGGSLRFAVPINDQLSANLAYSYIQEEYDFGKKYDLSKETDIRE 564

Query: 562 IY-------TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYH 614
           +Y           +H  +   SIS  + YNT+D+   P  G  +    +YAG GG++++ 
Sbjct: 565 LYGKYSGAIVQAAQHSPWKRSSISYGLTYNTIDDMKNPHDGWYVRVLQEYAGLGGNAKFL 624

Query: 615 RIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +   +A  +  LSD  D+VG L FG G +     + +++FD F ++++  +RGF Y GIG
Sbjct: 625 KTTGKAMMYKTLSDRMDLVGLLSFGGGYIHEIGREGVRIFDMFKINTD-MIRGFKYNGIG 683

Query: 674 PR-VDKK---YAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALG 726
           PR V  K   Y +GG  Y +A+A V FP+P+VPE  G RGA F D ATLY ++   V  G
Sbjct: 684 PRQVSNKGEVYFLGGTTYMNATAEVQFPIPVVPEGLGFRGALFADVATLYGSNYKPVFQG 743

Query: 727 ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
              +    S WR S GV +MW+SP G +   Y  P++ +EGD++QQ  F I  +
Sbjct: 744 ETPVTNIKSAWRSSAGVSLMWDSPFGPLRFDYAWPIKKQEGDRLQQLNFGISTK 797


>gi|219693162|gb|ACL34359.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|219693164|gb|ACL34360.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|219693166|gb|ACL34361.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|219693168|gb|ACL34362.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|219693170|gb|ACL34363.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 231

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/231 (100%), Positives = 231/231 (100%)

Query: 430 VILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT 489
           VILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT
Sbjct: 1   VILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT 60

Query: 490 FSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQ 549
           FSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQ
Sbjct: 61  FSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQ 120

Query: 550 YGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
           YGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG
Sbjct: 121 YGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 180

Query: 610 DSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           DSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 181 DSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 231


>gi|319408401|emb|CBI82056.1| outer membrane protein [Bartonella schoenbuchensis R1]
          Length = 798

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 275/774 (35%), Positives = 443/774 (57%), Gaps = 28/774 (3%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           AI  +S V  +  S+V  IE+ G   V  ++I   I +V+G+S++  D+D  VK ++A+G
Sbjct: 26  AITSISMVEKAQASVVHSIEVHGNKFVDSQIIRDNIQIVIGKSLASDDVDAVVKRLFALG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            F ++KI  V + LI+ + E +++N + F GN  LKD  LK  +  +    +    ++AD
Sbjct: 86  LFYDIKINQVGNKLIVAVKEYEVVNQVLFQGNKTLKDPDLKRFISLKPNETFSSAKLSAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
           +  I++AY+++G  NV V  Q   +    +N+ + + EG K KI  I F GN  +   RL
Sbjct: 146 IRIIREAYSTVGRKNVAVTAQTIDLGKGRVNVVFNVVEGQKTKIADITFEGNNTFPTRRL 205

Query: 213 ERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSG 270
             VIS R SG FS   + DVY++ER++ DEEA+R FY++RGYA  + VSS+V+FD++ + 
Sbjct: 206 RDVISTRPSGIFSLLLRGDVYNEERLAADEEALRRFYYNRGYADFRIVSSKVVFDEKSNS 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y + F +DEGE YT+G++ ++S ++ I  + +   ++ R G +YN   I++S   I+   
Sbjct: 266 YKINFILDEGERYTIGDVQVESDIEGINTQFIKEALKTRPGIIYNAAYIEKSVAIINNRV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V  R NRDFA R + + Y I+QG  +YV+RIEI GN+++ D VIRRE++L+
Sbjct: 326 ADSGYAFAKVDPRGNRDFANRTISLVYNIEQGPRVYVQRIEIRGNEKTRDYVIRREIDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N ++++RAKRR+   G+F  VNIS +P  D SD V+L V V ++  G +  +  Y
Sbjct: 386 EGDAYNQTLVQRAKRRLENLGFFKTVNISMVPT-DESDQVVLVVDVVEVPTGDLSFSGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  GM +E  + + N  G+G   RL+ G G+   +NY  S  +P+FLG  +SAG D
Sbjct: 445 TTGGNTPGMSLEVSVTERNLGGRGQYVRLSLGAGQEKSRNYNLSFVEPHFLGYRLSAGVD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG-----AISEKEKIPS 561
           + + T+  D + D+     ++R  V I E +S +  Y     +Y       ++  + I  
Sbjct: 505 IFRSTYRADNAYDVRQTGGSLRFGVSIFEQLSANLGYSYVQEEYDFGKGYDLTNDDVIAE 564

Query: 562 IY-------TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYH 614
           +Y           +H  +   SI   + YN++D+   P  G+ I +  +YAG GG++Q+ 
Sbjct: 565 LYGKYSGAIVQAAKHSPWKRSSIVYGLTYNSIDDMNNPHDGLYIRAMQEYAGLGGNAQFL 624

Query: 615 RIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIG 673
           +   +A  +  LSD+ D+V  L  G G + P  K+ +++FD F   ++  +RGF Y GIG
Sbjct: 625 KTTGKAMMYKTLSDEMDLVSLLSVGSGYIHPIGKDGVRIFDMFKSDTD-MIRGFKYNGIG 683

Query: 674 PR----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA-NHVALGAD 728
           PR      + Y +GGK Y +A+A + FP+P+VPE  G RGA F D+ATLY  N+  +  +
Sbjct: 684 PRQVSNSGEAYFLGGKTYMNATAELQFPIPVVPESLGFRGAIFADAATLYGHNYKPVLEN 743

Query: 729 KLEGND--SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           ++   D  S WR S GV +MW SP G + + Y  P+  ++GD++Q+F F I  +
Sbjct: 744 EMPVTDTGSAWRTSAGVSLMWESPFGPLRINYAWPITQKKGDQVQKFEFGISTK 797


>gi|240850310|ref|YP_002971703.1| outer membrane protein [Bartonella grahamii as4aup]
 gi|240267433|gb|ACS51021.1| outer membrane protein [Bartonella grahamii as4aup]
          Length = 798

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 278/784 (35%), Positives = 435/784 (55%), Gaps = 28/784 (3%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            +MG I        ++AV     S+VR IE+RG   V  + I   + +  GQ +S AD+D
Sbjct: 16  LKMGMIAPATVFMSIAAVGEIQASVVRSIEVRGNKFVSSQAIRDNMGIKAGQGVSSADVD 75

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA 142
           +AVKN++ +G F +VKI  V   L++ + E +++N + F GN + KD  LK  +  +   
Sbjct: 76  NAVKNLFELGLFYDVKINPVGDKLVVFVKEYEVVNQILFQGNKSFKDPDLKRFISLKPNE 135

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            ++   ++AD++ I++AY ++G  N+ V VQ  ++    +N+ + + EG K KI  I F 
Sbjct: 136 PFNSAKLSADINTIREAYKTLGRNNITVNVQTINLGKGRVNVVFNVVEGQKTKIGDITFK 195

Query: 203 GNKNYSHARLERVISIRTSGYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSS 260
           GN  +   RL  VIS +TSG FS     DVYS+ER++ DEEA+R FY++RGYA  + VSS
Sbjct: 196 GNSVFGSRRLRDVISTKTSGIFSKLLGGDVYSEERLAADEEALRRFYYNRGYADFRVVSS 255

Query: 261 QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIK 320
           +  FD   + Y + F +DEG  Y + +I ++S +  I  +++   ++ + G++Y+ ++I+
Sbjct: 256 KATFDAASNTYKISFVLDEGVRYKISDIQVESDVDGIDVQSVKRGLKTQPGDVYSAEDIE 315

Query: 321 ESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYD 380
           +S   I+         F +V+ R NR+ A   + I Y I+QG+  Y++RI+I GN+++ D
Sbjct: 316 QSVAIINNKVADSGYAFAKVEPRGNRNLANHTISILYNIEQGTRAYIQRIDIRGNEKTRD 375

Query: 381 SVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLS 440
            VIRRE++L+EGD  N ++++RAKRR+ + G+F  VNIS +P  D SD VIL + V + S
Sbjct: 376 YVIRREIDLNEGDAYNQTLLQRAKRRLESLGFFKAVNISMVPT-DQSDQVILVIDVVEAS 434

Query: 441 AGSVGIATNYE---VDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
            G + ++  Y       GM +E  + + N  G+G   RL    G+   +NY  S  DPYF
Sbjct: 435 TGDLSLSGGYTTGGTSPGMSLEVSVTERNLGGRGQYVRLGLCAGQEKSRNYNLSFVDPYF 494

Query: 498 LGSPISAGFDL-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISE- 555
           LG  +SAG D+ + T+  D + D+     ++R  +PI   +S +  Y     +Y    E 
Sbjct: 495 LGYRLSAGVDVFRSTYRADKAYDVRQTGGSLRFSLPINNQLSANVAYSYVQEEYDFGGEY 554

Query: 556 ---KE--------KIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
              KE        K         +   +   SIS    YNT+D+   P  G  +    +Y
Sbjct: 555 DFDKESDVIELYGKYSGAIVQAAKQSPWKRSSISYGFTYNTIDDMRSPHDGWYVHLLQEY 614

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYY 663
           AG GG +++ +   +A  +  LSD  DIVG L FG G +    ++ +++FD F  +++  
Sbjct: 615 AGLGGSAKFLKTTGKAMMYKTLSDQKDIVGLLSFGGGYIHGMGRDGVRIFDMFKANTD-M 673

Query: 664 LRGFAYKGIGPR-VDKK---YAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           +RGF Y GIGPR V  K   Y +GG  Y +A+A V FP+P+VPE  GLRGA F D ATLY
Sbjct: 674 IRGFKYNGIGPRQVSSKGEVYFLGGTTYMNATAEVQFPIPVVPEGFGLRGALFADIATLY 733

Query: 720 ANH---VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFR 776
            N+   V  G   +    S WR S GV +MW+SP G +   Y  P+  +EGD++QQ  F 
Sbjct: 734 GNNYKAVFKGEPSVTNTKSAWRSSAGVSLMWDSPFGPLRFDYAWPITKQEGDRLQQLNFG 793

Query: 777 IGNR 780
           I  +
Sbjct: 794 ISTK 797


>gi|319405837|emb|CBI79469.1| outer membrane protein [Bartonella sp. AR 15-3]
          Length = 798

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 271/771 (35%), Positives = 427/771 (55%), Gaps = 28/771 (3%)

Query: 37  LSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSN 96
           ++ V  +  SIV  IE+RG   VG + I   + +  G++ S+ D+D  VK ++ +G F +
Sbjct: 30  IATVEETQASIVHSIEVRGNKYVGAQTIRDNMKIKAGRNFSEGDIDAEVKRLFELGLFYD 89

Query: 97  VKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNI 156
           +KI  V + L++ + E + +N + F GN   KD  LK  +  +   A+  D ++AD+  I
Sbjct: 90  IKINQVGNKLVVAVKEYETVNQVLFQGNKTFKDPDLKRFITLKQNEAFSSDKLSADIKVI 149

Query: 157 KQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVI 216
           ++AY ++G  NV V VQ  ++    +N+ + I EG + KI  I F GNK +   RL  VI
Sbjct: 150 REAYRTVGRNNVSVTVQTINLGEGRVNVVFNIVEGQRTKIADITFQGNKTFGVRRLRDVI 209

Query: 217 SIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLI 274
             + SG FS   K DVY+++R++ DEEA+R FY+ RGYA  +V SS+ ++D+  + Y + 
Sbjct: 210 LTKPSGIFSLLLKGDVYTEDRLAADEEALRRFYYSRGYADFRVVSSKAVYDESNNAYKIH 269

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
           F +DEG  Y +G+I I+S ++ +  ++L  +I+ R+G++YN + +++S   I+       
Sbjct: 270 FILDEGACYKIGDIQIESDIEGVDTESLKKIIKTRTGDVYNAEYVEQSVTLINNKVADSG 329

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F +V  R NR+F    + I Y I+QG   YV+RIEI GN+++ D +IRREL+L+EGD 
Sbjct: 330 YAFAKVDPRGNRNFKNHTISIVYNIEQGPRAYVQRIEIRGNEKTRDYIIRRELDLNEGDA 389

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYE--- 451
            N ++++RAKRR+ + G+F  VNIS +P  D SD V L + V ++  G +  +  Y    
Sbjct: 390 YNQTLVQRAKRRLESLGFFKAVNISMVPT-DQSDQVTLVIDVVEVPTGDLSFSGGYTTGG 448

Query: 452 VDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QK 510
              GM +E  + + N  G+G   RL  G G+   +NY  S  DP+FLG   SAG D+ + 
Sbjct: 449 TSPGMSLEVSVTERNLGGRGQYVRLGLGAGQEKSRNYNLSFVDPHFLGYRSSAGLDIFRS 508

Query: 511 THLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQY--GA---ISEKEKIPSIY-- 563
           T+  D + D+     ++R  +PI + +S +  Y     +Y  GA   +++   I  +Y  
Sbjct: 509 TYRADKAYDVRQTGGSLRFGLPINDQLSANLAYSYVQEEYDFGAQYDLTDDAVIRELYQK 568

Query: 564 -----TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
                    +H  +   SIS  + YN++D+   P  G+      +YAG GGD+Q+ +   
Sbjct: 569 YSGAIVQAAKHSPWHRSSISYGLTYNSIDDMKNPHDGIYARLLQEYAGLGGDAQFLKTTG 628

Query: 619 RASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIGPR-- 675
           +A  +  LSD  D+VG    G G +     N L++FD F  S+N  +RGF Y GIGPR  
Sbjct: 629 KAMMYKTLSDRMDVVGLFSVGAGYIYGIGDNGLRIFDMFK-SNNDMIRGFKYNGIGPRQI 687

Query: 676 --VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADKL 730
               + Y +GG  Y +  A V FP+P+VP+  G RGA F+D+ATLY N+   V      +
Sbjct: 688 SEQGEVYFLGGTTYMNGIAEVQFPIPIVPDSLGFRGAVFLDAATLYGNNYKPVLTNEAPV 747

Query: 731 EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             + S WR S GV +MW SP G +   Y  PL  +EGD +Q   F I  + 
Sbjct: 748 TNSHSSWRTSAGVSLMWESPFGPLRFDYAWPLTKQEGDNVQSLNFGISTKF 798


>gi|319899037|ref|YP_004159130.1| outer membrane protein [Bartonella clarridgeiae 73]
 gi|319403001|emb|CBI76556.1| outer membrane protein [Bartonella clarridgeiae 73]
          Length = 798

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 269/770 (34%), Positives = 430/770 (55%), Gaps = 28/770 (3%)

Query: 37  LSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSN 96
           ++ V  +  SIV  IEIRG   VG + I   + +  G+  S+ D+D  VK ++ +G F +
Sbjct: 30  IAIVEETQASIVHSIEIRGNKYVGTQTIRDNMKIKAGRDFSEVDIDAEVKRLFELGLFYD 89

Query: 97  VKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNI 156
           VKI  V + L++ + E +++N + F GN   KD  LK  +  +    +  D + AD+  I
Sbjct: 90  VKINQVGNKLVVAVKEYEVVNQVLFQGNKTFKDPDLKRFITLKQNETFSSDKLTADIKVI 149

Query: 157 KQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVI 216
           ++AY S+G  NV + V+  ++    +N+ + I EG + KI  I F GNK +   RL  VI
Sbjct: 150 REAYKSVGRNNVSITVKTINLGKGRVNVVFNIVEGPRTKIADITFQGNKTFGVRRLRDVI 209

Query: 217 SIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLI 274
             ++SG FS   K DVY+++R++ DEEA+R FY++RGYA  +V SS+ ++D+  + Y + 
Sbjct: 210 FTKSSGIFSLLMKGDVYTEDRLAADEEALRRFYYNRGYADFRVVSSKAVYDESSNAYKIH 269

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
           F +DEG  Y +G+I ++S +  +  ++L  +I+ R+G++YN + +++S   I+       
Sbjct: 270 FILDEGACYKIGDIRVESDIDGVDSQSLKQVIKTRTGDVYNAEYVEQSVALINNKVADSG 329

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F +V  R +R+F    + I Y I+QG  +YV+RIEI GN+++ D VIRREL+L+EGD 
Sbjct: 330 YAFAKVDPRGDRNFKNHTISIVYNIEQGPRVYVQRIEIRGNEKTRDYVIRRELDLNEGDA 389

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYE--- 451
            N ++++RAKRR+ + G+F  VNIS +P  D SD V L V V ++  G +  +  Y    
Sbjct: 390 YNQTLVQRAKRRLESLGFFKAVNISMVPT-DQSDQVTLVVDVVEIPTGDLSFSGGYTTGG 448

Query: 452 VDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QK 510
              GM +E  + + N  G+G   RL  G G+   +NY  S  DP+FLG   SAG D+ + 
Sbjct: 449 TSPGMSLEVSVTERNLGGRGQYVRLGVGAGQEKSRNYNLSFVDPHFLGYRSSAGLDIFRS 508

Query: 511 THLEDGSLDINDESAAVRMIVPITESISTSFKY-----DLRFLQYGAISEKEKIPSIYT- 564
           T+  D + D+     ++R  +PI + +S +  Y     +  F +   +++ E I  +Y  
Sbjct: 509 TYRADKAYDVRQTGGSLRFGLPINDQLSANLAYSYVQEEYDFGEKYDLTDDEVIQELYRK 568

Query: 565 ---TLIEHGK---FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
               +++  K   +   SIS  + YN++D+   P  G+      +YAG GG++Q+ +   
Sbjct: 569 YSGAIVQAAKNSPWHRSSISYGVTYNSIDDMKNPHDGIYARLLQEYAGLGGNAQFLKTTG 628

Query: 619 RASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIGPRV- 676
           +A  +  LSD  DIVG    G G +   N + L++FD F  S+N  +RGF Y GIGPR  
Sbjct: 629 KAMVYKTLSDRMDIVGLFSIGAGYIYGINDDGLRIFDMFK-SNNDMIRGFKYNGIGPRQI 687

Query: 677 ---DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADKL 730
               + Y +GG  Y + +A V FP+P+VP+  G RGA F+D+ATLY N+   V      +
Sbjct: 688 SQRGEMYFLGGTTYMNGTAEVQFPIPIVPDSLGFRGAVFLDAATLYGNNYKPVLKDETPV 747

Query: 731 EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
               S WR S G+ +MW SP G +   Y  PL  +EGD +Q   F I  +
Sbjct: 748 TNTHSSWRTSAGISLMWESPFGPLRFDYAWPLTKQEGDNVQNLNFGISTK 797


>gi|319783664|ref|YP_004143140.1| outer membrane protein assembly complex, YaeT protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169552|gb|ADV13090.1| outer membrane protein assembly complex, YaeT protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 788

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 272/763 (35%), Positives = 439/763 (57%), Gaps = 26/763 (3%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
           A   +  ++V R+E+ G   +  E I + I +  G++ S +D+D AVK ++  G FS+V+
Sbjct: 32  ATSAAEAAVVSRVEVSGNQRIDAETIRNYITIKPGKAFSSSDIDGAVKALFGTGLFSDVQ 91

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQ 158
           I  V S L++ + E +++N + F  N  LKD+ L   V+ +    + + T++ADV ++K 
Sbjct: 92  INQVGSTLVVKVAEYQVVNQVLFQNNKKLKDNALAAAVQLKPRGTFSQATLDADVESVKA 151

Query: 159 AYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISI 218
           AY  IG  +V V  Q   +    +N+ + I EG + +I +I FVGN  YS  RL  +I+ 
Sbjct: 152 AYKRIGRDDVTVTTQVMQLGDNRVNVVFNIAEGDRTQIAAINFVGNSAYSSRRLSDIINT 211

Query: 219 RTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQV-LFDKQKSGYVLIFQ 276
           + S + SF  + DVY  +++  D+E +R FY++ GYA  +V S V   D   + Y +   
Sbjct: 212 KRSSWVSFILRDDVYDDDKLRADQELLRRFYYNHGYADFQVVSAVGELDSATNKYTVTIT 271

Query: 277 IDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERP 336
           + EG+ YT G++S++ST+ E+  K+L S+I    G++YN + +++S   +++        
Sbjct: 272 VQEGDRYTFGDVSVESTIPEVDGKSLESVIETHKGDVYNAKNVEDSIIALTEKVAGSGYA 331

Query: 337 FVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPIN 396
           F +V  R +R+F    + + Y IDQG+  Y++RIEI GND++ D VIRRE ++SEGD  N
Sbjct: 332 FAQVTPRGDRNFENHTISVVYTIDQGTKAYIERIEIRGNDRTRDYVIRREFDVSEGDAFN 391

Query: 397 YSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV---D 453
             +I+RAK+R+    YF +V+IS +P +   D V+L V V + S G   +   Y      
Sbjct: 392 QVLIQRAKKRLENLNYFEKVDISTVPGSQ-PDQVVLVVDVVEKSTGEFSVGAGYSTGGDT 450

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL 513
            G  VEG + + NF G+G   +L+AG G+++ ++Y+ S  +PYFLG  I+AGFD+ K+  
Sbjct: 451 AGPSVEGSVTERNFLGRGQFIKLSAGGGKNS-RDYSLSFTEPYFLGRRIAAGFDIYKSTR 509

Query: 514 E-DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQY----GAISEKEKIP----SIYT 564
           E + + D +   A +R  +PIT+SI+T   Y++   +Y    G +++   IP    +I T
Sbjct: 510 EYNNNYDSDTTGATIRFGLPITDSITTQLAYNISQEKYKVDDGCLTDGVYIPGSPCNIST 569

Query: 565 TL---IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRAS 621
            +   I+   +   S+S  ++YNT+D+   P +G+  +++ + AG GGD+++ +I  R S
Sbjct: 570 AILDGIDQSPWIKSSVSLGLVYNTIDDMKNPHEGIYANTTVEVAGLGGDAKFVKITGRGS 629

Query: 622 YFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY 680
            +  LS+  D+VG +  G G V    +  L++FDQF  S++  +RGFAY GIGP VD   
Sbjct: 630 VYQTLSESLDLVGLISGGAGHVEGYGSDGLRIFDQFQ-STDRMIRGFAYGGIGP-VDPLT 687

Query: 681 A--IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
              +GG  Y +ASA   FP+P+VPE  GLRGA F D+ATLY + V   A   E  D   R
Sbjct: 688 GDHLGGTTYFNASAEAQFPLPVVPESFGLRGAVFADAATLYGSKVTSVAQ--ESTDMQLR 745

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S GV +MW SP G + + Y IP++    D +Q+F F I  R 
Sbjct: 746 ASVGVGLMWASPFGPIRIDYAIPVKKEARDDVQEFNFGISTRF 788


>gi|319407369|emb|CBI81016.1| outer membrane protein [Bartonella sp. 1-1C]
          Length = 798

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 265/770 (34%), Positives = 426/770 (55%), Gaps = 28/770 (3%)

Query: 37  LSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSN 96
           ++ V  +  SIV  IE+RG   V  + I   + +  G++ S+ D+D  VK+++ +G F +
Sbjct: 30  IAMVEKTQASIVHSIEVRGNKYVAAQTIRDNMRIKAGRNFSEGDIDAEVKHLFELGLFYD 89

Query: 97  VKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNI 156
           +KI  + + LI+ + E +++N + F GN   KD  LK  +  +    +  D ++AD+  I
Sbjct: 90  IKINQIGNKLIVAVKEYEVVNQILFQGNKTFKDPDLKRFITLKQNETFSSDKLSADIKVI 149

Query: 157 KQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVI 216
           ++AY + G  NV V VQ  ++    +N+ + I EG + KI  I F GN  +   RL  VI
Sbjct: 150 REAYKTAGRNNVSVTVQTINLGKGRVNVVFNIVEGQRTKIADITFQGNNTFGVRRLRDVI 209

Query: 217 SIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLI 274
             + SG FS   K DVY+++R++ DEEA+R FY++RGYA  +V SS+ ++D++ + Y + 
Sbjct: 210 LTKPSGIFSLLLKGDVYTEDRLAADEEALRRFYYNRGYADFRVISSKAVYDEKNNAYKIH 269

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
           F +DEG  Y +G+I I+S +  +  ++L  +I+ R+G++YN + +++S   I+       
Sbjct: 270 FILDEGACYKIGDIQIESDIAGVDTQSLKKIIKTRTGDVYNAEHVEQSVAIINNKVADSG 329

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F +V  R NR+F    + I Y I+QG   YV+RIEI GN+++ D VIRREL+L+EGD 
Sbjct: 330 YAFAKVDPRRNRNFKNNTISIVYNIEQGPRAYVQRIEIRGNEKTRDYVIRRELDLNEGDA 389

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYE--- 451
            N +M++RAKRR+ + G+F  VNIS +   D  D V L + V ++  G +  +  Y    
Sbjct: 390 YNQTMVQRAKRRLESLGFFKAVNISMV-TTDQPDQVTLVIDVVEVPTGDLSFSGGYTTGG 448

Query: 452 VDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QK 510
              GM +E  + + N  G+G   RL  G G+   +NY  S  DP+FLG   SAG D+ + 
Sbjct: 449 TSPGMSLEVSVTERNLGGRGQYVRLGLGAGQEKSRNYNLSFVDPHFLGYRSSAGLDIFRS 508

Query: 511 THLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQY--GA---ISEKEKIPSIY-- 563
           T+  D + D+     ++R  +PI + +S +  Y     +Y  GA   +++ + +  +Y  
Sbjct: 509 TYRADKAYDVRQTGGSLRFGLPINDKVSANLAYSYVQEEYDFGAQYDLTDDQVVKELYGK 568

Query: 564 -----TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
                    +H  +   SIS  + YN++D+   P  G+      +YAG GGD+Q+ +   
Sbjct: 569 YSGAIVQAAKHSPWHRSSISYGLTYNSIDDMKNPHDGIYARLLQEYAGLGGDAQFLKTTG 628

Query: 619 RASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-- 675
           +A  +  LSD  D+V     G G +    +  L++FD F  S+N  +RGF Y GIGPR  
Sbjct: 629 KAMMYKTLSDRMDMVSLFSVGAGYIYGIGDDGLRIFDMFK-SNNDMIRGFKYNGIGPRQV 687

Query: 676 --VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADKL 730
             + + Y +GG  Y + +A V FP+P+VP+  G RGA F+D+ATLY N+   V      +
Sbjct: 688 SQLGEVYFLGGTTYMNGTAEVQFPIPIVPDSLGFRGAVFLDAATLYGNNYKPVLKDETPV 747

Query: 731 EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
             + S WR S GV +MW SP G +   Y  PL  +EGD +Q   F I  +
Sbjct: 748 TNSHSSWRTSAGVSLMWESPFGPLRFDYAWPLTKQEGDNVQSLNFGISTK 797


>gi|319404365|emb|CBI77965.1| outer membrane protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 798

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 264/770 (34%), Positives = 425/770 (55%), Gaps = 28/770 (3%)

Query: 37  LSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSN 96
           ++ V  +  SIV  IE+RG   V  + I   + +  G++ S+ D+D  VK ++ +G F +
Sbjct: 30  IAMVEETQASIVHSIEVRGNKYVAAQTIRDNMRIKAGRNFSEGDIDAEVKRLFELGLFYD 89

Query: 97  VKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNI 156
           +KI  V + L++ + E +++N + F GN   KD  LK  +  +    +  D ++AD+  I
Sbjct: 90  IKINQVGNKLVVAVKEYEVVNRILFQGNKTFKDPDLKRFITLKQNETFSSDKLSADIKVI 149

Query: 157 KQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVI 216
           ++AY ++G  NV V VQ  ++    +N+ + I EG + KI  I F GN  +   RL  VI
Sbjct: 150 REAYKTVGRNNVSVTVQTINLGKGRVNVVFNIVEGQRTKIADITFQGNNTFGVRRLRDVI 209

Query: 217 SIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLI 274
             + SG FS   K DVY+++R++ DEEA+R FY+ RGYA  +V SS+ ++D++ + Y + 
Sbjct: 210 LTKPSGIFSLLLKGDVYTEDRLAADEEALRRFYYSRGYADFRVISSKAVYDEKNNAYKIH 269

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
           F +DEG  Y +G+I I+S +  +  ++L  +I+ R+G++YN + +++S   I+       
Sbjct: 270 FILDEGACYKIGDIQIESDIAGVDTQSLKKIIKTRTGDVYNAEHVEQSVAIINNKVADSG 329

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F +V  R NR+F    + I Y I+QG   YV+RIEI GN+++ D VIRREL+L+EGD 
Sbjct: 330 YAFAKVDPRGNRNFKNNTISIVYNIEQGPRAYVQRIEIRGNEKTRDYVIRRELDLNEGDA 389

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYE--- 451
            N +M++RAKRR+ + G+F  VNIS +   D  D V L + V ++  G +  +  Y    
Sbjct: 390 YNQTMVQRAKRRLESLGFFKSVNISMV-TTDQPDQVTLVIDVVEVPTGDLSFSGGYTTGG 448

Query: 452 VDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QK 510
              GM +E  + + N  G+G   RL  G G+   +NY  S  DP+FLG   SAG D+ + 
Sbjct: 449 TSPGMSLEVSVTERNLGGRGQYVRLGLGAGQEKSRNYNLSFVDPHFLGYRSSAGLDIFRS 508

Query: 511 THLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQY--GA---ISEKEKIPSIY-- 563
           T+  D + D+     ++R  +PI + +S +  Y     +Y  GA   +++ + +  +Y  
Sbjct: 509 TYRADKAYDVRQTGGSLRFGLPINDKLSANLAYSYVQEEYDFGAQYDLTDDQVVKELYGK 568

Query: 564 -----TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
                    +H  +   SIS  + YN++D+   P  G+      +YAG GGD+Q+ +   
Sbjct: 569 YSGAIVQAAKHSPWHRSSISYGLTYNSIDDMKNPHDGIYARLLQEYAGLGGDAQFLKTTG 628

Query: 619 RASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-- 675
           +A  +  LSD  D+V     G G +    +  L++FD F  S+N  +RGF Y GIGPR  
Sbjct: 629 KAMMYKTLSDRMDMVSLFSVGAGYIYGIGDDGLRIFDMFK-SNNDMIRGFKYNGIGPRQV 687

Query: 676 --VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADKL 730
             + + Y +GG  Y + +A V FP+P+VP+  G RGA F+D+ATLY N+   V      +
Sbjct: 688 SQLGEVYFLGGTTYMNGTAEVQFPIPIVPDSLGFRGAVFLDAATLYGNNYKPVLKDETPV 747

Query: 731 EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
             + S WR S G+ +MW SP G +   Y  PL  +EGD +Q   F I  +
Sbjct: 748 TNSHSSWRTSAGISLMWESPFGPLRFDYAWPLTKQEGDNVQNLNFGISTK 797


>gi|121602491|ref|YP_988897.1| OMP85 family outer membrane protein [Bartonella bacilliformis
           KC583]
 gi|120614668|gb|ABM45269.1| surface antigen/outer membrane protein, OMP85 family [Bartonella
           bacilliformis KC583]
          Length = 798

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 267/774 (34%), Positives = 432/774 (55%), Gaps = 28/774 (3%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A   +S +  +  S+V+ IEI G + V  + I   I +  G++   +D++ AVK ++ +G
Sbjct: 26  AAIPVSIIGNAQASVVQSIEIHGNSLVDAKTIQDNISIKAGKTFESSDINAAVKQLFGLG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            F +VKI  VD+ LI+ + E +IIN + F GN  LK+  LK  +  +    +    ++AD
Sbjct: 86  LFYDVKINQVDNKLIVTVKEYEIINQVLFQGNRALKEPDLKRFITLKPNTTFSAAKLSAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
           +  IK AY ++G  N+ V  Q  ++    +N+ + I EG + KI +I F GNK + + RL
Sbjct: 146 IKTIKDAYRTVGRSNISVSAQTINLGKGRVNVIFTIVEGQRTKIKNIVFEGNKAFGNRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS ++SG FS   + DVY++ER++ DE+A+R FY++RGYA  +V SS+ LFD+  + 
Sbjct: 206 HDVISTKSSGIFSLLMRGDVYTEERLAADEQALRLFYYNRGYADFRVVSSKALFDEISNS 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y + F +DEG  Y +GN+ ++S +  I  K++ ++++ R G++Y+ + I+ S   I+   
Sbjct: 266 YEIYFVLDEGARYKIGNVGVESDIDGIDTKSMTNMLKTRPGDVYSAERIERSVAIINDKV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V  R NRDF    + I Y I+QG  +Y++RI+I GN+++ D+VIRRE++L+
Sbjct: 326 ADSGYAFAKVDPRGNRDFQNHTISILYNIEQGPRVYIQRIDIRGNEKTRDNVIRREIDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N +++ RA+RR+ + G+F  VNIS +P ++ SD V L + V +   G    +  Y
Sbjct: 386 EGDAYNQTLVRRAQRRLESLGFFKAVNISMVPTSE-SDQVTLVIDVVETPTGDFSFSGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  GM +E  + + N  G G  ARL  G G+   +NY FS  +PYFLG  +S+G D
Sbjct: 445 TTGGNSPGMSLEASVTERNLGGYGQYARLGLGAGQGNSRNYNFSFVEPYFLGYRLSSGVD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG-----AISEKEKIPS 561
           + + T   D + D      ++R  V I E IS S  Y     +Y       +++   I  
Sbjct: 505 IFRSTSRVDKAYDSQQTGGSLRFGVSINEEISASLAYSYVQEEYNFGSNYDLTDDAVIEE 564

Query: 562 IYT----TLIEHGKFSS---HSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYH 614
           +Y      +++  K S     S+   + YN++DN   P  G+ I +  +YAG GG++++ 
Sbjct: 565 LYDKYSGAIVQAAKNSPWRRSSVIFGLTYNSVDNMRNPHDGLYIHALQEYAGLGGNAKFL 624

Query: 615 RIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIG 673
           +   +A  +  LSD+ D+VG L  G G +    K+ +++FD F  +++  +RGF Y GIG
Sbjct: 625 KTTGKAIMYKTLSDEMDLVGLLSIGAGYMHEIGKDGVRIFDMFKSNTD-IIRGFRYNGIG 683

Query: 674 PR----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALG 726
           PR      +   +GG  Y +A+A   FP+PL+P+  G RGA F D+ATLY N+   V   
Sbjct: 684 PRQISNTGEVSFLGGTTYMNATAEAQFPIPLIPDSLGFRGAVFADAATLYGNNYKPVLQN 743

Query: 727 ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
              +    S WR S GV +MW SP G + V Y  P+  + GD++Q   F I  +
Sbjct: 744 EKPVTDRGSAWRTSAGVSLMWESPFGPLRVDYAWPITKQNGDQVQNLNFGISTK 797


>gi|260459221|ref|ZP_05807476.1| outer membrane protein assembly complex, YaeT protein
           [Mesorhizobium opportunistum WSM2075]
 gi|259034775|gb|EEW36031.1| outer membrane protein assembly complex, YaeT protein
           [Mesorhizobium opportunistum WSM2075]
          Length = 790

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 266/764 (34%), Positives = 433/764 (56%), Gaps = 26/764 (3%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
           A   +  ++V R+E+ G   V  E I + I +  G++ S +D+D AVK ++  G FS+V+
Sbjct: 32  ATSAAEAAVVSRVEVSGNQRVDAETIRNYITIKPGKAFSSSDIDSAVKALFGTGLFSDVQ 91

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQ 158
           I  V S L++ + E K++N + F GN  LKD+ L+  V+ +  + + + T+++DV  +K 
Sbjct: 92  INQVGSTLVVKVSEYKVVNQVLFQGNKKLKDNALQAAVQLKPRSTFSQATLDSDVEAVKA 151

Query: 159 AYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISI 218
           AY  IG  +  V  Q   +    +N+ + I EG + +I +I FVGN  YS  RL  VI+ 
Sbjct: 152 AYRRIGRDDAGVTTQIMDLGDNRVNVVFKITEGDRTQIAAINFVGNSAYSSRRLSDVINT 211

Query: 219 RTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQV-LFDKQKSGYVLIFQ 276
           + S + SF  + DVY ++++  D+E +R FY++ GYA  +V S V   D   + Y +   
Sbjct: 212 KRSSWVSFILRDDVYDEDKLRADQELLRRFYYNHGYADFQVVSAVGELDNATNKYTVTIT 271

Query: 277 IDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERP 336
           + EGE Y  G+IS++ST+ E+  K+L S++  + G++YN + +++S   +++        
Sbjct: 272 VQEGERYNFGDISVESTIPEVDAKSLQSVVETQKGDVYNAKNVEDSIIALTEKVAGSGYA 331

Query: 337 FVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPIN 396
           F +V  R +R+F    + + Y IDQG+  Y++RIEI GND++ D VIRRE ++SEGD  N
Sbjct: 332 FAQVTPRGDRNFENHTISVVYTIDQGTKAYIERIEIRGNDRTRDYVIRREFDVSEGDAFN 391

Query: 397 YSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV---D 453
             +++RAK+R+    YF +V+IS +P +   D V+L V V + S G   +   Y      
Sbjct: 392 QVLVQRAKKRLEDLNYFDKVDISTVPGSQ-PDQVVLVVDVVEKSTGEFSVGAGYSTGGDT 450

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL 513
            G  VEG I + NF G+G   +++AG G+++ ++Y+ S  +PYFLG  I+AGFD+ K+  
Sbjct: 451 AGPSVEGSITERNFLGRGQFIKVSAGGGKNS-RDYSLSFTEPYFLGRRIAAGFDIYKSTR 509

Query: 514 E-DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQY-----------GAISEKEKIPS 561
           E + + D +   A +R  +PIT SI+T   Y++   +Y           G +     I  
Sbjct: 510 EYNNNYDSDTTGATIRFGLPITNSITTQLAYNISQEKYKVDDSCGPTGPGNLDGTCTISP 569

Query: 562 IYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRAS 621
                I    +   S+S  ++YNT+D+   P +G+  +++ + AG GGD+++ ++  R S
Sbjct: 570 AILDGIAQSPWIKSSVSLGLVYNTIDDMKNPHEGIYANTTVEVAGLGGDAKFVKVTGRGS 629

Query: 622 YFYLLSDDSDIVGSLRFGYGCVIP--SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKK 679
            +  LS+  D+VG +  G G V     + +L++FDQF  S++  +RGFAY GIGP VD  
Sbjct: 630 VYQTLSEQLDLVGLISGGAGHVEAYGGDGSLRIFDQFQ-STDRMIRGFAYGGIGP-VDPT 687

Query: 680 YA--IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFW 737
               +GG  Y +ASA   FP+P+VPE  GLRGA F D+ATLY + +    ++    D   
Sbjct: 688 TGDHLGGVTYFNASAEAQFPLPVVPESFGLRGAVFADAATLYGSKIDTSVNQ-SSLDMKL 746

Query: 738 RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           R S G+ +MW SP G + + Y IP+R    D +Q+F F I  R 
Sbjct: 747 RASVGIGLMWASPFGPIRIDYAIPVRKEATDDVQEFNFGISTRF 790


>gi|90419599|ref|ZP_01227509.1| outer membrane protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90336536|gb|EAS50277.1| outer membrane protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 818

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 258/781 (33%), Positives = 428/781 (54%), Gaps = 54/781 (6%)

Query: 50  RIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIID 109
           RI++RG + V  + +   + +  GQ++++AD D AV+ +++ G FS+V+I      LI+ 
Sbjct: 43  RIDVRGNSRVEADTVRGFMQISAGQNVTEADQDQAVRRLFSTGLFSDVRISQSGGTLIVQ 102

Query: 110 LIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVM 169
           + E +I+N + F GN+ +KD+QL   V+++  AAY   T  ADV  I+ AY SIG  + +
Sbjct: 103 VDENQIVNQVLFQGNSKVKDEQLIAAVQTQPRAAYSSATTQADVEAIQAAYTSIGRSDAI 162

Query: 170 VKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GK 228
           V V+   I    +N+ Y I+EG + KI SI FVGN  +  +RL++VI++R SG  SF  +
Sbjct: 163 VSVRTQEIGENRVNVIYDIQEGDRTKIESISFVGNNAFGDSRLKQVIALRESGILSFIQR 222

Query: 229 TDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGN 287
            D+Y  ER+  DEE +R FY++RGYA  ++ S V   D+ ++ Y +   +DEGE Y+ GN
Sbjct: 223 NDIYDPERLRTDEETLRRFYYNRGYADFRIVSSVAELDESQNSYFITITVDEGERYSFGN 282

Query: 288 ISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRD 347
           ++I ST+  +  ++L   I  ++G +Y+ ++++++   ++    +    F +V  R +RD
Sbjct: 283 VTIDSTVAGVDTESLYGEIETQTGEVYSAKDVEDTLVNLTNSLANAGFAFAQVTPRGDRD 342

Query: 348 FAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRI 407
           FA R + I+Y+IDQG   YV+R+EI GN ++ D VIRRE ++SEGD  N  +++RAK+R+
Sbjct: 343 FASRTIAIDYVIDQGPRAYVERLEIRGNTKTRDYVIRREFDVSEGDAFNQVLVQRAKQRL 402

Query: 408 MATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV---DKGMGVEGHIDD 464
               YF +V++S  P  +    +++   V++ + G + +   Y       G   E  + +
Sbjct: 403 EDLKYFDKVSVSTAPGAEPDRVIVIVDVVEK-ATGELSLGGGYTTGGESSGPVAEIGVTE 461

Query: 465 NNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDES 524
            NF G+G   +++AGFG    +NY+ S  +PYFLG  ++AGFD+ ++    G  D     
Sbjct: 462 RNFLGRGQFIKVSAGFGAD-TRNYSLSFTEPYFLGRRLAAGFDVYRSESSSGDYDSERTG 520

Query: 525 AAVRMIVPITESISTSFKYDLRFLQYG--------------------------------- 551
             +R+  PITE ++    Y+++  ++G                                 
Sbjct: 521 GDIRIAAPITEDLTAQIAYNIKQEKFGDDNGTTYNQFSNSQLVDGSGNVFESTCGNPDPN 580

Query: 552 ----------AISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
                     A++       I    I    + + S+S ++ YNTLDN   PR G  I + 
Sbjct: 581 NNIVDPNGRPAVAPPYTDSPIINQAICESPYLTSSVSYALTYNTLDNTNDPRNGFFIQAG 640

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSS 660
            ++AG GGD+ + +   +ASYF+LL+++ D++GSL  G G V       L++FD F    
Sbjct: 641 QEFAGVGGDANFVKTTGKASYFHLLNEEYDVIGSLNAGGGNVTSFGGDGLRVFDNFFKGQ 700

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           +  +RGF YKGIGPR     +IGG  Y++ASA  +FP+P +    G RGA F D+ +L+ 
Sbjct: 701 D-IVRGFDYKGIGPR-QNGVSIGGNNYANASAEATFPLPGISRDLGFRGAVFADAGSLWG 758

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           +        + G D+  R S GV ++W SP G + V Y  PL   + D++Q+F F   +R
Sbjct: 759 SEYENDPGVI-GVDASLRASAGVGLIWASPFGPLRVNYAHPLAKEDFDELQEFSFGFSSR 817

Query: 781 M 781
            
Sbjct: 818 F 818


>gi|13470835|ref|NP_102404.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021578|dbj|BAB48190.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 794

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/768 (34%), Positives = 430/768 (55%), Gaps = 30/768 (3%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
           A   +  ++V R+E+ G   V  + I + I +  G++ S +D+D AVK ++  G FS+V+
Sbjct: 32  ATSAAEAAVVSRVEVSGNQRVDADTIRNYITIKPGKAFSSSDVDAAVKALFGTGLFSDVQ 91

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQ 158
           I  V S L++ + E K++N + F GN  LKD+ L   V+ +    + + T+++DV  +K 
Sbjct: 92  INQVGSTLVVKVAEYKVVNQVLFQGNKKLKDNALAAAVQLKPRGTFSQATLDSDVEAVKA 151

Query: 159 AYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISI 218
           AY  IG  +  V  Q   +    +N+ + I EG + +I +I FVGN  YS  RL  VI+ 
Sbjct: 152 AYRRIGRDDAGVTTQVMELGDNRVNVVFHITEGDRTQIAAINFVGNSAYSSRRLSDVINT 211

Query: 219 RTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQV-LFDKQKSGYVLIFQ 276
           + S + SF  + DVY ++++  D+E +R FY++ GYA  +V S V   D   + Y +   
Sbjct: 212 KRSSWVSFILRDDVYDEDKLRADQELLRRFYYNHGYADFQVVSAVGELDNATNKYTVTIT 271

Query: 277 IDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERP 336
           + EGE Y  G+IS++ST+ E+  K+L S++    G++YN +++++S   +++        
Sbjct: 272 VQEGERYNFGDISVESTIPEVDSKSLESVVETHKGDVYNAKDVEDSIIALTEKVAGSGYA 331

Query: 337 FVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPIN 396
           F +V  R +R+F    + + Y +DQG+  Y++RIEI GND++ D VIRRE ++SEGD  N
Sbjct: 332 FAQVTPRGDRNFENHTISVVYTVDQGTKAYIERIEIRGNDRTRDYVIRREFDVSEGDAFN 391

Query: 397 YSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV---D 453
             +I+RAK+R+    YF +V IS +P +   D V+L V V + S G   +   Y      
Sbjct: 392 QVLIQRAKKRLEDLNYFDKVEISTVPGSQ-PDQVVLVVDVVEKSTGEFSVGAGYSTGGDS 450

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL 513
            G  VEG I + NF G+G   +L+AG G+++ ++Y+ S  +PYFLG  I+AGFD+ K+  
Sbjct: 451 AGPSVEGSITERNFLGRGQFIKLSAGGGKNS-RDYSVSFTEPYFLGRRIAAGFDIYKSTR 509

Query: 514 E-DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQY-----GAISEKEKIPSIYTTL- 566
           E + + D +   A VR  +PIT SI+T   Y++   +Y        ++    P     + 
Sbjct: 510 EYNNNYDSDTVGATVRFGLPITNSITTQLAYNISQEKYKVDNSCGPTDPPNPPGGTCNIS 569

Query: 567 ------IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA 620
                 I    +   S+S  ++YNT+D+   P +G+  +++ + AG GGD+++ +I  R 
Sbjct: 570 QAILDGIAESPWIKSSVSLGLVYNTIDDMKNPHEGIYANTTVEVAGVGGDAKFVKITGRG 629

Query: 621 SYFYLLSDDSDIVGSLRFGYGCV--IPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDK 678
           S +  LS+  D+VG +  G G V    ++ +L++FD F  S++  +RGFAY GIGP    
Sbjct: 630 SIYQTLSEQLDLVGLISGGAGHVEGYGNDGDLRIFDHFQ-STDRMIRGFAYGGIGPVASG 688

Query: 679 KYA--IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSF 736
                +GG  Y +ASA   FP+P++PE  GLRGA F D+ATLY N +A     L   DS 
Sbjct: 689 TSGDHLGGTTYFNASAEAQFPLPVIPESFGLRGAVFADAATLYGNKIA--DQTLVDQDST 746

Query: 737 ---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R S GV +MW SP G + + Y IP+R    D +Q+F F I  R 
Sbjct: 747 GMKLRASVGVGLMWASPFGPIRIDYAIPVRKEASDDVQEFNFGISTRF 794


>gi|306841878|ref|ZP_07474558.1| outer membrane protein assembly complex, YaeT protein [Brucella sp.
           BO2]
 gi|306288008|gb|EFM59410.1| outer membrane protein assembly complex, YaeT protein [Brucella sp.
           BO2]
          Length = 704

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 257/711 (36%), Positives = 402/711 (56%), Gaps = 21/711 (2%)

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAY 144
           +K ++AMG FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +
Sbjct: 1   MKRLFAMGLFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLTRAVQLKPRAPF 60

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D  T+ AD   IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN
Sbjct: 61  DVATMEADKEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGN 120

Query: 205 KNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
           + +S  RL  VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  
Sbjct: 121 QAFSGRRLRDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNA 180

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
           + D   + Y +   +DEG  YT G++S++ST+  +  + L  L++ RSG  Y+ +EI++S
Sbjct: 181 VLDPSTNEYTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRSGKPYSAKEIEDS 240

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
              +++        F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D V
Sbjct: 241 VLSVTESVAGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYV 300

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           IRRE +L+EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G
Sbjct: 301 IRREFDLNEGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTG 359

Query: 443 SVGIATNYEV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
              I   Y       G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG
Sbjct: 360 EFSIGGGYTTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLG 419

Query: 500 SPISAGFDL-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISE 555
             +SAGFD+ ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E
Sbjct: 420 YRLSAGFDVFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAE 479

Query: 556 KEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
               P++     E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +
Sbjct: 480 NYYAPALLEA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVK 538

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGP 674
              + +Y+  LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP
Sbjct: 539 TTFKGNYYQTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGP 597

Query: 675 RVD----KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKL 730
             D    K+Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        +
Sbjct: 598 YQDAKNGKRYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DI 653

Query: 731 EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            G+D   R S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 654 SGDDKKLRASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 704


>gi|110633741|ref|YP_673949.1| surface antigen (D15) [Mesorhizobium sp. BNC1]
 gi|110284725|gb|ABG62784.1| surface antigen (D15) [Chelativorans sp. BNC1]
          Length = 788

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 275/801 (34%), Positives = 440/801 (54%), Gaps = 40/801 (4%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            + + RL+      +   G ++    +  L+A   +  + V RIE+RG   V  E I ++
Sbjct: 1   MKAVSRLMSAVSAVALSAGIVVSGAMVAELTATVSAYAATVSRIEVRGNRRVDAETIRNQ 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           + +  GQ+ + AD+D AVK ++A G F++V I      L++ + E  I+N + F GN  +
Sbjct: 61  VGIRPGQNFTTADVDEAVKRLFATGLFADVSITQQGGALVVSVDEYAIVNQVLFQGNRKV 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KD  L   ++ +  +A+    V +D   I++AY  +G     V  +   +    +N+ + 
Sbjct: 121 KDQTLSEAIQLKPRSAFSNQLVESDAEVIREAYRRVGRDEATVTSEVQDLGEGRVNVIFH 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRA 246
           ++EG + KI  I F GN  +S  RL  VI+ + S  FSF  + DVY + R+  DEE +R 
Sbjct: 181 VQEGDRTKITEINFEGNTAFSDRRLRDVITTKRSNVFSFMMRNDVYDEARLQADEELLRR 240

Query: 247 FYHDRGYAAVKV--SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLS 304
           FY++RGYA  +V  S   L D +   Y +   +DEG+ YT G++SI+ST+  +    L S
Sbjct: 241 FYYNRGYADFRVISSDAQLVDNK---YTITIMVDEGQRYTFGDVSIESTIPGVDVSALQS 297

Query: 305 LIRIRSGNLYNPQEIKES----SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
            ++ R G +Y+ +++++S    +E ++ + ++    F +V  R NRDF  R + + Y ID
Sbjct: 298 ALKTRQGAVYSAEDVEQSIIGLTEDVAGHGYA----FAQVTPRGNRDFQNRTISVVYSID 353

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           +G   YV+RIEI  N+++ D VIRRE ++SEGD  N  +I+RAKRR+    +F  VNI+ 
Sbjct: 354 EGPRAYVERIEIRANNRTRDYVIRREFDVSEGDAFNQILIQRAKRRLERLNFFQTVNITT 413

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEV------DKGMGVEGHIDDNNFFGQGYRA 474
           +P +   D V+L V V + S G   I   Y          G  VEG + + NF G+G   
Sbjct: 414 VPGSQ-PDQVVLVVDVVEKSTGEFSIGAGYTTSASSGSSGGFSVEGSVTERNFLGRGQFI 472

Query: 475 RLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKT--HLEDGSLD-INDES---AAVR 528
           R AA  G  + ++YTFS  +PYFLG  I+AGFD+ +     ED   D I D       VR
Sbjct: 473 RFAAAGGEKS-RDYTFSFTEPYFLGRRIAAGFDVFRNTRTFEDSDGDNIYDREVTGGTVR 531

Query: 529 MIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDN 588
             +PIT++++    Y+L   +Y  +++   + +     ++ GK+   S+S S+IYNT+DN
Sbjct: 532 FGLPITDALTAQLAYNLTQEEYERLADSSDLSTGINQALDQGKWVKSSVSASLIYNTIDN 591

Query: 589 PIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SN 647
              P  G+  + + + AG GGD+++ +  +RA+Y+  LSD+ D+VG L  G G ++   +
Sbjct: 592 MQNPHDGIYANLTTEIAGLGGDAKWAKFTARANYYRTLSDELDLVGLLTVGGGHIVAFGD 651

Query: 648 KNLQLFDQFSVSSNYYLRGFAYKGIGP-------RVDKKYAIGGKIYSSASAAVSFPMPL 700
           + L++FDQF+ S++  +RGF Y GIGP         D+ Y +GG  Y  ASA   FP+P+
Sbjct: 652 EPLRIFDQFN-SNDRIIRGFEYNGIGPFELRSAGDDDRDY-LGGTTYFHASAEAQFPLPI 709

Query: 701 VPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
           VPE  GLRGA F D+ATLY +     +  + G D  WR S G  ++W SP G + V Y  
Sbjct: 710 VPESFGLRGAVFADAATLYGSDYT--SPLVRGTDMEWRASVGASLIWASPFGPLRVDYAE 767

Query: 761 PLRHREGDKIQQFGFRIGNRM 781
           P+   + D+I+ + F I  R 
Sbjct: 768 PVVKEDTDRIRHWNFGISTRF 788


>gi|114704868|ref|ZP_01437776.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
 gi|114539653|gb|EAU42773.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
          Length = 828

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 264/796 (33%), Positives = 424/796 (53%), Gaps = 67/796 (8%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSV 105
           ++V RI++RG + V    I S   V  GQ++++AD D  ++ +++ G FS+V++      
Sbjct: 40  AVVNRIDVRGNSRVEASTIRSFSQVQPGQNVTEADQDAILQRLFSTGMFSDVRVSQSGGT 99

Query: 106 LIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGY 165
           LII++ E  ++N + F GN+ LKD+QL  IV++  + A+ +  V+ADV  I+ AY +IG 
Sbjct: 100 LIIEVSENAVVNQVLFQGNSKLKDEQLDAIVQTNPSGAFSQSQVDADVQRIRDAYTNIGR 159

Query: 166 LNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS 225
            + +V  Q   +    +N+ Y ++EG + K+  I FVGN  Y   RL++VI +R SG  S
Sbjct: 160 SDALVSAQVQRLGQGRVNVIYTMQEGDRTKVAQINFVGNNFYGDTRLKQVIDLRESGILS 219

Query: 226 F-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIY 283
           +  + D+YS+E +  DEE +R FY++RG+A  ++ SS    D +++ Y + F +DEGE Y
Sbjct: 220 WLQRNDIYSEEGLRSDEEKLRRFYYNRGFADFRIISSNAQLDPEQNSYFITFTVDEGERY 279

Query: 284 TVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTR 343
           T GN++I ST+ E+  + L S +    G++Y+ ++++ES   ++         F +V  R
Sbjct: 280 TFGNVTIDSTIAEVDSEALYSELETAPGDIYSAEDVEESIVNLTDRLAGSGFAFAQVTPR 339

Query: 344 INRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERA 403
            +RDFA R + + Y+IDQG   YV+RIEI GND++ D VIRRE ++SEGD  N  +I+RA
Sbjct: 340 GDRDFASRTIGVNYVIDQGPRAYVERIEIRGNDKTRDYVIRREFDVSEGDAFNQVLIQRA 399

Query: 404 KRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV---DKGMGVEG 460
           K+R+   GYF  VN+S  P  +  D VI+ + V + + G + I   Y      +G   E 
Sbjct: 400 KQRLEDLGYFETVNVSTAPGAE-PDRVIVIIDVVEKATGELSIGGGYTTGGDSEGPVAEI 458

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG--------------------- 499
            + + NF G+G   +++AGFG  + +NY  S  +PYFLG                     
Sbjct: 459 GVTERNFLGRGQFIKVSAGFGTDS-RNYNLSFTEPYFLGQRLAVGFDVYRSESTAGDYDT 517

Query: 500 ----------SPISAGFDLQKTH----------------LEDGSLDINDESAAVRMIVPI 533
                     +PI+  F  Q  +                  DG    +D+   +R     
Sbjct: 518 VRTGGDIRVAAPITENFTAQVAYNYKEEEFGDEIGVDLRTTDGRRLFDDDGDELRSTCAS 577

Query: 534 TESISTSFKYD-------LRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
               S +F  D        RF    A +  +    I    I    +++ S+S S++YNTL
Sbjct: 578 PNGPSRAFDRDGDPVDAARRFNSLTAPAFTDS--PIINEAICDSPYTTSSVSYSLVYNTL 635

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP- 645
           D+   PR+G  + +  +YAG GGD+++ +   +AS F L+S++ D++GS+    G V   
Sbjct: 636 DSATQPREGFFVQAGQEYAGLGGDAEFLKTTGKASAFALISEEYDLIGSVTATGGHVTEI 695

Query: 646 SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERA 705
           S   L++FD F    +  +RGF  KGIGPR     AIGG  ++ A A  +FP+PL+    
Sbjct: 696 SGDELRVFDNFFKGKD-LVRGFESKGIGPR-QNGVAIGGTQFAGAQAEATFPLPLLSRDL 753

Query: 706 GLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHR 765
           G RGA F D+ TL+ +     A  + G D+  R S GV ++W+SP G + V Y  PL  +
Sbjct: 754 GFRGALFADAGTLWGSQFEDRAGVV-GTDAELRASVGVGLIWDSPFGPLRVNYAEPLEKQ 812

Query: 766 EGDKIQQFGFRIGNRM 781
             D+ ++F F   +R 
Sbjct: 813 SFDETEEFSFGFSSRF 828


>gi|1262291|gb|AAA96788.1| OMP1 precursor [Brucella abortus]
          Length = 782

 Score =  442 bits (1137), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 267/769 (34%), Positives = 425/769 (55%), Gaps = 32/769 (4%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AV+ ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVQRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L    + +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLAPCRQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRTDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFD----- 265
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D     
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 266 -KQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
            + +S ++ +  I  G          Q  +  I+++ ++    +R+ +L + +EI++S  
Sbjct: 266 YRSRSPWMKVRVIPFGRC----KRGKQPLMVSIRRRLIVWSRPVRA-SLTSAKEIEDSVL 320

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
            +++        F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIR
Sbjct: 321 SVTESVAGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIR 380

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           RE +L+EGD  N  M++RAKRR+ A  +F  VNIS  P +D  D VIL V V + S G  
Sbjct: 381 REFDLNEGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSD-PDQVILVVDVVEKSTGEF 439

Query: 445 GIATNYEV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSP 501
            I   Y       G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  
Sbjct: 440 SIGGGYTTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYR 499

Query: 502 ISAGFDL-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKE 557
           +SAGFD+ ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E  
Sbjct: 500 LSAGFDVFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENY 559

Query: 558 KIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIG 617
             P++     E+  +   S+S S+ Y+++D+   P  G+      ++AG GGD++Y +  
Sbjct: 560 YAPALLEA-AENSPWLRSSVSYSLTYSSIDDIKNPHDGLYGKFIQEFAGLGGDAKYVKTT 618

Query: 618 SRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV 676
            + +Y+  LS ++DIVG L  G G +    +  +++FD F  SS+  +RGF + GIGP  
Sbjct: 619 FKGNYYQTLSQEADIVGLLGVGAGYIHEFGDDGVRIFDLFKNSSD-IIRGFKFNGIGPYQ 677

Query: 677 D----KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG 732
           D    K+Y +GG  Y S +A V FPMP++PE  G+RGAFF D+ATLY N        + G
Sbjct: 678 DAKNGKRYWMGGTTYFSGTAEVQFPMPVLPESLGVRGAFFADAATLYGNDTP----DISG 733

Query: 733 NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +D   R S GV +MW SP G +   Y  P+   + DK+Q F F +  + 
Sbjct: 734 DDKKLRASVGVSLMWASPFGPLRFDYAFPVAKADTDKVQNFNFGVSTKF 782


>gi|304391653|ref|ZP_07373595.1| outer membrane protein assembly complex, YaeT protein [Ahrensia sp.
           R2A130]
 gi|303295882|gb|EFL90240.1| outer membrane protein assembly complex, YaeT protein [Ahrensia sp.
           R2A130]
          Length = 779

 Score =  402 bits (1034), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 243/759 (32%), Positives = 410/759 (54%), Gaps = 29/759 (3%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           S    +  ++V RI++RG   V  + I S + V  G++ +  D D +++ ++A G FS+V
Sbjct: 35  SGATAAQAAVVNRIDVRGNRRVDADTIRSYVTVKPGRNYTTFDTDESLRALFATGLFSDV 94

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIK 157
           +I    S L++++ E   IN + F GN  +KDDQL  IV+S+S   + +D V++D+  ++
Sbjct: 95  RISRAGSALLVEVEENPTINLVRFEGNEKVKDDQLGRIVQSQSLGIFSQDKVDSDLERVR 154

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           +     G  N  V V+   +    +N+ +VI EG + KI +I FVGN  +   RL  +IS
Sbjct: 155 EVVRRSGRANSQVTVRVDQLDNNRVNVIFVINEGGRTKIKNIEFVGNNAFGDRRLADIIS 214

Query: 218 IRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIF 275
              S   S+ K  D+Y  +R+  DEE +R FY +RGYA  +V S V  FD   + Y ++ 
Sbjct: 215 HNESNLLSWLKRDDIYDPDRLRADEERLRRFYFNRGYADFQVISAVAEFDSADNVYNIVI 274

Query: 276 QIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGER 335
            ++EG++Y  G+I I + L  +    L   ++I SG++Y+ + ++++   ++    +   
Sbjct: 275 TVEEGDLYRFGSIQIDNALAVVDDGLLQDNLKIDSGDIYSARNVEKTLVAMTDAIAASGY 334

Query: 336 PFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPI 395
            F  V  R +R+F  R +DI + +D+G   YV+RI++ GN ++ + VIRRE ++SEGD  
Sbjct: 335 AFAEVTPRGDRNFENRTIDITFFVDEGPRTYVERIDVVGNTRTREYVIRREFDISEGDAY 394

Query: 396 NYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKG 455
           N  ++ +AK R+ A G+F  V ++  P +   D V++ V+VK  + G   I   Y    G
Sbjct: 395 NRVLVNKAKTRLDALGFFDSVRMTTRPGS-APDRVVVVVNVKDKATGEFSIGGGYSSANG 453

Query: 456 MGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKT---H 512
              E  + + NF G+G   +++AG G   V+ Y  S  +PYFLG+ I+AGFD+ +T    
Sbjct: 454 PIAEVSLTEKNFLGRGQFLKISAGLG-DDVEKYELSFTEPYFLGNRIAAGFDISRTTSGD 512

Query: 513 LEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKF 572
            +D S D    S  +R   P+T++++ S  Y   +    +I     + +     +    +
Sbjct: 513 TDDKSFDSETTSFRLRAAAPLTDNLTASVNYTYTYEDL-SIDPGTVVSTAVQDTLNRSPY 571

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDI 632
           S+ SI  ++ Y+T+DN   PR+G+      D AG GGD++Y R  +    +YLLS+D+DI
Sbjct: 572 STSSIGYALTYSTIDNRKSPREGIYAQFRQDIAGLGGDAEYVRTEAELYAYYLLSEDADI 631

Query: 633 V-------GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGK 685
           V       G++  G+G       +L++ D F    N  +RGF  +G+GPR     A+GGK
Sbjct: 632 VLFGGATAGAIE-GFGS-----DDLRITDNFFKGGN-LVRGFDSRGLGPRATDGEALGGK 684

Query: 686 IYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG---NDSFWRVSTG 742
            ++S +A V FP+PL+P   GLR A F D+ T+Y N      DK++    +++  R S G
Sbjct: 685 YFASVTAEVQFPLPLLPRSYGLRAALFADAGTVYGNDF----DKIDPTIRDENSIRASVG 740

Query: 743 VEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             ++W+SP G +   +   L   + D+ Q F F +  + 
Sbjct: 741 ASLLWDSPFGPLRADFAHVLAEEDFDEKQFFKFGVSTKF 779


>gi|254469955|ref|ZP_05083360.1| outer membrane protein assembly complex, YaeT protein [Pseudovibrio
           sp. JE062]
 gi|211961790|gb|EEA96985.1| outer membrane protein assembly complex, YaeT protein [Pseudovibrio
           sp. JE062]
          Length = 793

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 239/762 (31%), Positives = 391/762 (51%), Gaps = 27/762 (3%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++V +I + GAT +  E + + + +  G+S S  D+D ++  +YA G F++V I+  
Sbjct: 36  AEAAVVNKIVVNGATRIEDETVRNYLTIRPGKSFSAIDIDESLTTLYATGLFADVSIEQR 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L++D+ E  +I  + F GN  L D  L+ +VRS   +      V +D  N+ +AY  
Sbjct: 96  GGTLVVDVKENPVIGKISFEGNKRLTDQALQSVVRSSERSMLTRARVQSDAQNLLEAYRR 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G     V+ +    +   +++ + IEEG K  +  I F+GNK +S   L   I  R SG
Sbjct: 156 SGRYRASVEPKIIERANNRVDLVFEIEEGDKTGVARISFIGNKAFSDGYLREQIQTRESG 215

Query: 223 YFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEG 280
           +  + +T DVY  +R+  D+EA+R FY+ +GYA  +V S V   D++++ + + F +DEG
Sbjct: 216 FLGWLRTTDVYDPDRLEVDQEALRQFYYQKGYADFRVVSAVADLDREQNIFYVTFTVDEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           E Y  G+I I ++L  I  + +   +R +SG+ YN  E++++ E ++         F +V
Sbjct: 276 EQYEFGDIEIDTSLSAIDPEAMRQYLRTQSGDTYNSLEVEKTLEALTLEVSKAGYAFAQV 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
           + R  RD+  + V I YLI++G  +Y++RI + GND++ + VIRRE +L+EGD  N  ++
Sbjct: 336 RPRGERDYENKTVSITYLIEEGPRVYIERINVRGNDRTREYVIRREFDLAEGDAYNRILL 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
           ++A+RR+  T YF  V I++   +   D VI+ V V++   G V     Y    G+  + 
Sbjct: 396 DKAERRLRNTRYFENVRITRQQGS-APDRVIINVDVEEQPTGEVSFGVGYSTSDGVIGDI 454

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDI 520
            I + NF G+G   + A G G    Q Y F   +P+F+G  ISAG D+ +      S   
Sbjct: 455 SITERNFLGRGQYVKAAVGGGTDN-QKYEFKFVEPFFMGRRISAGLDVYRRVYNQNSSRA 513

Query: 521 NDES---AAVRMIVPITESIST------SFKYDLRFLQYGAISEKEKIPSIYTTLIEHGK 571
            DE     AV   +P+ E   T       ++ DL       I++     S+       G+
Sbjct: 514 YDEQTTGGAVNFGLPLREDELTLNLFYKLYQRDLTRSDSNGINDCADGVSL-GVCDSLGE 572

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           +++     S++YNTLDN + PR G L +   + AG GG SQY R   +AS F  L  +  
Sbjct: 573 YTTSLAGFSLVYNTLDNNLNPRDGYLATYEQEVAGLGGQSQYLRGQFKASAFEELYAEWG 632

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
           +VG ++   G +      L++ DQF  S +  +RGFA  G GPR +    A+GGK Y +A
Sbjct: 633 LVGLVKGSAGYIESIGNRLRVTDQFQGSPD-RIRGFATNGYGPRDEVGGDALGGKYYVAA 691

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHV-----ALGADKLEGNDSFWRV 739
           +    FP P+ PE  GL GA F D+ +L+      AN +     +    K++  D   R 
Sbjct: 692 TVEGQFPFPVFPEELGLSGAVFADAGSLWGVDSDLANAITNPGGSATPGKIQSEDFDLRA 751

Query: 740 STGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           S G  ++W SP G +   +  P+   + D+ Q F    G R 
Sbjct: 752 SVGFGVLWQSPFGPLRADFAWPVLKNDVDETQVFKLSGGTRF 793


>gi|254502739|ref|ZP_05114890.1| outer membrane protein assembly complex, YaeT protein [Labrenzia
           alexandrii DFL-11]
 gi|222438810|gb|EEE45489.1| outer membrane protein assembly complex, YaeT protein [Labrenzia
           alexandrii DFL-11]
          Length = 792

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 231/756 (30%), Positives = 394/756 (52%), Gaps = 33/756 (4%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++ R IE+RG + + ++ ++S + +V G+S   AD+D ++K +YA G F+ V+I   
Sbjct: 37  AEAAVARNIEVRGTSRIEEDTVISYMTIVPGRSYGAADVDESLKALYATGLFATVEITPR 96

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
            S +I+ + E  +I  + F GN  +KDD L   VRS+S +      V +DV +I +AY  
Sbjct: 97  GSTVIVTVTENPMITRVSFEGNRKIKDDALATAVRSQSRSMLSRAKVQSDVQSILEAYRR 156

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G     V+ +        +++ + I EG K  +  I F+GN ++S  RL  VI  R SG
Sbjct: 157 SGRYGAAVEPKIIERGQNRVDLVFEINEGAKTGVERISFIGNNSFSDGRLRDVIRTRESG 216

Query: 223 YFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
             S+ + TD Y  +R++ DEE +R +Y+++GYA  + VS     D++ + + + F +DEG
Sbjct: 217 LLSWLRSTDTYDPDRLAADEELLRQYYNNKGYADFRIVSVSADLDRENNIFYVTFTVDEG 276

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y VGN+ + ST+ E+  + L  L+R RSG  +N   +++S E I+         F RV
Sbjct: 277 DRYDVGNVEVVSTIAEVDPEDLRRLVRTRSGRTFNALRVEQSVEDITLRVSEEGYAFARV 336

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
           + R +R++    +D+ Y I++G   YV+RI I GND++ + VIRRE +++EGD  N +++
Sbjct: 337 RPRGSRNYENNTIDLIYYIEEGPRAYVERINIIGNDRTREYVIRREFDVAEGDAFNRALV 396

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
           ++A+RR+    +F  V+I+    +   D VI+ V V++   G +     Y    G+  + 
Sbjct: 397 DKAERRLRNLNFFERVSITTQQGS-APDRVIVNVQVEEKPTGEISFGIGYSTTDGVVGDI 455

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISA---------------G 505
            + + NF G+G   ++  G G    Q Y F   +P+F+G  ++                 
Sbjct: 456 SLTERNFLGRGQYVKIGVGGGSD-TQTYEFRFIEPFFMGRRVALDLDVYRQVNDANSYRS 514

Query: 506 FDLQKTHLEDG-SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYT 564
           FD ++T    G +L + ++   +R+   I E  +T  KY    +     S      ++  
Sbjct: 515 FDEERTGGGFGFTLPLREDETTLRLFYAIYEEKNTDGKYGSTGIN--NCSTANLSLAVCD 572

Query: 565 TLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFY 624
           +L   G + +  +   + YNTLD  + P  G+  S   ++AG GGDSQY +   +A  + 
Sbjct: 573 SL---GTYLTSLVGYELRYNTLDRNLNPTDGIYASFRQEFAGVGGDSQYIKSEIQARAYK 629

Query: 625 LLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIG 683
            +  D  +VGS++F  G ++  N+ L++ +QF +  N  +RGF  +GIGPR      AIG
Sbjct: 630 EILADYGLVGSVQFRGGNIMGLNERLRVSEQFMLGGN-LIRGFENRGIGPRDATSDDAIG 688

Query: 684 GKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLEGNDSFW 737
           G+ Y +AS    FP+P +P+  GL GA F D+ +L+       + V  G  ++  N    
Sbjct: 689 GRWYFAASTEAQFPIPGIPKELGLGGALFADAGSLWDADNELVDIVENGGGRILSNGFDL 748

Query: 738 RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQF 773
           R S G  I W SP G +   +  PL   + D+ Q F
Sbjct: 749 RASVGFGIRWQSPFGPLKADFAYPLLKEDSDRTQVF 784


>gi|328543719|ref|YP_004303828.1| Outer membrane protein assembly complex, YaeT protein [polymorphum
           gilvum SL003B-26A1]
 gi|326413463|gb|ADZ70526.1| Outer membrane protein assembly complex, YaeT protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 792

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 231/774 (29%), Positives = 393/774 (50%), Gaps = 36/774 (4%)

Query: 35  FGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYF 94
           FG  AV  +  ++   I +RG   +  E ++S + +  G+S S AD+D ++K ++A G F
Sbjct: 28  FGPLAVSTAEAAVASAIVVRGNARIEDETVISYLTISRGRSYSAADVDESLKALFATGLF 87

Query: 95  SNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVH 154
            +V+I      L++ + E  +I+ + F GN  + D+ LK +VR+   +      V  DV 
Sbjct: 88  EDVRITTQGGTLVVTVTENPVISRISFEGNKRVSDETLKGVVRTTERSMLTRSKVETDVQ 147

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
           NI +AY   G     V  +        +++ + I EG K  +  I F+GN N+S  RL  
Sbjct: 148 NILEAYRRTGRYRASVDPKIIDRGNNRVDLVFEINEGDKTGVERITFIGNNNFSDRRLRE 207

Query: 215 VISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYV 272
           VI  R SG  S+ +T D Y  +R++ D+E +R FY+  GYA  + V+     D++++ + 
Sbjct: 208 VIRTRQSGLLSWLRTTDTYDPDRLNADQELLRQFYYQHGYADFRIVAVSADLDREQNVFY 267

Query: 273 LIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFS 332
           + F +DEGE Y +G++ +Q++L  +  + L   +R +SG+ YN + ++++ E ++     
Sbjct: 268 VTFTLDEGEKYKIGDVEVQTSLSTVDPEALRRYLRTKSGDTYNSKRVEQTLEDLTLQVSE 327

Query: 333 GERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEG 392
               F  V+ R  RD+  R + + Y I++G   YV+RI + GND++ + VIRRE +L+EG
Sbjct: 328 EGYAFAEVRPRALRDYENRTISLVYNIEEGPRAYVERINVRGNDRTREYVIRREFDLAEG 387

Query: 393 DPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV 452
           D  N  ++++A+RR+   G+F EV ++        D VI+ V+V++   G +     Y  
Sbjct: 388 DAFNRVLLDKAERRLRNLGFFKEVRVTT-ERGSAPDRVIINVTVEEQPTGEISFGVGYST 446

Query: 453 DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTH 512
             G+  +  + + NF G+G   ++ AG G    Q+Y F   +P+F+G  I+   ++ +  
Sbjct: 447 TDGIIGDVSLSEKNFLGRGQYVKIGAGGGTD-TQSYEFVFREPFFMGRRIALDLEVYRRV 505

Query: 513 LEDG---SLDINDESAAVRMIVPITE-SISTSFKYDLRFLQYGAISEKEKIPSIYTTLIE 568
            +     S D       +   +P+ E  ++    Y++   +   IS+ + I     T   
Sbjct: 506 YDANDYRSYDEETTGGGIGFTLPLREDELALKVFYNIYETK---ISDPKGIAKNLATC-- 560

Query: 569 HGKFSSHSISQS------------IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRI 616
            G   S+++  S            + YNTLDN I P +G+      ++AG GGD+Q+ R 
Sbjct: 561 PGSGLSNAVCDSLGSSLTSLAGYALFYNTLDNNIDPSEGIFAKFQQEFAGLGGDAQFIRT 620

Query: 617 GSRASYFYLLSDDSDIVGS--LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGP 674
            + A  +  +  D  +VGS  LR G+   I S K L++ DQF    +  +RGF  +GIGP
Sbjct: 621 TAEARAYREVLPDMGLVGSVALRGGHIQAIGS-KRLRVSDQFMFGGD-LVRGFENQGIGP 678

Query: 675 R---VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAL----GA 727
           R      + A+GG+ Y + S   +FP P++PE  GL GA F D+ +L+     L    GA
Sbjct: 679 RDMSTTNRDALGGRFYVAGSVETTFPFPVIPEEFGLSGALFADAGSLWDADKDLVNIVGA 738

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           + +  N    R S G  I W SP G + V +  P+   + DK Q F    G + 
Sbjct: 739 NNVASNGFELRASVGAGIRWRSPFGPLRVDFAWPVMKEDSDKTQWFRLSGGTKF 792


>gi|118590003|ref|ZP_01547407.1| putative outer membrane protein [Stappia aggregata IAM 12614]
 gi|118437500|gb|EAV44137.1| putative outer membrane protein [Stappia aggregata IAM 12614]
          Length = 781

 Score =  365 bits (936), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 245/787 (31%), Positives = 411/787 (52%), Gaps = 39/787 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           F +G  +L  A   +S V  +  ++ R I++RG T V  E ++S + +V G+S S  D+D
Sbjct: 6   FSIG-TVLPKAFGPVSLVSQAQAAVARSIDVRGNTRVEDETVVSYMTIVPGRSYSAFDVD 64

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA 142
            ++K +YA G F+ V I    SV+++ + E  IIN + F GN  +KD  L+  VRS+  +
Sbjct: 65  ESLKALYATGLFATVDITPRGSVVVVTVTENPIINRVSFEGNRKIKDSALETAVRSQPRS 124

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
                 V ADV NI +AY   G     V+ Q        +++ + I EG K  +  I F+
Sbjct: 125 MLSRAKVQADVQNILEAYRRSGRYGASVEPQIIDRGQNRVDLVFEINEGAKTGVERISFI 184

Query: 203 GNKNYSHARLERVISIRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSS 260
           GN  +S  RL  VI  R SG  S+ + TD Y  +R++ DEE +R +Y+ +GYA  + VS+
Sbjct: 185 GNSAFSDGRLRDVIRTRESGLLSWLRSTDTYDPDRLAADEELLRQYYNKKGYADFRIVST 244

Query: 261 QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIK 320
               D++++ + + F ++EGE Y +G++ I ST+ ++  + L  LIR +SG  +N   ++
Sbjct: 245 SADLDREQNIFYVTFTVEEGEKYEIGDVEIVSTIPDVDPEDLRRLIRTKSGQTFNSLRVE 304

Query: 321 ESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYD 380
           +S E I+         F RV+ R  RD+    + + Y I++G   Y++RI + GND++ +
Sbjct: 305 QSVEDITLRVSEEGYAFARVRPRGARDYDNNTISLIYYIEEGPRAYIERINVIGNDRTRE 364

Query: 381 SVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLS 440
            VIRRE +++EGD  N +++++A+RR+   G+F +V+I+    +   D V++ V V++  
Sbjct: 365 YVIRREFDIAEGDAFNRALVDKAERRLRNLGFFEKVSITTQQGS-APDRVVVNVRVEEKP 423

Query: 441 AGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGS 500
            G +     Y    G+  +  + + NF G+G   +LA G G    Q+Y F   +P+F+G 
Sbjct: 424 TGEISFGVGYSTVDGVIGDISLTEKNFLGRGQFVKLAVGGGTD-TQSYEFRFVEPFFMGR 482

Query: 501 PISAGFDLQKTHLEDG----SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
            ++   DL +  ++D     S D           +P+ E   T     +R   Y    E+
Sbjct: 483 RVALDLDLYR-KVDDANDYRSFDQEKTGGGFGFTLPLREDELT-----VRLF-YNIFQEQ 535

Query: 557 EKIPSIYTTLIEHGKFSSHSIS---------QSII-----YNTLDNPIVPRKGMLISSSY 602
              P   +T I +   +S S++          S++     YNTLD  + P  G+  S   
Sbjct: 536 NSDPDNNSTNINNCDTASLSLAVCDSLGTYLTSLVGYELRYNTLDRVMDPTDGIYASFGQ 595

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSN 661
           ++AG GGDS Y +  ++A  +  +  D  +VGSL    G ++   ++ L++ +QF +   
Sbjct: 596 EFAGLGGDSFYIKTEAQARAYKEILADYGLVGSLSVRGGNIMALGDERLRVSEQFMLGGT 655

Query: 662 YYLRGFAYKGIGPR-VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY- 719
             +RGF  +GIGPR    + AIGG+ Y +A+A   FP P++P+  GL GA F D+ +L+ 
Sbjct: 656 -LVRGFENQGIGPRDAATEDAIGGRFYFAATAETRFPFPVIPKEFGLSGAVFADAGSLWD 714

Query: 720 --ANHVALGAD---KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
             ++ V+L  D   +++ ND   R S G  I WNSP G +   +  P+   + DK Q F 
Sbjct: 715 ADSSLVSLVEDNGGQIDSNDFNVRASIGAGIRWNSPFGPLRADFAYPIVKDDSDKTQIFR 774

Query: 775 FRIGNRM 781
              G R 
Sbjct: 775 LSGGTRF 781


>gi|307942150|ref|ZP_07657501.1| outer membrane protein assembly complex, YaeT protein [Roseibium
           sp. TrichSKD4]
 gi|307774436|gb|EFO33646.1| outer membrane protein assembly complex, YaeT protein [Roseibium
           sp. TrichSKD4]
          Length = 792

 Score =  359 bits (922), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 230/766 (30%), Positives = 384/766 (50%), Gaps = 36/766 (4%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++ R I +RG T + +E +LS +    G+S S AD+D ++K ++A G F+ V IK  
Sbjct: 36  AEAAVARNIVVRGNTRIEEETVLSYLTFSRGRSYSAADVDESLKALFATGLFATVDIKQQ 95

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              +++++ E  IIN + F GN  L D  L+  VRS+         V +DV NI + Y  
Sbjct: 96  GGTVVVEVTENPIINQVSFEGNKKLNDSSLETAVRSQPRTMLTRARVESDVQNILEGYRR 155

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G  +  V+ +        +++ + I EG K  +  I F+GNK++S  RL  VI  R SG
Sbjct: 156 SGRYDASVEPKIIDRGNNRVDLVFEINEGDKTGVERISFIGNKSFSDGRLRDVIRTRESG 215

Query: 223 YFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
           + S+ + TD Y  +R++ D+E +R +Y+ +GYA  + VS+    D++++ + + F ++EG
Sbjct: 216 FLSWLRSTDTYDPDRLAADQELLRQYYNRKGYADFRIVSATADLDREQNIFYVTFTVEEG 275

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           E Y  G++ I S++ ++    L S +R + G  ++   +++S E ++         F ++
Sbjct: 276 ERYEFGDVEIVSSVPDVDANELYSTLRTKPGKRFDSLRVEQSIEDLTLRVSEKGYAFAQI 335

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
           + R  RD+    + + Y I++G   YV+RI + GND++ + VIRRE +L+EGD  N  +I
Sbjct: 336 RPRALRDYENNTISLIYYIEEGPRAYVERINVIGNDRTREYVIRREFDLAEGDAFNRVLI 395

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
           ++A+RR+   G+F  VNI+    +  SD VI+ V V + + G V     Y    G+  + 
Sbjct: 396 DKAERRLRNLGFFERVNITTSQGS-ASDRVIVNVEVMEKATGEVSFGLGYSTTDGVIGDI 454

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDG---S 517
            + + NF G+G   +L  G G  + Q Y F+  +P+F+G  I+   D  +   +     S
Sbjct: 455 SVSERNFLGRGQYVKLGVGRGESS-QTYEFAFAEPFFMGRRIAFDVDAYRRVRDSNDYRS 513

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
            D           +P+ E       +      Y    EK   P+  +T + +   +  S+
Sbjct: 514 FDQETTGGGFGFTLPLREEELRLRLF------YKIFQEKNTDPNNTSTGVTNCNTADLSL 567

Query: 578 SQS--------------IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
           +                 IYNTL+  + P  G   +   ++AG GGDS Y +  + A  +
Sbjct: 568 AVCDSLGEYITSLAGYRFIYNTLNRNLNPTDGFYAAFGQEFAGIGGDSTYIKSTAEARAY 627

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY-A 681
             L  D  IVGS +   G +    +  L++ +QF V  N  +RGF  +GIGPR  K   A
Sbjct: 628 TELLPDWGIVGSAKIEGGHIYGIGDDRLRVSEQFMVGGN-IIRGFENQGIGPRDSKTGDA 686

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH------VALGADKLEGNDS 735
           +GG++Y + S   +FP P++PE  GL GA F D+ TL+         V  G +K+  ND 
Sbjct: 687 LGGRMYIAGSLETTFPFPVIPEEFGLSGAVFADAGTLWDADDDLVKIVENGGNKVNSNDF 746

Query: 736 FWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             R S G  I W SP G + V +  P+   + D+ Q F    G R 
Sbjct: 747 DIRASVGAGIRWQSPFGPLRVDFAWPVMKNDKDETQVFRLSGGTRF 792


>gi|260761938|ref|ZP_05874281.1| surface antigen [Brucella abortus bv. 2 str. 86/8/59]
 gi|260672370|gb|EEX59191.1| surface antigen [Brucella abortus bv. 2 str. 86/8/59]
          Length = 626

 Score =  357 bits (915), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 204/573 (35%), Positives = 326/573 (56%), Gaps = 11/573 (1%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 48  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 107

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 108 LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 167

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 168 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 227

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 228 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 287

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 288 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 347

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 348 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 407

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P +D  D VIL V V + S G   I   Y
Sbjct: 408 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSD-PDQVILVVDVVEKSTGEFSIGGGY 466

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 467 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 526

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 527 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 586

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGM 596
               E+  +   S+S S+ Y+++D+   P  G+
Sbjct: 587 EAA-ENSPWLRSSVSYSLTYSSIDDIKNPHDGL 618


>gi|300023421|ref|YP_003756032.1| outer membrane protein assembly complex, YaeT protein
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525242|gb|ADJ23711.1| outer membrane protein assembly complex, YaeT protein
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 795

 Score =  357 bits (915), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 242/802 (30%), Positives = 389/802 (48%), Gaps = 45/802 (5%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           L  +   +F    I +  A +G  A +     ++R IE+ G+  V  E + S +   VG 
Sbjct: 4   LRLFLALAFISPVIAMGDATWGSGAAFAQG--VIRNIEVVGSRRVEPETVRSYLQFNVGD 61

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
             S A +D ++K ++A G F++V I+   S +++ + E  IIN + F GN+ +    L  
Sbjct: 62  GYSAAKVDASIKALFATGLFADVSIQPKGSTIVVSVKENPIINQVAFEGNSEVDTATLSG 121

Query: 135 IVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
            V+ ++ + +      ADV  I   Y   G     V+ +   +  + +N+ + I EG   
Sbjct: 122 EVQLKARSVFTRAKAQADVQRILDVYRRQGLFAASVEPKLIQLEESRVNLVFEITEGGAT 181

Query: 195 KINSIRFVGNKNYSHARLERVISIRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGY 253
           K+  I FVGN  +S ++L  VIS    G+F F K T +Y  +RM+ D E IR +Y   GY
Sbjct: 182 KVKGINFVGNHAFSDSQLRDVISTTQVGWFDFLKGTSIYDPDRMNLDRELIRQYYLKNGY 241

Query: 254 AAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGN 312
           A   V++     D   +G+++ F +DEG +Y  G I+I+S+L +++     S +   SG 
Sbjct: 242 ADASVTAANAEIDPDGTGFLITFAVDEGPLYNFGAINIESSLPDVRPDDYRSQLLTNSGE 301

Query: 313 LYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEI 372
           +Y+  EI ++SEK++         F RV+ R   D A   + I Y+ID+G  +Y++RI +
Sbjct: 302 VYDASEIDKTSEKLTLAVADAGYAFARVRPRATPDVANHTISISYIIDEGPRIYIERINV 361

Query: 373 EGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVIL 432
            GN ++ D VIRRE  L+EGD  N  M++RAK+R+ A G F +V+I + P +   D V+L
Sbjct: 362 IGNTRTKDFVIRREFRLAEGDAFNSLMVDRAKKRLKALGIFKDVDIKRRPGS-APDRVVL 420

Query: 433 RVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQG--YRARLAAGFGRHAVQNYTF 490
            V V++ S G +     Y  ++G+  +  I + N FG G   R  LA  F R  V     
Sbjct: 421 DVMVQEQSTGELSFGAGYSTNEGVIGDVSITERNLFGNGQYLRLGLAGSFERMQVD---L 477

Query: 491 SVEDPYFLGSPISAGFDL---QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRF 547
           S  +P FL   +SAGFDL   Q  + +    D       VR+  PI E++     Y L  
Sbjct: 478 SFTEPRFLDRNLSAGFDLFYKQLNYQDSSGFDQRKAGGQVRLGFPIAENLWMQTSYGLSR 537

Query: 548 LQYGAISEKEKI----PSIYTTLIEH-------GKFSSHSISQSIIYNTLDNPIVPRKGM 596
            +   +S    I        T L+++         + +  +  +I Y+  +N   P  G 
Sbjct: 538 DEIFDVSNNASIAIKEACGATNLLDNTTPGCRDSGYWTSLVGTTITYDKRNNAQNPTSGY 597

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP--SNKNLQLFD 654
            + +  D+AG GGD+QY R+ + A  +Y +++    VG      G  I     ++++L D
Sbjct: 598 FLQAGTDFAGLGGDAQYWRVNAEARAYYPITEKITFVGR---AIGGTIQGWGGEDVRLLD 654

Query: 655 QFSVSSNYYLRGFAYKGIGPR---VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAF 711
            F       +RGF   G GPR        A+GG+ Y + +A + FP+P VP+  GL GA 
Sbjct: 655 SF-FKGGETVRGFDRAGYGPRDLSSANHDALGGQTYWATTAEIRFPLPFVPDDLGLSGAV 713

Query: 712 FVDSATLYAN----HVALGADKLEGN--------DSFWRVSTGVEIMWNSPLGMMGVYYG 759
           F D+ +L+        AL A     N         S  R S G  +MWNSP+G + + + 
Sbjct: 714 FADAGSLFGATGGVESALNAPGCVENGKPCQLADSSSIRSSVGASLMWNSPVGPIRMDFA 773

Query: 760 IPLRHREGDKIQQFGFRIGNRM 781
             L   + D+ Q F F   +R 
Sbjct: 774 KVLTKEKYDETQFFRFGASSRF 795


>gi|254697512|ref|ZP_05159340.1| Bacterial surface antigen (D15) [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 604

 Score =  356 bits (914), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 204/573 (35%), Positives = 326/573 (56%), Gaps = 11/573 (1%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P +D  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSD-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGM 596
               E+  +   S+S S+ Y+++D+   P  G+
Sbjct: 565 EAA-ENSPWLRSSVSYSLTYSSIDDIKNPHDGL 596


>gi|158423325|ref|YP_001524617.1| putative outer membrane protein precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158330214|dbj|BAF87699.1| putative outer membrane protein precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 857

 Score =  355 bits (912), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 231/770 (30%), Positives = 387/770 (50%), Gaps = 43/770 (5%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I ++G   V  + I S   +  G+ ++ A +D  VK +YA G F++V++       ++ +
Sbjct: 92  IVVQGNRRVDADTIRSYFNLKPGEGLTSAKIDDGVKALYATGLFADVRVSQQGGRTVVTV 151

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E ++IN + F GN  +KD+QL   ++S+    + +  V AD   I   Y   G  +V V
Sbjct: 152 VENEVINKIAFEGNKKIKDEQLSGEIQSKERGPFSKALVQADTQRIVDLYRRTGRTDVKV 211

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGK-T 229
                      +++ + I EG K  +  I+FVGNK +S  +L+ VIS  T+ + SF K T
Sbjct: 212 NPVTIDRGNGRVDLVFEINEGEKTGVKDIKFVGNKAFSDWKLKDVISTTTTNWLSFLKST 271

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           DVY  +R++ D+E +R FY   GYA  + VS+    D   +GYV+   +DEG  Y  G +
Sbjct: 272 DVYDADRVNADQELLRRFYLKNGYADFRIVSASAELDPGGAGYVITIVLDEGAQYKFGKV 331

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
            + S ++++   +L + +R+  G +YN + ++++ E ++         F +V+ R +RDF
Sbjct: 332 DVVSNIRDVPASSLRNALRVSDGQIYNAELVEKTVENLTIEVSKSGYAFAQVRPRGDRDF 391

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
             + +++ +++++G  +YV+RIEI GN ++ D VIRRE ++ EGD  N  +++RA+RR+ 
Sbjct: 392 ENKRINVTFVVEEGPRVYVERIEIRGNTRTRDWVIRREFDIGEGDAYNRVLVDRAERRLK 451

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
             GYF  V I+  P +   D VIL V+V+    G   I+  Y    G      + + NF 
Sbjct: 452 NLGYFKTVKITNEPGS-APDRVILVVTVEDQPTGEFSISGGYSTADGFIGSVSLGEKNFL 510

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDE---SA 525
           G+G    ++   G+++ Q   FS  +PYFLG  ++AGFDL        S  + D      
Sbjct: 511 GRGQYVSISGSLGQYS-QGAQFSFTEPYFLGYRVAAGFDLYWKETSANSYTVYDSQTIGG 569

Query: 526 AVRMIVPITESISTSFKYDL--RFLQ-------YGAISEKEKIPSIYTTL--IEHGKFSS 574
            VR+ +PIT+ ++ + +Y+L  R L        YG     +     +  +  ++ G+  +
Sbjct: 570 GVRLGLPITDEVTLALRYNLYQRELSLPNCTTFYGTALTAQNCGVSWAIIEAVQQGQTIT 629

Query: 575 HSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVG 634
             +  ++ +N LD+ I P  G+      D+AG GGD  + R      Y+Y L  DS ++ 
Sbjct: 630 SVVGYTLSFNGLDSNINPTSGLYAELKQDFAGLGGDVNFVRTTGDVRYYYPLIYDSILLL 689

Query: 635 SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY---AIGGKIYSSAS 691
             + GY       K+LQ+ D F +  N  +RGFA  GIGPR    Y   A+GG  Y  AS
Sbjct: 690 HGQAGYVSAW-GGKDLQIMDNFFMGPN-LVRGFAPSGIGPRDLANYNQDALGGTTYWGAS 747

Query: 692 AAVSFPMPLVPERAGLRGAFFVDSATLY-------------ANHVALGADK-------LE 731
           A V FP+  +P+  G++GA F D+ ++Y             AN     ++          
Sbjct: 748 AEVQFPLSFLPKDVGMKGAVFFDAGSVYGYTGPTTFASAGTANFTVCPSNSQNKMGAICV 807

Query: 732 GNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +D+  R S G  ++W SP G +   Y   L     D +Q F F  G + 
Sbjct: 808 ADDNVIRTSVGASLIWQSPFGPLRFDYAWALTKASYDDLQAFRFSGGTKF 857


>gi|218672403|ref|ZP_03522072.1| outer membrane lipoprotein [Rhizobium etli GR56]
          Length = 485

 Score =  355 bits (911), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 193/485 (39%), Positives = 299/485 (61%), Gaps = 5/485 (1%)

Query: 64  ILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSG 123
           + S + +  G+S S+ D+D +VK +Y  GYFS+VKI +    L++++ E +++N + F+G
Sbjct: 1   VRSNLTITPGKSFSNTDIDDSVKQLYGTGYFSDVKISVSGGTLVVNVQEAQLVNQVVFNG 60

Query: 124 NNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLN 183
           N  +KDD+L  IV++ +A  Y +  + +D+  IK AYA+ G   V V  Q   +    +N
Sbjct: 61  NRKIKDDKLATIVQTHAAGPYSDTQIQSDIQAIKDAYAATGRSEVEVTTQVVPLGEGRVN 120

Query: 184 ITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEE 242
           + +VI EG + KI+SI FVGN  YS  RL  VI+ + S + SF  + DVY+++++  DEE
Sbjct: 121 LAFVINEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSNFLSFLTRKDVYNEDKLHADEE 180

Query: 243 AIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKT 301
           A+R FY++RGYA ++ VSS   FD+  + Y L F I+EG+ Y  G +++QST++ +    
Sbjct: 181 ALRQFYYNRGYADMRIVSSDASFDEATNKYTLTFNIEEGQRYDFGPVTVQSTVEGVGSDQ 240

Query: 302 LLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQ 361
           LL L+R + G++Y+ +E+++S E IS    S   PF RV  R NRD     + +EYL+DQ
Sbjct: 241 LLPLVRTKEGHVYSAKEVQKSIEAISDQVASAGYPFARVTPRGNRDLNNNTIGVEYLVDQ 300

Query: 362 GSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQL 421
           G   YV+RIEI GN ++ D VIRRE ++SEGD  N  MI +AKRR+ A GYFS VNIS  
Sbjct: 301 GERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMITKAKRRLEALGYFSSVNISTQ 360

Query: 422 PANDVSDYVILRVSVKQLSAGS-VGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           P +   D V++ V V+  S GS    A       G+ +E  I++ NF G+G   R++AG 
Sbjct: 361 PGSS-PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLEASIEEKNFLGRGQYIRISAGG 419

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL-EDGSLDINDESAAVRMIVPITESIST 539
           G+   + Y  S  +PYFLG  ++AGFD+  +    + + D  + S  +R+  PITE ++T
Sbjct: 420 GQEGSRAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNYDYEETSVVLRVTAPITEDLAT 479

Query: 540 SFKYD 544
           +F+Y+
Sbjct: 480 TFRYN 484


>gi|256159889|ref|ZP_05457611.1| Outer membrane protein assembly factor yaeT precursor [Brucella
           ceti M490/95/1]
 gi|265998285|ref|ZP_06110842.1| OMP1 [Brucella ceti M490/95/1]
 gi|262552753|gb|EEZ08743.1| OMP1 [Brucella ceti M490/95/1]
          Length = 601

 Score =  354 bits (908), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 203/573 (35%), Positives = 326/573 (56%), Gaps = 11/573 (1%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A F L++V  +  ++V RIE+RG T V  + I   I +  G++ + AD+D AVK ++AMG
Sbjct: 26  AGFSLASVSVAEAAVVSRIEVRGNTRVDAQTIRDNIDIRPGKAFTSADIDAAVKRLFAMG 85

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNAD 152
            FS+V+I    S LI+ + ER ++N++ F GN  +KD  L   V+ +  A +D  T+ AD
Sbjct: 86  LFSDVRIHQSGSTLIVQVKERSVVNNVLFQGNKKIKDPDLARAVQLKPRAPFDMATMEAD 145

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
              IK AY+ IG  +  V  +   +    +N+ Y I EG + KI +I FVGN+ +S  RL
Sbjct: 146 KEAIKAAYSHIGRSDATVNARTVDLGQGRVNVVYEINEGSRTKIANIEFVGNQAFSGRRL 205

Query: 213 ERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSG 270
             VIS + S   S+  + DVY + R+  DEE +R FY++RGYA  +V SS  + D   + 
Sbjct: 206 RDVISTKRSNPLSWLTRNDVYDEGRLQADEETLRRFYYNRGYADFRVLSSNAVLDPSTNE 265

Query: 271 YVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF 330
           Y +   +DEG  YT G++S++ST+  +  + L  L++ R+G  Y+ +EI++S   +++  
Sbjct: 266 YTITITVDEGPRYTFGDVSVESTVDGVDTQALDRLVKTRTGKPYSAKEIEDSVLSVTESV 325

Query: 331 FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELS 390
                 F +V+ R +R+F    + + Y +DQG   Y++RIEI GND++ D VIRRE +L+
Sbjct: 326 AGSGYAFAKVEPRGDRNFENHTISVVYSVDQGPRAYIQRIEIRGNDKTRDYVIRREFDLN 385

Query: 391 EGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           EGD  N  M++RAKRR+ A  +F  VNIS  P ++  D VIL V V + S G   I   Y
Sbjct: 386 EGDAFNQVMVQRAKRRLEALDFFQTVNISTAPGSE-PDQVILVVDVVEKSTGEFSIGGGY 444

Query: 451 EV---DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
                  G  VE  I + NF G+G   R++AG G+  ++NY  S  +PYFLG  +SAGFD
Sbjct: 445 TTGGESPGAQVEAAITERNFLGRGQYIRISAGAGQDDMRNYGLSFTEPYFLGYRLSAGFD 504

Query: 508 L-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL---RFLQYGAISEKEKIPSIY 563
           + ++++  +   D+      +R  +PIT++ S    Y+L   ++  +   +E    P++ 
Sbjct: 505 VFRRSYRVNDDYDVEQTGGTIRFGLPITDNFSAGIAYNLVQEKYDLFRGDAENYYAPALL 564

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGM 596
               E+  +   S+S S+ Y+++D+   P  G+
Sbjct: 565 EAA-ENSPWLRSSVSYSLTYSSIDDIKNPHDGL 596


>gi|218459404|ref|ZP_03499495.1| outer membrane lipoprotein [Rhizobium etli Kim 5]
          Length = 470

 Score =  350 bits (897), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 187/460 (40%), Positives = 288/460 (62%), Gaps = 4/460 (0%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +  ++++RI++RGA+ VG E + S + +  G+S S+ D+D +VK +Y  GYFS+VKI + 
Sbjct: 9   AEAAVIQRIDVRGASRVGAEAVRSNLTITPGKSFSNTDIDDSVKQLYGTGYFSDVKISVS 68

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
              L++++ E +++N + F+GN  +KDD+L  IV++ +A  Y +  + AD+  IK+AYA+
Sbjct: 69  GGTLVVNVQEAQLVNQVVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQADIQAIKEAYAA 128

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G   V V  Q   +    +N+ +VI EG + KI++I FVGN  YS  RL  VI+ + S 
Sbjct: 129 TGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDAINFVGNNAYSAGRLAAVINTKRSN 188

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEG 280
           + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD+  + Y L F I+EG
Sbjct: 189 FLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDASFDEATNKYTLTFNIEEG 248

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           + Y  G +++QST++ +    LL L+R + G++Y+ +E+++S E IS    S   PF RV
Sbjct: 249 QRYDFGPVTVQSTVEGVGSDQLLPLVRTKEGHVYSAKEVQKSIEAISDQVASAGYPFARV 308

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             R NRD     + +EYL+DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N  MI
Sbjct: 309 TPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMI 368

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS-VGIATNYEVDKGMGVE 459
            +AKRR+ A GYFS VNIS  P +   D V++ V V+  S GS    A       G+ +E
Sbjct: 369 TKAKRRLEALGYFSSVNISTQPGSS-PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLE 427

Query: 460 GHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
             I++ NF G+G   R++AG G+   + Y  S  +PYFLG
Sbjct: 428 ASIEEKNFLGRGQYIRISAGGGQEGSRAYGVSFTEPYFLG 467


>gi|298291815|ref|YP_003693754.1| outer membrane protein assembly complex, YaeT protein [Starkeya
           novella DSM 506]
 gi|296928326|gb|ADH89135.1| outer membrane protein assembly complex, YaeT protein [Starkeya
           novella DSM 506]
          Length = 822

 Score =  347 bits (889), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 236/798 (29%), Positives = 390/798 (48%), Gaps = 63/798 (7%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           SA+  S +SI+    + G   V  + I S      G+S++ A +D  +K +YA G FS+V
Sbjct: 34  SAMAQSASSII----VEGNRRVDADTIRSYFQTGPGESLTPAKIDEGLKALYATGLFSDV 89

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIK 157
            I      L++ + E ++IN + F GN  +KD+QL + V+S++ +   + TV AD   I 
Sbjct: 90  TISNRGGRLVVRVAENEVINRVAFEGNKKVKDEQLSVEVQSKARSPLSKTTVQADTQRII 149

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           + Y   G  +V V  +        +++ + I EG K  I+ IRFVGNK +S  +L+  I+
Sbjct: 150 EVYHRAGRYDVRVTPKTIDRGQGRVDLVFEITEGDKLGISEIRFVGNKAFSAYKLKDEIT 209

Query: 218 IRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIF 275
              S + S+ K TD+Y  +R++ D+E +R FY   GYA  ++ S     D++  G++L +
Sbjct: 210 TTESNWLSWLKNTDIYDVDRINTDQELLRRFYLKHGYADFRIISVTADLDRKSGGFILTY 269

Query: 276 QIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGER 335
             +EG  Y VG + + S ++++    L S +R+  G +YN + +++S E  +        
Sbjct: 270 TFEEGPQYRVGTVEVASGIKDVDVNRLRSALRVAPGQVYNAELVEKSVENATIEVSKSGY 329

Query: 336 PFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPI 395
            F +V+ R +R+   R + + + +++G  +Y++RI+I GN ++ D VIRRE +L+EGD  
Sbjct: 330 AFAQVRPRGDRNVEARTISLVFAVEEGPRVYIERIDIRGNTRTRDWVIRREFDLAEGDAY 389

Query: 396 NYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKG 455
           N  +++RA+RR+   GYF  V I+  P     D ++L V+V+    G   ++  Y    G
Sbjct: 390 NRVLVDRAERRLNNLGYFKTVKITNEPGT-APDRIVLVVTVEDQPTGEFSVSGGYSTADG 448

Query: 456 MGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKTHL 513
              E  + + NF G+G   RLA   G + VQ   FS  +PYFL   ++AGFDL  ++T  
Sbjct: 449 FIGEVAVSEKNFLGRGQYVRLAGQLGEN-VQGVDFSFTEPYFLDYRVAAGFDLFWKETSA 507

Query: 514 EDGS-LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKF 572
            D S  D       +R+ +P+T+ ++   +Y L   +     E     S+ T     G  
Sbjct: 508 TDYSPYDTETAGGTLRVALPLTDELTLGLRYTLSQKEITVDQECPYTWSVATCNAYWGDI 567

Query: 573 S------------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA 620
           S            + ++  ++ YN LDN   P  G L+    D AG GGD  + R    A
Sbjct: 568 SWAILEVNGVSAITSAVGYTLSYNMLDNNKDPTNGYLVELKQDLAGLGGDVNFIRSTFDA 627

Query: 621 SYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---- 675
            ++  +    D V  LR   G V     +NL++ D F    +  +RGFA  GIGPR    
Sbjct: 628 RWYMPVV--GDFVLMLRGQAGNVTSWGGENLRILDNFFKGPD-LVRGFAPNGIGPRDLAS 684

Query: 676 -----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY----------- 719
                 ++  A+GG +Y   +A V FP+  +P+  GL+ A F D+ +L+           
Sbjct: 685 GNPLLGEEPDALGGTLYWGTTAEVQFPLSFLPKDFGLKAAVFADAGSLWDYQGDTIFPNI 744

Query: 720 ---------ANHVALGADKLEG-------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                     N  A+     +G       +    R S GV ++W+SP G +   Y   L 
Sbjct: 745 AGWNDPGNLVNCSAIPGSSTKGLANVCVADSDLIRSSVGVSLIWSSPFGPLRFDYAWALT 804

Query: 764 HREGDKIQQFGFRIGNRM 781
               D++Q+F F  G R 
Sbjct: 805 KEYYDQVQEFRFSGGTRF 822


>gi|299134993|ref|ZP_07028184.1| outer membrane protein assembly complex, YaeT protein [Afipia sp.
           1NLS2]
 gi|298589970|gb|EFI50174.1| outer membrane protein assembly complex, YaeT protein [Afipia sp.
           1NLS2]
          Length = 818

 Score =  341 bits (874), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 236/791 (29%), Positives = 388/791 (49%), Gaps = 59/791 (7%)

Query: 35  FGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYF 94
           F ++A Y      V  I + G   +  + I S         + +A +D  +K +   G F
Sbjct: 31  FSVTAAYAQT---VASIGVEGNRRIEADTIRSYFKPGPSGRLDNAAVDDGLKALINTGLF 87

Query: 95  SNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVH 154
           S+V+I+     L++ + E  ++  + F GN  +KD+QL   V+S+         V +D  
Sbjct: 88  SDVRIEHRGGRLVVVVSENAVLGRVVFEGNKKIKDEQLTAEVQSKPRGTLSRAMVQSDTQ 147

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
            I + Y   G  +V V  ++       +++ +VI+EG K  + +I F+GN  +S  RL  
Sbjct: 148 RIIEIYRHAGRYDVTVTPEYIEQPNNRVDLIFVIQEGKKTGVQAINFIGNHAFSSYRLRD 207

Query: 215 VISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYV 272
           +I  R S + SF    DVY  +R+  D + IR FY   GYA V+V + +  +D    G++
Sbjct: 208 IIKTRVSNFLSFLSSGDVYDPDRVEADRDLIRRFYLKNGYADVQVVAALTEYDPSVKGFI 267

Query: 273 LIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFS 332
           + F+I+EG+ Y VG+IS  ST+      TL SL R+  G++YN + +++S E ++     
Sbjct: 268 VTFKIEEGQKYRVGSISFNSTIPSFDANTLRSLSRVSVGSVYNVEAVEKSVEDMTVDTSR 327

Query: 333 GERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEG 392
               F +VK R +R+F    V I + + +G  +Y++RI I GN ++ D V+RRE ++ EG
Sbjct: 328 RGYAFAQVKPRGDRNFENHTVSIVFDVTEGPRVYIERINIRGNTRTRDYVLRREFDIGEG 387

Query: 393 DPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV 452
           D  N ++I+RA+RR+    YF EV I+Q P +   D VI+ V V++ S G   ++  Y  
Sbjct: 388 DAYNRALIDRAERRLKNLDYFKEVKITQEPGSS-PDRVIVNVDVEEKSTGDFSVSGGYST 446

Query: 453 DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKT 511
             G   E  + + N  G+G  A+ +  +G++A + YT S  +PY LG  ++ G DL Q+ 
Sbjct: 447 ADGALAEVSVSERNLLGRGLYAKASVQYGQYA-RGYTLSFVEPYLLGYRVALGLDLYQRK 505

Query: 512 HLEDGSLDINDESAAV--RMIVPITESISTSFKYDL---------------RFLQYGAIS 554
            L +  +  N ++     R+   + E +S   +Y +                 + Y  I+
Sbjct: 506 QLANSYVSYNSDTFGFSPRLGFQLREDLSLQVRYSISQQKIELPWQFQNCNNGIPYPQIT 565

Query: 555 EKEKIPSIYT---------TLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
               I   +            +  G+  + S   ++ YNTLDN   P  G+L + + D+A
Sbjct: 566 PPNTIQDCFVDGEASVPVKAGLAFGRVLTSSAGATLTYNTLDNNKNPTSGILATWAEDFA 625

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRF-----------GYGCVIPSNKNLQLFD 654
           G GGD +Y +      ++  +   SDIVG +             G   V   N N+++ D
Sbjct: 626 GLGGDVRYVKSTGDVKFYTPVV--SDIVGFIHLQGGILNGWGGGGAANVGNPNGNVRMLD 683

Query: 655 QFSVSSNYYLRGFAYKGIGPRVDKKY-----AIGGKIYSSASAAVSFPMPLVPERAGLRG 709
            F +  N  +RGFA  GIGPR D  +     A+GG  Y  ASA +  P   +P+  GL+G
Sbjct: 684 NFQMGPN-LVRGFAPMGIGPR-DTTFGTTNDALGGTKYWGASAELQMPFWFLPKETGLKG 741

Query: 710 AFFVDSATLYANHVA---LGAD-KLEGNDSF-WRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
           A F D+ +L+        LG    L G D+   R S GV ++W SP G +   Y +P+  
Sbjct: 742 AVFADAGSLWGYEGVTQYLGQSVNLGGTDTMKVRSSVGVGLIWASPFGPLRFDYAVPINK 801

Query: 765 REGDKIQQFGF 775
             GD++Q+F F
Sbjct: 802 VTGDRVQEFRF 812


>gi|316933929|ref|YP_004108911.1| outer membrane protein assembly complex, YaeT protein
           [Rhodopseudomonas palustris DX-1]
 gi|315601643|gb|ADU44178.1| outer membrane protein assembly complex, YaeT protein
           [Rhodopseudomonas palustris DX-1]
          Length = 846

 Score =  336 bits (862), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 240/802 (29%), Positives = 387/802 (48%), Gaps = 86/802 (10%)

Query: 53  IRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIE 112
           + G   V  E I S      G  +    +D  +K +   G F +V+I      L++ ++E
Sbjct: 46  VEGNRRVEAETIRSYFKPGPGGRLDQGSIDDGLKALIETGLFQDVRINQAGGRLVVSVVE 105

Query: 113 RKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKV 172
             +I  L F GN  +KD+QL   ++S+         V  D   I + Y   G  +V V  
Sbjct: 106 NPVIGRLAFEGNKKIKDEQLSAEIQSKPRGTLSRPMVQGDALRIAEIYRRSGRYDVRVDP 165

Query: 173 QHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDV 231
           Q        +++ +VI EG K  + SI FVGNK YS  RL+ VI  R S   SF G  DV
Sbjct: 166 QIIEQPNNRVDLVFVITEGPKTGVKSIEFVGNKTYSSYRLKDVIKTRESNLLSFLGSGDV 225

Query: 232 YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNISI 290
           Y  +R+  D + IR FY   G+A V+V + +  +D ++ G+++ FQI+EG+ Y VG+++ 
Sbjct: 226 YDPDRVEADRDLIRRFYLKHGFADVQVVAALTEYDPERKGFMVTFQIEEGQQYRVGSVTF 285

Query: 291 QSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAK 350
            ST+  +   ++ S  R+  G+LYN + +++S E++          F  V+ R +R+F +
Sbjct: 286 DSTIPTLDANSMRSYSRVNVGSLYNAEALEKSVEEMQIELSRRGYAFATVRPRGDRNFDE 345

Query: 351 RIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMAT 410
             V I + I++G  +Y++RI + GN ++ D VIRRE ++SEGD  N ++++RA+RR+   
Sbjct: 346 HTVSIVFSIEEGPRVYIERINVVGNTRTRDYVIRREFDISEGDAYNRALVDRAERRLKNL 405

Query: 411 GYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQ 470
            +F  V I+  P +  SD VIL V++++ S G   ++  Y    G   E  + + NF G+
Sbjct: 406 DFFKSVKITTEPGSS-SDRVILVVNLEEKSTGDFSVSGGYSTSDGALGEVSVSERNFLGR 464

Query: 471 GYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHL---------------- 513
           G  A+ +  +G++A + Y+ S  +PY L   ++ G DL Q+  L                
Sbjct: 465 GIFAKASVQYGQYA-RGYSLSFVEPYLLDYRVALGLDLYQREQLANRYISYSTKTLGFSP 523

Query: 514 -------EDGSLDI------------------NDESAAVRMIVPITESISTSFKYDLRFL 548
                  ED SL I                  N+   A     P   + +T+   DLR  
Sbjct: 524 RLGFALREDLSLQIRYSLYRQEITLPSYLNNCNNIPGAGFFPTPQYIAGNTTPTNDLR-T 582

Query: 549 QYGAI---SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
           QYG +   S+ E    +   L   G + + S+  ++ YNTLDN   P  G+L+    D+A
Sbjct: 583 QYGVLGCYSDGEASLPVRIGL-AGGAYWTSSLGYTLTYNTLDNIKNPTDGLLVDLRQDFA 641

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYL 664
           G GGD ++ +    A Y+  L   +D++G +    G +     N L++ D F + SN  +
Sbjct: 642 GVGGDVKFIKTAFDAKYYTPLV--ADLIGLIHLQAGNLSTYGDNQLRMLDHFQMGSN-LV 698

Query: 665 RGFAYKGIGPRVDKKYAI--------GGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSA 716
           RGFA  GIGPR    YAI        GG  Y  AS  +  P   +P+  GL+GA + D+ 
Sbjct: 699 RGFAPNGIGPRDIGTYAIYGYGGDALGGTNYWGASVELQMPFWFLPKEVGLKGAIYADAG 758

Query: 717 TLY---------------------ANHVALG-ADKLEGNDS-FWRVSTGVEIMWNSPLGM 753
           +L+                     A+   +G    L  +D+   R S GV ++W SP G 
Sbjct: 759 SLFDYKGPTSWTLTGEVNTPGCTPASQTTIGTCSGLNYDDTNLVRTSVGVGLIWASPFGP 818

Query: 754 MGVYYGIPLRHREGDKIQQFGF 775
           +   Y IP+   + D++Q+F F
Sbjct: 819 LRFDYAIPITKGKYDRVQEFKF 840


>gi|39935979|ref|NP_948255.1| putative outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|192291632|ref|YP_001992237.1| outer membrane protein assembly complex, YaeT protein
           [Rhodopseudomonas palustris TIE-1]
 gi|39649833|emb|CAE28355.1| putative outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|192285381|gb|ACF01762.1| outer membrane protein assembly complex, YaeT protein
           [Rhodopseudomonas palustris TIE-1]
          Length = 841

 Score =  333 bits (853), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 229/795 (28%), Positives = 383/795 (48%), Gaps = 77/795 (9%)

Query: 53  IRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIE 112
           + G   V  E I S      G  +    +D  +K +   G F +V+I      L++ ++E
Sbjct: 46  VEGNRRVEAETIRSYFKPGPGGRLDQGSIDDGLKALIETGLFQDVRINQAGGRLVVSVVE 105

Query: 113 RKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKV 172
             +I  L F GN  +KD+QL   ++S+         V  D   I + Y   G  +V V  
Sbjct: 106 NPVIGRLAFEGNKKIKDEQLSAEIQSKPRGTLSRPMVQGDALRIAEIYRRSGRYDVRVDP 165

Query: 173 QHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDV 231
           Q        +++ +VI EG K  + SI FVGNK YS  RL+ VI  R S   SF G  DV
Sbjct: 166 QIIEQPNNRVDLVFVITEGPKTGVKSIEFVGNKAYSSYRLKDVIKTRESNLLSFLGNGDV 225

Query: 232 YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNISI 290
           Y  +R+  D + IR FY   G+A V+V + +  +D ++ G+++ F+I+EG+ Y VG+++ 
Sbjct: 226 YDPDRVEADRDLIRRFYLKHGFADVQVVAALTEYDPERKGFLVTFKIEEGQQYRVGSVTF 285

Query: 291 QSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAK 350
           +S +  +   ++ S  R+  G+LYN + +++S E++          F  V+ R +R+F +
Sbjct: 286 ESAIPTLDGNSMRSFSRVNVGSLYNAEALEKSVEEMQIELSRRGYAFATVRPRGDRNFDE 345

Query: 351 RIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMAT 410
             V I + I++G  +Y++RI + GN ++ D VIRRE ++SEGD  N ++++RA+RR+   
Sbjct: 346 HTVSIVFSIEEGPRVYIERINVVGNTRTRDYVIRREFDISEGDAYNRALVDRAERRLKNL 405

Query: 411 GYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQ 470
            +F  V I+  P +  SD VIL V++++ S G   ++  Y    G   E  + + NF G+
Sbjct: 406 DFFKTVKITTEPGSS-SDRVILVVNLEEKSTGDFSVSGGYSTSDGALGEVSVSERNFLGR 464

Query: 471 GYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDESAAV-- 527
           G  A+ +  +G++A + Y+ S  +PY L   ++ G DL Q+  L +  +  + ++     
Sbjct: 465 GIFAKASVQYGQYA-RGYSLSFVEPYLLDYRVALGLDLYQREQLANRYISYSTKTLGFSP 523

Query: 528 RMIVPITESISTSFKYDL--------------------RFLQYGAISEKEKIPSIYTTL- 566
           R+   + E +S   +Y L                     F           + + Y  L 
Sbjct: 524 RLGFALREDLSLQIRYSLYRQEITLPSYLNNCNNIPGPGFFPTPQYIAANNLQATYGVLG 583

Query: 567 --------------IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQ 612
                         +  G + + S+  ++ YNTLDN   P  G+L+    D+AG GGD +
Sbjct: 584 CYGDGEASLPVRIGLAGGAYWTSSLGYTLTYNTLDNIKNPTDGLLVDLRQDFAGVGGDVK 643

Query: 613 YHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKG 671
           + +    A Y+  L   SD+VG +    G +     N L++ D F + SN  +RGFA  G
Sbjct: 644 FIKTAFDAKYYTSLV--SDLVGLIHLQAGNLSTYGDNQLRMLDHFQMGSN-LVRGFAPNG 700

Query: 672 IGPRVDKKY--------AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY---- 719
           IGPR   +Y        A+GG  Y  AS  +  P   +P+  GL+GA + D+ +L+    
Sbjct: 701 IGPRDIGQYALYGYGGDALGGTNYWGASVELQMPFWFLPKEVGLKGAVYADAGSLFDYKG 760

Query: 720 -----------------ANHVALG-ADKLEGNDS-FWRVSTGVEIMWNSPLGMMGVYYGI 760
                            A+   +G    L  +D+   R S GV ++W SP G +   Y I
Sbjct: 761 PTSWSVTGEVNTPGCIPASQTTIGTCSGLNYDDTNLVRTSVGVGLIWASPFGPLRFDYAI 820

Query: 761 PLRHREGDKIQQFGF 775
           P+   + D++Q+F F
Sbjct: 821 PITKGKYDRVQEFKF 835


>gi|90423944|ref|YP_532314.1| surface antigen (D15) [Rhodopseudomonas palustris BisB18]
 gi|90105958|gb|ABD87995.1| surface antigen (D15) [Rhodopseudomonas palustris BisB18]
          Length = 841

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 224/798 (28%), Positives = 379/798 (47%), Gaps = 79/798 (9%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I + G   V  E I S      G  +    +D  +K +   G F +V+I      L++ +
Sbjct: 44  IAVEGNRRVEVETIRSYFKAGPGGRLDQGRIDDGLKALIETGLFQDVRINQAGGRLVVTV 103

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E  +I  + F GN  +KD+QL   ++S+         V +D   I + Y   G  +V V
Sbjct: 104 VENPVIGRVAFEGNKKVKDEQLSAELQSKPRGTLSRPMVQSDALRIAEIYRRSGRYDVRV 163

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKT 229
             +        +++ + +EEG K  + SI F+GN  +S  RL+ +I    S + SF    
Sbjct: 164 TPEIIEQPNNRVDLVFTVEEGAKTGVRSIEFIGNNAFSSYRLKDIIKTHESNFLSFLASG 223

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNI 288
           D+Y  +R+  D + IR +Y   GYA V+V + +  +D +K G+++ F+I+EG+ Y VG++
Sbjct: 224 DLYDPDRVEADRDLIRRYYLKHGYADVQVVAALTEYDPEKKGFLVTFKIEEGQQYRVGSV 283

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
             QST+  +   +  S  R+  G+LYN + +++S E++S         F  V+ R +R++
Sbjct: 284 EFQSTIPTLDANSFRSYSRVSVGSLYNAEALEKSVEEMSIEASRRGYSFATVRPRGDRNY 343

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               V I + ID+G   Y++RI++ GN ++ D VIRRE +LSEGD  N ++++RA+RR+ 
Sbjct: 344 DNHTVSIVFAIDEGPRTYIERIDVRGNTRTRDYVIRREFDLSEGDAYNRALVDRAERRLK 403

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
              +F  V +   P +  SD +IL V +++ S G   ++  Y    G   E  + + NF 
Sbjct: 404 NLDFFKSVKVVTEPGSS-SDRIILVVDLEEKSTGDFSVSGGYSTSDGALAEVSVSERNFL 462

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDESAAV 527
           G+G  A+ +  +G+++ + Y+ S+ +PY L   ++ G DL Q+  L +  +    ++   
Sbjct: 463 GRGLFAKASVSYGQYS-RGYSLSLVEPYLLDYRVALGLDLYQRQQLANSYVSYTTKTLGF 521

Query: 528 --RMIVPITESISTSFKYDL-------------------------------------RFL 548
             R+   + E +S   +Y +                                      + 
Sbjct: 522 SPRLGFGLREDLSLQVRYSIYQQEISLPDALNNCNNNFGSSYFPTPGFINAGNPNNTSYG 581

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
            YG + + E    +   L + GK  + +I  ++ YNTLDN   P  G+LI    DYAG G
Sbjct: 582 SYGCLGDGEAALPVRIEL-QDGKALTSAIGYTLTYNTLDNNKNPTDGLLIDLRQDYAGVG 640

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPS-NKNLQLFDQFSVSSNYYLRGF 667
           GD  Y +    A Y+  L   +DIVG +    G +  +  K++++ D F +  N  +RGF
Sbjct: 641 GDVSYLKSAFDAKYYTPLV--ADIVGLIHVQGGILNEAGGKDIRMLDHFQMGPN-LVRGF 697

Query: 668 AYKGIGPRVDKKY-------AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY- 719
           A  GIG R    Y       A+GG  Y  ASA +  P   +P+  G++GA + D+ +L+ 
Sbjct: 698 APNGIGARDISNYGLTGYGDALGGTKYWGASAELQMPFWFLPKEVGVKGAIYADAGSLWD 757

Query: 720 ----------------------ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
                                  N V   A     + +  R S GV ++W SP G +   
Sbjct: 758 YKGPTSWALTNQVNTATCVPATKNDVGTCAGMTYDDSNLVRTSVGVGLIWASPFGPLRFD 817

Query: 758 YGIPLRHREGDKIQQFGF 775
           Y IPL   + D++QQF F
Sbjct: 818 YAIPLTKGQFDRVQQFKF 835


>gi|209885092|ref|YP_002288949.1| outer membrane protein assembly complex [Oligotropha
           carboxidovorans OM5]
 gi|209873288|gb|ACI93084.1| outer membrane protein assembly complex [Oligotropha
           carboxidovorans OM5]
          Length = 822

 Score =  331 bits (849), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 225/774 (29%), Positives = 377/774 (48%), Gaps = 87/774 (11%)

Query: 76  ISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMI 135
           + +A +D  +K++   G FS+V++      L++ + E  +I  + F GN  +KD+QL   
Sbjct: 56  LDNAAIDDGLKSLVGTGLFSDVRVDHRGGRLVVVVTENAVIGRVAFEGNKKVKDEQLTAE 115

Query: 136 VRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAK 195
           V+S+   A    TV +D   I + Y   G  +V V  ++       +++ +VI EG K  
Sbjct: 116 VQSKPRGALSRATVQSDTQRIIEIYRHSGRYDVTVTPEYIERPNNRVDLIFVINEGKKTG 175

Query: 196 INSIRFVGNKNYSHARLERVISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYA 254
           + +IRF+GN  +S  RL  +I  R S   SF  + DVY  +R+  D + IR FY   GYA
Sbjct: 176 VEAIRFIGNNAFSSYRLRDIIKTRESNILSFLTSGDVYDPDRVEADRDLIRRFYLKNGYA 235

Query: 255 AVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
            V+V + +  +D    G+++ F+I+EG+ Y VG+I   ST+       L  L R+  G++
Sbjct: 236 DVQVIAALTEYDPSVKGFIVTFKIEEGQKYRVGSIEFSSTIPSFDANALRGLSRVSVGSV 295

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           YN + +++S E ++         F +V+ R +R+F    V I + + +G+ +Y++RI I 
Sbjct: 296 YNVEAVEKSVEDMTVDASRRGYAFAQVRPRGDRNFENHTVSIVFEVTEGARVYIERINIR 355

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE ++ EGD  N ++I+RA+RR+    YF+ V I+Q P +   D VI+ 
Sbjct: 356 GNTRTRDYVLRREFDIGEGDAYNRALIDRAERRLKNLDYFTTVKITQEPGSS-PDRVIVN 414

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V++ S G   ++  Y    G   E  + + N  G+G  A+ +  +G++A + YT S  
Sbjct: 415 VDVEEKSTGDFSVSGGYSTADGFLAEVGVSERNLLGRGLYAKASVQYGQYA-RGYTLSFV 473

Query: 494 DPYFLGSPISAGFDL-QKTHLEDGSLDINDESAAV--RMIVPITESISTSFKYDLRFLQY 550
           +PY LG  ++ G DL Q+    +  +  N ++     R+   + E +S   +Y +     
Sbjct: 474 EPYLLGYRVALGLDLYQREQRANRYISYNSKTFGFSPRLGFQLREDLSLQVRYTIS---- 529

Query: 551 GAISEKEKIPSIYTTL-------------------------------------------- 566
              S+K  +P+ YT                                              
Sbjct: 530 ---SQKITLPAWYTNCNNINPDFVNSFPTSFGVGPNPAATTPPIGYTGMASCFDDGEASV 586

Query: 567 -----IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRAS 621
                +  G   + S+  ++ YNTLDN   P  G+L +   D+AG GGD++Y +      
Sbjct: 587 PVKAGLAMGSVLTSSMGYTLTYNTLDNNKNPTSGILATLGQDFAGVGGDTRYLKTTGDVK 646

Query: 622 YFYLLSDDSDIVGSLRFGYGCV-----------IPSNKNLQLFDQFSVSSNYYLRGFAYK 670
            +  +   SDIVG +    G +              N ++++ D F +  N  +RGF   
Sbjct: 647 LYTPIV--SDIVGLIHLQGGILNGWGNGGAANAGNPNGSVRMLDNFQMGPN-LVRGFQPM 703

Query: 671 GIGPR---VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA-----NH 722
           GIGPR      + A+GG  Y  ASA +  P   +P+ AGL+GA F D+ +L+      ++
Sbjct: 704 GIGPRDMASTTQDALGGTKYWGASAELQMPFWFLPKEAGLKGAVFADAGSLWGYEGITSY 763

Query: 723 VALGADKLEGNDSF-WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
           +    D L+G D+   R S GV ++W SP G +   Y +P+    GD+IQQF F
Sbjct: 764 LGQNVD-LQGTDTMKVRTSVGVGLIWASPFGPLRFDYAVPINKVTGDRIQQFRF 816


>gi|154248351|ref|YP_001419309.1| surface antigen (D15) [Xanthobacter autotrophicus Py2]
 gi|154162436|gb|ABS69652.1| surface antigen (D15) [Xanthobacter autotrophicus Py2]
          Length = 834

 Score =  331 bits (848), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 224/777 (28%), Positives = 375/777 (48%), Gaps = 80/777 (10%)

Query: 77  SDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV 136
           + A +D A K +YA G FS+V++      +I+ + E ++IN + F GN  +KD+ L+  V
Sbjct: 66  TGAKIDEAWKALYATGLFSDVQVSQSGGRIIVRVSENEVINRVVFEGNRKIKDEVLEGEV 125

Query: 137 RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKI 196
           +S++  A  + TV +D   I + Y   G   V V           +++ + I EG K  I
Sbjct: 126 QSKARGALSKATVQSDTQRIIEVYRRSGRSGVRVNPVTIDRGNGRVDLVFEITEGDKTGI 185

Query: 197 NSIRFVGNKNYSHARLERVISIRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAA 255
             I+FVGNK +S  +L+ VIS   + + SF K TDVY  +R++ D+E +R FY   GYA 
Sbjct: 186 KDIKFVGNKAFSDWKLKDVISTTATNWLSFLKSTDVYDPDRVNSDQELLRRFYLKNGYAD 245

Query: 256 VKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLY 314
            ++  +    D    GY + F +DEGE Y  G + + S ++++  ++L   +R   G +Y
Sbjct: 246 FRIIGASAEMDPAGGGYTITFTLDEGEQYRFGKVDVVSNIRDVSGESLRRSVRATEGQVY 305

Query: 315 NPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEG 374
           N + +++S E ++         F +V+ R +RDF  + ++I +++++G  +Y++RIE+ G
Sbjct: 306 NAELVEKSVENLTIEVSKSGYAFAQVRPRGDRDFEAKRINIVFVVEEGPRVYIERIEVRG 365

Query: 375 NDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRV 434
           N ++ D V+RRE ++ EGD  N  +++RA+RR+   GYF  V I+  P +   D VIL V
Sbjct: 366 NTRTRDYVVRREFDIGEGDAYNRVLVDRAERRLRNLGYFKTVKITTEPGS-APDRVILVV 424

Query: 435 SVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVED 494
            V+    G   I+  Y    G+  E  + + NF G+G   +++   G++A Q   FS  +
Sbjct: 425 DVEDQPTGEFAISGGYSTADGVIAEVSLGEKNFLGRGQYVKVSGSMGQNA-QGAEFSFTE 483

Query: 495 PYFLGSPISAGFDL------QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
           PYFLG  ++AGFDL        ++   G+  I      +R  +PIT+ I+ + +Y+L + 
Sbjct: 484 PYFLGYRLAAGFDLYWKETSTTSYTPYGTTTI---GGGLRFGLPITDEITLALRYNL-YQ 539

Query: 549 QYGAISEKEKIPSIY------TT------LIEHGKFSSHSISQSIIYNTLDNPIVPRKGM 596
           +   +     + ++Y      TT          G   + +I  ++ +N LDN + P +G+
Sbjct: 540 REINLCNDYAVGTVYYDYCASTTSWAIRDAAAQGATITSAIGYTLSFNGLDNNLNPTQGL 599

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQF 656
                 D+AG GGD  + R      ++  L  DS ++   + GY      N  L + D F
Sbjct: 600 YAELKQDFAGIGGDVNFIRTTGDIRHYTPLWGDSVLILRTQAGY-VSSWGNDTLDVLDNF 658

Query: 657 SVSSNYYLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAVSFP 697
            +  N  +RGFA  GIGPR                    ++  A+GG  Y   SA + FP
Sbjct: 659 YMGPN-LVRGFAPSGIGPRDIAPCAASNLNSVIGYNCYNNQLNALGGTTYWGVSAEIQFP 717

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKL---EGNDSFW----------------- 737
              +P+  G++GA F D+ +L+         K+   +GN+ F+                 
Sbjct: 718 FAFLPKDIGMKGAIFADAGSLFDYGGPTNFPKVPNYDGNNIFYGTPNQVTCPANSKNTPG 777

Query: 738 -------------RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                        R S G  ++W SP G +   Y   L     D+ Q F F  G R 
Sbjct: 778 YVYNVCVYDENTVRSSVGASLIWQSPFGPLRFDYAWVLSQATYDRTQAFRFSGGTRF 834


>gi|218660162|ref|ZP_03516092.1| outer membrane lipoprotein [Rhizobium etli IE4771]
          Length = 421

 Score =  330 bits (847), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 170/411 (41%), Positives = 262/411 (63%), Gaps = 3/411 (0%)

Query: 42  GSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKI 101
            +  ++++RI++RGA+ VG E + S + +  G+S S+ D+D +VK +Y  GYFS+VKI +
Sbjct: 8   AAEAAVIQRIDVRGASRVGAEAVRSNLTITPGKSFSNTDIDDSVKQLYGTGYFSDVKISV 67

Query: 102 VDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYA 161
               L++++ E +++N + F+GN  +KDD+L  IV++ +A  Y +  + AD+  IK+AYA
Sbjct: 68  SGGTLVVNVQEAQLVNQVVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQADIQAIKEAYA 127

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTS 221
           + G   V V  Q   +    +N+ +VI EG + KI++I FVGN  YS  RL  VI+ + S
Sbjct: 128 ATGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDAINFVGNNAYSAGRLAAVINTKRS 187

Query: 222 GYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDE 279
            + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD+  + Y L F I+E
Sbjct: 188 NFLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDASFDEATNKYTLTFNIEE 247

Query: 280 GEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVR 339
           G+ Y  G +++QST++ +    LL L+R + G++Y+ +E+++S E IS    S   PF R
Sbjct: 248 GQRYDFGPVTVQSTVEGVGSDQLLPLVRTKEGHVYSAKEVQKSIEAISDQVASAGYPFAR 307

Query: 340 VKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSM 399
           V  R NRD     + +EYL+DQG   YV+RIEI GN ++ D VIRRE ++SEGD  N  M
Sbjct: 308 VTPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQM 367

Query: 400 IERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNY 450
           I +AKRR+ A GYFS VNIS  P +   D V++ V V+  S GS G+   Y
Sbjct: 368 ITKAKRRLEALGYFSSVNISTQPGSS-PDRVVVVVDVQDQSTGSFGVGAGY 417


>gi|182677292|ref|YP_001831438.1| outer membrane protein assembly complex, YaeT protein [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182633175|gb|ACB93949.1| outer membrane protein assembly complex, YaeT protein [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 855

 Score =  329 bits (844), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 252/830 (30%), Positives = 404/830 (48%), Gaps = 88/830 (10%)

Query: 17  KYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSI 76
           K+  R+     I   Y    L+AV  S  ++   + + G   V  E I S          
Sbjct: 43  KFLGRASATALIASLY----LAAVMPSAFAV--SVSVHGNKRVDTETIASYF-----TGT 91

Query: 77  SDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV 136
             A ++  VK++YA G FS+VKI      L++ + E  IIN + F GN+ +K + L+  V
Sbjct: 92  DSASVNKGVKDLYATGMFSDVKISQAGGGLVVSVTENNIINRVVFEGNSKVKTETLQGEV 151

Query: 137 RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKI 196
           +S+S  AY + TV+ADV  IK AY   G     V  +   +    +++ + I+EG K  +
Sbjct: 152 QSKSRGAYSKATVDADVERIKDAYRRAGRAGAKVTSRIVDLPNGRMDVVFTIDEGEKTGV 211

Query: 197 NSIRFVGNKNYSHARLERVISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYAA 255
             I FVGN  ++  +L  ++      + SF KT DVY  +R+  D E IR FY   GYA 
Sbjct: 212 KRIEFVGNTVFTSNKLRDLMQTTEMNFLSFFKTSDVYDPDRIGSDLELIRRFYLKNGYAD 271

Query: 256 VKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLY 314
            +V  S   FD+ + GYV+   ++EG  Y V +++I S L +I   +L   +R+  G +Y
Sbjct: 272 FRVVGSDAKFDENEGGYVITITVEEGVQYKVQSVTIDSHLPDIDTNSLQKFLRLSPGEIY 331

Query: 315 NPQEIKES----SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           N   ++++    + +IS++ F+    F +V  R +RD A R V I +++++G  +Y++RI
Sbjct: 332 NGDMVEKTVDALTREISRHGFA----FSQVHPRGDRDPASRTVSIVFVLEEGPRVYIERI 387

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            I GN ++ D VIRRE +L EGD  N +++ERA+RR+   GYF +V I+  P +   D V
Sbjct: 388 VIRGNTRTRDYVIRREFDLGEGDAYNRAIVERAERRLNNLGYFKKVKITNEPGS-APDRV 446

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTF 490
           I+ V V+  S GS+ ++  Y    G+  E  + ++NF G+G   RLA   G+++ +   F
Sbjct: 447 IIVVDVEDQSTGSLSLSGGYGTASGLIAEVSVSESNFMGRGQYVRLAVSAGQYS-RGVDF 505

Query: 491 SVEDPYFLGSPISAGFDL--QKTHLEDGSLDIN-DESAAVRMIVPITESISTSFKY---- 543
           S  +PYFLG+ I+AGFDL  +KT +   S   N       R+ +P+TE ++ S +Y    
Sbjct: 506 SFTEPYFLGNRIAAGFDLYAKKTEVSYYSYYSNFITGGTFRLGLPVTEELTFSPRYSIYN 565

Query: 544 --------------DLRFLQYGAISE-KEKIPSIYTTLIEHGKFS-----------SHSI 577
                         D     +G         PS   + + +G+ S           +   
Sbjct: 566 SDLTIPDDWNHPYDDCNRPIWGLTPGFGAGAPSYSYSCLTNGEASLALKQAAGQYLTSMF 625

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
             ++ YN+LDN   P  G+      D AG GG S++ R       ++ L++  DIVG LR
Sbjct: 626 GYTLSYNSLDNNKNPTSGIFAELRQDVAGAGGYSEFVRTTGDFRIYHELTE--DIVGFLR 683

Query: 638 FGYGCVIPSNKN---LQLFDQFSVSSNYYLRGFAYKGIGPR-----VD-KKYAIGGKIYS 688
              G ++  N     L++ D F++  +  +RGF   G+GPR     VD     +GG  Y 
Sbjct: 684 LQGGDLVSLNSKGHPLRIVDNFNLGPS-LVRGFQPMGLGPRDVSPGVDWSGNPLGGTKYW 742

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYA----NHVALGADKLEGNDSFW------- 737
            A+    FP+  +P   GLRGA F D+ +L+      + A G + +  N           
Sbjct: 743 GATLEAQFPLWGLPRDLGLRGAVFADAGSLWGYEGRTNFANGGNIIPNNAPPLYTQGNTI 802

Query: 738 ---------RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                    R S GV ++W+SP+G +   +   L     D+ + F F  G
Sbjct: 803 TVGGAGMTVRSSVGVSLIWSSPMGPIRFDFAKALTKSPFDQTRIFNFTGG 852


>gi|85716988|ref|ZP_01047951.1| Outer membrane protein [Nitrobacter sp. Nb-311A]
 gi|85696190|gb|EAQ34085.1| Outer membrane protein [Nitrobacter sp. Nb-311A]
          Length = 838

 Score =  328 bits (840), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 234/800 (29%), Positives = 383/800 (47%), Gaps = 82/800 (10%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I + G   V  E I S         +  A +D A+K +   G F +V+I  V + L++ +
Sbjct: 40  ISVEGNRRVELETIRSYFKPDASGRLDQASIDGALKALIETGLFQDVRINRVGNGLVVSV 99

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           IE  +IN + F GN  +KDDQLK  ++S+    +    V +DV  I + Y   G  +V V
Sbjct: 100 IENPVINRVAFEGNKKVKDDQLKSEIQSKPRGTFSRPMVQSDVRRIVEIYRHSGRYDVRV 159

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKT 229
             +        +++ + I EG K  I SI F+GN+ +S  RL+ VI    S + SF G  
Sbjct: 160 TPEFIEQPNNRVDLIFTIVEGDKTGIASIEFIGNQAFSSYRLKDVIKTHESNFLSFLGGG 219

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNI 288
           D Y  +R+  D + +R FY   GYA V++ + +  +D  + G+++ F+IDEG+ Y VG++
Sbjct: 220 DTYDPDRVEADRDLLRRFYLKHGYADVQIIAALTEYDPGRHGFLVTFKIDEGQQYRVGSV 279

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           +I+S++      +L S  R+  G LYN + +++S E++          F  V+ R +R+F
Sbjct: 280 AIESSIPTFDGNSLRSFSRVHVGALYNAEALEKSVEEMQVEASRRGYAFAVVRPRGDRNF 339

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               V I + ID+G   Y++RI I GN ++ D VIRRE ++SEGD  N S+++RA+RR+ 
Sbjct: 340 DAHTVSIVFAIDEGPRTYIERINIRGNTRTRDYVIRREFDISEGDAYNRSLVDRAERRLK 399

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
              +F  V I+  P +  SD VIL V V+  S G   ++  +   +G   E  + + N  
Sbjct: 400 NLDFFKTVKITTEPGSS-SDRVILDVEVEDKSTGDFSVSGGFSTTQGALAEVSVSERNLL 458

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDESAAV 527
           G+G  A+ +  +G+ A + Y+ S  +P+ L   ++ G DL Q+  L +  +  N ++   
Sbjct: 459 GRGLYAKASVQYGQWA-RGYSLSFVEPFLLDYRVALGLDLYQREQLSNQWISYNMKTLGF 517

Query: 528 --RMIVPITESISTSFKYDLRFLQ------------------------------------ 549
             R+   + E ++   +Y + F Q                                    
Sbjct: 518 SPRLGFGLREDLTLQLRYSI-FQQEIGLPSAMRNCNNNFGSPNYNPSPAFMNANGIWDGS 576

Query: 550 -YGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
             G  S+ E    I   L E G+  +  +  ++ YNTLDN   P  G+LI    D+AG G
Sbjct: 577 SLGCYSDGEASLPIRREL-ERGRTLTSMLGYTLTYNTLDNNKNPTGGLLIDFRQDFAGVG 635

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCV-----IPSNKNLQLFDQFSVSSNYY 663
           GD +Y +    A Y+  L   SDIVG +    G +           +++ D F +  N  
Sbjct: 636 GDVKYLKTALDAKYYQPLV--SDIVGLIHLQGGILNNVGAYAGQNGIRMLDNFQMGPN-L 692

Query: 664 LRGFAYKGIGPR----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           +RGFA  GIGPR    +  + A+GG  Y  AS  +  P   +P+  GL+GA + D+ +L+
Sbjct: 693 VRGFAPYGIGPRDINFLSTRDALGGTKYWGASVELQMPFWFMPKEVGLKGAVYADAGSLW 752

Query: 720 A----NHVALGAD-------------------KLEGNDS-FWRVSTGVEIMWNSPLGMMG 755
                   AL  +                    L+ +D+   R S GV ++W SP G + 
Sbjct: 753 GYQGPTSYALTNEFNMPGCVPSTSSTSPGTCAGLQLDDTNVVRSSVGVGLIWQSPFGPLR 812

Query: 756 VYYGIPLRHREGDKIQQFGF 775
             Y +P+     D++Q+F F
Sbjct: 813 FDYAVPITKGRYDRVQEFRF 832


>gi|148255862|ref|YP_001240447.1| surface antigen domain-containing protein [Bradyrhizobium sp.
           BTAi1]
 gi|146408035|gb|ABQ36541.1| putative exported protein of unknown function with surface antigen
           domain [Bradyrhizobium sp. BTAi1]
          Length = 852

 Score =  327 bits (839), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 235/813 (28%), Positives = 380/813 (46%), Gaps = 91/813 (11%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V  IE+ G   V  E I S      G ++    +D  +K +   G FS+VKI      L+
Sbjct: 40  VNAIEVVGNRRVEVETIRSYFKPGPGGTLDAGRVDDGLKALIETGLFSDVKINRQGGRLV 99

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + ++E  +I  + F GN  +KD+QL+  V+S+         V +D   I + Y   G  +
Sbjct: 100 VTVVENPVIGRVAFEGNKKVKDEQLQAEVQSKPRGTLSRPMVQSDAQRIAEIYRRSGRYD 159

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
           V V  +        +++ + +EEG K  + SI FVGN  +S  RL+ VI    +   SF 
Sbjct: 160 VRVTPEMIEQPNNRVDLIFTVEEGAKTGVKSIEFVGNNAFSSYRLKDVIKTHETNLLSFL 219

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
           G  DVY  +R+  D + IR FY   GYA V+V + +  +D ++ G+++ F+I+EG+ Y V
Sbjct: 220 GSGDVYDPDRVEADRDLIRRFYLKNGYADVQVVAALTEYDPERKGFLVTFKIEEGQQYRV 279

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G++  QST+  +   +L +  R+  G+LYN + +++S E++          F  V+ R +
Sbjct: 280 GSVDFQSTIPTLDPNSLRTFSRVNVGSLYNVESLEKSVEEMQIEASRRGYAFAVVRPRGD 339

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           R+F    V + + ID+G   Y++RI I GN ++ D VIRRE ++SEGD  N ++++RA+R
Sbjct: 340 RNFEAHTVSVVFAIDEGPRTYIERINIRGNTRTRDYVIRREFDISEGDAYNRALVDRAER 399

Query: 406 RIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDN 465
           R+    +F +V I+  P +  SD VIL V++++ S G   I+  Y    G   E  I + 
Sbjct: 400 RLKNLDFFKDVKITTEPGSS-SDRVILVVNLEEKSTGDFSISGGYSTTDGALAEVSISER 458

Query: 466 NFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDES 524
           NF G+G  A+ +  +G+ A + Y+ S  +PY L   ++ G DL Q+  L +  +    ++
Sbjct: 459 NFLGRGLFAKASVTYGQFA-RGYSLSFVEPYLLDYRVALGLDLYQRQQLANNFISYGTKT 517

Query: 525 A--AVRMIVPITESISTSFKYDL-------------------------RFLQY------- 550
              + R+   + E +S   +Y +                         RF+ +       
Sbjct: 518 LGFSPRLGFQLREDLSLQLRYSIYRQEITLPATLSDCNNLTAGTLIGNRFVPFNPTPAFI 577

Query: 551 --------------GAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGM 596
                         G  +  E    +   L +    +S ++  ++ YNTLDN   P  G+
Sbjct: 578 NANGGVDPTGNNGLGCFANGEASLPVRQELAKGATLTS-ALGYTLNYNTLDNNKNPTDGL 636

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQ 655
           LI    D+AG GGD  Y +    A YF  L   SDIV  +    G +    N  L++ D 
Sbjct: 637 LIDFKQDFAGVGGDVSYLKTAFDAKYFTPLV--SDIVSIVHLQGGILNKIGNTQLRMLDH 694

Query: 656 FSVSSNYYLRGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAF 711
           F +  N  +RGFA  GIGPR    +    A+GG  Y  AS  +  P   +P+  GL+GA 
Sbjct: 695 FQMGPN-LVRGFAPNGIGPRDINPFGTQDALGGTKYWGASLELQMPFWFLPKEVGLKGAV 753

Query: 712 FVDSATLYA-------------------------NHVALGADKLEG----NDSFWRVSTG 742
           + D+  L+                            V   A    G    + +  R S G
Sbjct: 754 YADAGGLWGYQGPTSWAQTGEVNVAGCRAPTRATGTVPANAGTCLGLQFDDQNKVRSSVG 813

Query: 743 VEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
           V ++W SP G +   Y IPL   + D+ Q+F F
Sbjct: 814 VGLVWASPFGPLRFDYAIPLTKGQFDRTQEFRF 846


>gi|288958459|ref|YP_003448800.1| outer membrane protein [Azospirillum sp. B510]
 gi|288910767|dbj|BAI72256.1| outer membrane protein [Azospirillum sp. B510]
          Length = 777

 Score =  327 bits (838), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 220/745 (29%), Positives = 366/745 (49%), Gaps = 28/745 (3%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           VR I + G   +    + S + V  G       +D ++K ++  G F++V +K     L+
Sbjct: 50  VRDIRVEGTQRIEPSTVRSYLTVQPGDPFDPDRIDQSLKALFNTGLFADVVLKREGETLV 109

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + + E  IIN + F GN  +  D L   ++ R    Y    V +DV  I++ Y   G   
Sbjct: 110 VTVAENPIINRIAFEGNRRIDKDTLDKEIQLRPRVVYTRTRVQSDVQRIQEIYRRQGRFG 169

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
             V+ +   +    +++ + I EGV+  +  I F+GN+++S   L   +  + S ++ F 
Sbjct: 170 ATVEPKIIQLDQNRVDLVFEINEGVRTGVRGITFIGNEHFSDGTLRENVQTKESAWWRFL 229

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
              D Y  +R+++D + +R FY   GYA  +V S V      KS + + F I+EGE Y  
Sbjct: 230 SSDDNYDPDRLNYDRDLLRRFYLREGYADFRVVSAVAELTPDKSDFFITFTIEEGERYKF 289

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G + I++TL+++    L + +    G+ YN Q+++++  K++      +  FV V+ RI+
Sbjct: 290 GKVDIKTTLKQLDPTVLQNSVITTEGDWYNAQKVEDTITKLTNAVGDLQYAFVDVRPRIS 349

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           R+     +DI Y I++G   +V RI+I GN ++ D VIRRE+ LSEGDP N S ++R+++
Sbjct: 350 RNRETHTIDITYEINEGPRTFVDRIDISGNVRTLDKVIRREMLLSEGDPFNSSKLKRSEQ 409

Query: 406 RIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDN 465
           RI   G+F  VN++   ++   D  ++ V V + S G + I   +    G   +  I + 
Sbjct: 410 RIKDLGFFERVNVTTAESS-APDRTVVNVDVAEQSTGEISIGAGFSTSDGPLGDFSIRER 468

Query: 466 NFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKT---HLEDGSLDIND 522
           N  G+G   RL A       Q Y  S  +PYF+   +SAG D+ +T   +  + S +  +
Sbjct: 469 NLLGRGQDLRLGATLSSKR-QLYDISFTEPYFMDRDLSAGVDIFRTRYNYQNESSFNEKN 527

Query: 523 ESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI--EHGKFSSHSISQS 580
              A+R+  P+TE +     Y    LQ   I   E++PS  +  I  + G+  +  I Q 
Sbjct: 528 TGFALRLGYPLTEQLRQRVYYQ---LQDTLI---EEVPSNASRYIREQRGERLTSLIGQE 581

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV---GSLR 637
           + Y+  ++ + P +G  I  + D AG GG  ++ R      Y+  L +D  ++   G + 
Sbjct: 582 LTYDVRNSKLTPTEGYFIRLTNDVAGLGGSVRFLRNKLAGGYYIPLGEDQWVLSTTGEIG 641

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSASAAVSF 696
           + YG      K + L D+F +  +  LRGF   GIGPR +    A+GG  Y+ AS  +SF
Sbjct: 642 YIYGM----GKKVDLGDRFFIGGD-TLRGFKTAGIGPRDISTGDALGGTRYARASVEMSF 696

Query: 697 PMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGV 756
           P  L PE  GL G  F D  TL    +   +D    +D   RVS G  + W SP G + +
Sbjct: 697 PFGL-PEEFGLLGHAFTDVGTLGKVDI---SDPNVKDDESIRVSVGTGVSWKSPFGPIRL 752

Query: 757 YYGIPLRHREGDKIQQFGFRIGNRM 781
              +P+R    DK +   F  G R 
Sbjct: 753 DVALPIRKEGYDKKELIRFSFGTRF 777


>gi|146341061|ref|YP_001206109.1| hypothetical protein BRADO4132 [Bradyrhizobium sp. ORS278]
 gi|146193867|emb|CAL77884.1| conserved hypothetical protein; putative signal peptide; putative
           Surface antigen domains [Bradyrhizobium sp. ORS278]
          Length = 853

 Score =  327 bits (837), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 236/814 (28%), Positives = 381/814 (46%), Gaps = 92/814 (11%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V  IE+ G   V  E I S      G ++    +D  +K +   G FS+VKI      LI
Sbjct: 40  VNSIEVVGNRRVELETIRSYFKPGPGGTLDAGRIDDGLKALIETGLFSDVKINRQGGRLI 99

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + ++E  +I  + F GN  +KD+QL+  V+S+      +  V +D   I + Y   G  +
Sbjct: 100 VSVVENPVIGRVAFEGNKKVKDEQLQAEVQSKPRGTLSKPMVQSDAQRIAEIYRRSGRYD 159

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
           V V  +        +++ + I+EG K  + SI FVGN  +S  RL+ VI  R +   SF 
Sbjct: 160 VRVTPEMIEQPNNRVDLIFTIQEGPKTGVKSIEFVGNNAFSSYRLKDVIKTRETNLLSFL 219

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
           G  DVY  +R+  D + IR FY   GYA V+V + +  +D ++ G+++ F+I+EG+ Y V
Sbjct: 220 GSGDVYDPDRVEADRDLIRRFYLKNGYADVQVVAALSEYDPERKGFMVTFKIEEGQQYRV 279

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G++  QS++  +    L +  R+  G+LYN + I++S E++          F  V+ R +
Sbjct: 280 GSVDFQSSIATLDPNALRNYSRVSVGSLYNVENIEKSVEEMQIEASRRGYAFAVVRPRGD 339

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           R+F    V + + +D+G   Y++RI I GN ++ D VIRRE ++SEGD  N ++++RA+R
Sbjct: 340 RNFEAHTVSVVFAVDEGPRTYIERINIRGNTRTRDYVIRREFDISEGDAYNRALVDRAER 399

Query: 406 RIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDN 465
           R+    +F +V IS  P +  SD VIL V++++ S G   I+  Y    G   E  I + 
Sbjct: 400 RLKNLDFFKDVKISTEPGSS-SDRVILVVNLEEKSTGDFSISGGYSTTDGALAEVSISER 458

Query: 466 NFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDES 524
           NF G+G  A+ +  +G+ A + Y+ S  +PY L   ++ G DL Q+  L +  +    ++
Sbjct: 459 NFLGRGLFAKASVTYGQFA-RGYSLSFVEPYLLDYRVALGLDLYQRQQLANNFISYGTKT 517

Query: 525 AAV--RMIVPITESISTSFKYDL-------------------------RFLQY------- 550
                R+   + E +S   +Y +                         RF+ +       
Sbjct: 518 LGFSPRLGFQLREDLSLQLRYSIYRQEITLPTTLSDCNNIAAGSMVGNRFVPFSPTPAFI 577

Query: 551 ---------------GAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKG 595
                          G  +  E    +   L      +S ++  ++ YNTLDN   P  G
Sbjct: 578 NGNLGGVDPTGNNGLGCFANGEASLPVRQELANGATLTS-ALGYTLNYNTLDNNKNPTDG 636

Query: 596 MLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFD 654
           +L+    D+AG GGD  Y +    A YF  L   SDIV  +    G +    N  L++ D
Sbjct: 637 LLVDFKQDFAGVGGDVSYLKTAFDAKYFTPLV--SDIVSIVHLQGGILNKIGNTQLRMLD 694

Query: 655 QFSVSSNYYLRGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGA 710
            F +  N  +RGFA  GIGPR    +    A+GG  Y  AS  +  P   +P+  GL+GA
Sbjct: 695 HFQMGPN-LVRGFAPNGIGPRDINPFGTQDALGGTKYWGASLELQMPFWFLPKETGLKGA 753

Query: 711 FFVDSATLYA-----NHVALGADKLEG------------------------NDSFWRVST 741
            + D+  L+      +  A G   + G                        + +  R S 
Sbjct: 754 VYADAGGLWGYQGPTSWAATGEVNVAGCRAPTRATATVPANAGTCLGLQFDDQNKVRSSV 813

Query: 742 GVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
           GV ++W SP G +   Y IPL   + D+ Q+F F
Sbjct: 814 GVGLVWASPFGPLRFDYAIPLTKGQFDRTQEFRF 847


>gi|170738978|ref|YP_001767633.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium sp. 4-46]
 gi|168193252|gb|ACA15199.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium sp. 4-46]
          Length = 829

 Score =  327 bits (837), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 226/779 (29%), Positives = 376/779 (48%), Gaps = 84/779 (10%)

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSA 141
           + A +N+ A G FS+V++       ++ + E   IN + F GN  ++   L+ IV ++S 
Sbjct: 56  EEARRNLIASGMFSDVRVSQSGGRTVVTVRENNTINRVVFEGNKKVEKSTLESIVEAKSR 115

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
           A ++   V +DV  I++ Y   G     V  +   +   ++++ Y I+EG K  I  I F
Sbjct: 116 AGFNPAVVQSDVERIREVYRRSGRGLAKVSYRTVDLPNGSIDVIYTIDEGDKTGIREIHF 175

Query: 202 VGNKNYSHARLERVISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN+ YS  RL+ +++       SF KT DVY  +R++ D + +R +Y   GYA  +V S
Sbjct: 176 VGNQAYSEGRLKDLMTSTEMNLLSFVKTSDVYDPDRIANDLDLVRRYYLKNGYADFRVVS 235

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +   FD+   G+++   ++EG  Y VG ++I S L  +   TL   IR   G++YN +++
Sbjct: 236 ADARFDEGAGGWIITVTVEEGRQYRVGAVAIDSRLGGVDGATLRDEIRTEVGDVYNAEDV 295

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
           + +   ++        PF +V+    RD A   V + ++++ G  +YV+RI + GN ++ 
Sbjct: 296 ERTLTGVTTEVARRGYPFAQVRPTGERDRASGTVALGFVVEDGPRVYVERINVRGNTRTR 355

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RREL+  EGD  N  +++RA+RR+   G+F +V  S  P +   D V++ + V+  
Sbjct: 356 DYVVRRELDFGEGDAYNRVLVDRAERRLNGLGFFKKVRFSNEPGSS-PDRVVVNIDVEDQ 414

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
             GS  +A  Y    G+  E  + ++NF G+G   RL    G++  +   FS  +PYFLG
Sbjct: 415 PTGSFSVAGGYSTADGVIGEVSVSESNFLGRGQYVRLGVSAGQY-TRGIDFSFTEPYFLG 473

Query: 500 SPISAGFDL--QKTHLEDGSLDINDESAA-VRMIVPITESISTSFKY------------- 543
             ++AGFD+  + + L   S  + D +   +R+ +PITE    + +Y             
Sbjct: 474 YRLAAGFDVFSKYSDLTRYSRYVTDVTGGQLRLGLPITEEFGITLRYSLYNTTLKIPNTL 533

Query: 544 -----DLRFLQYGAISEKEKIPSIYTTLIEHGKFS---SHSISQSII--------YNTLD 587
                D  F   G  +      ++Y      G+ S     S+  ++         Y+TLD
Sbjct: 534 KRPYNDCSFPLAGYTAVNALGQALYPNCAYDGEASIALKESVGDTLTSLAGVTLAYSTLD 593

Query: 588 NPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSN 647
           N  +PR G       ++AG GGDS++ R+   A Y+  L +  D+VG ++   G ++P+ 
Sbjct: 594 NLQLPRNGFYGELKPEFAGLGGDSKFFRVTGEARYYKELWE--DVVGFVKIQGGHIMPTE 651

Query: 648 KN-LQLFDQFSVSSNYYLRGFAYKGIGPR-----VDKKYAIGGKIYSSASAAVSFPMPLV 701
            N L++ DQF +  +  +RGFA  GIGPR       +  A+GG  Y   +  V FP+  +
Sbjct: 652 GNTLRITDQFFLGPS-LVRGFAPNGIGPRDIGSTDSRSNALGGTTYIGGTVEVQFPIWGI 710

Query: 702 PERAGLRGAFFVDSATLYA--------------------------NHVALGADKLEGN-- 733
           P+  GL+GA F D+ TL+                           N   +G +    N  
Sbjct: 711 PKDIGLKGAIFADAGTLFGYKSKRTFDVNGDGIINGFSPVGGCNFNTFTIGVEPECVNVR 770

Query: 734 -DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG----------DKIQQFGFRIGNRM 781
             +  R S G  I+WNSPLG +   Y   L   EG          D++Q F F  G+R 
Sbjct: 771 DQATLRSSVGASILWNSPLGPIRFDYAYALTRDEGVLTAGGKVGKDQLQAFRFSGGSRF 829


>gi|86749937|ref|YP_486433.1| surface antigen (D15) [Rhodopseudomonas palustris HaA2]
 gi|86572965|gb|ABD07522.1| surface antigen (D15) [Rhodopseudomonas palustris HaA2]
          Length = 845

 Score =  326 bits (835), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 227/801 (28%), Positives = 389/801 (48%), Gaps = 82/801 (10%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKI-KIVDSVLIID 109
           I++ G   V  + I S         +    +D  +K +   G F +V+I +     L++ 
Sbjct: 45  IQVEGNRRVEADTIRSYFKPGPSGRLDQGSIDDGLKALIETGLFQDVRINQGGGGRLVVS 104

Query: 110 LIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVM 169
           ++E  +I  L F GN  +KD+QL   ++S+         + +D   I + Y   G  +V 
Sbjct: 105 VVENPVIGRLAFEGNKKIKDEQLSAEIQSKPRGTLSRPMIQSDALRIAEIYRRSGRYDVR 164

Query: 170 VKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GK 228
           V  Q        +++ +V+ EG K  + SI F+GNK +S  RL+ VI  R S   SF G 
Sbjct: 165 VDPQIIEQPNNRVDLVFVVNEGDKTGVKSIEFIGNKAFSSYRLKDVIKTRESNLLSFLGS 224

Query: 229 TDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGN 287
            DVY  +R+  D + IR FY   GYA V+V + +  +D ++ G+++ F+I+EG+ Y VG+
Sbjct: 225 GDVYDPDRVEADRDLIRRFYLKNGYADVQVVAALTEYDPERKGFLVSFKIEEGQQYRVGS 284

Query: 288 ISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRD 347
           +S +ST+      +L S  R+  G+LYN + +++S E++          F  V+ R +R+
Sbjct: 285 VSFESTIPNFDANSLSSYSRVNVGSLYNAEALEKSVEEMQIEMSRRGYAFATVRPRGDRN 344

Query: 348 FAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRI 407
           F    V I + I++G+ +Y++RI + GN ++ D VIRRE +++EGD  N ++++RA+RR+
Sbjct: 345 FESHTVSIVFSIEEGARVYIERINVVGNTRTRDYVIRREFDIAEGDAYNRALVDRAERRL 404

Query: 408 MATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNF 467
               +F  V IS  P +  SD VIL V++++ S G   ++  Y    G   E  + + NF
Sbjct: 405 KNLDFFKSVKISTEPGSS-SDRVILVVNLEEKSTGDFSVSGGYSTSNGAMGEVSVSERNF 463

Query: 468 FGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDESAA 526
            G+G  A+    +G++A + Y+ S+ +PY L   ++ G DL Q+  L +  +    ++  
Sbjct: 464 LGRGLFAKATVQYGQYA-RGYSLSLVEPYLLDYRVALGLDLYQREQLANSYISYGTKTLG 522

Query: 527 V--RMIVPITESISTSFKYDL---------------------------RFLQ-------- 549
           +  R+   + E ++   +Y L                           +F+         
Sbjct: 523 ISPRLGFALREDLTLQLRYSLYRQEITLPSYLNNCNNNLGSANYFPTPQFIAAGNPNNTG 582

Query: 550 ---YGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
               G   + E    +   L  +G + + S+  ++ YNTLDN   P  G+L+    D+AG
Sbjct: 583 YGVLGCYGDGEASLPVRIGL-SNGAYWTSSVGYTLTYNTLDNTRNPTNGLLVDFRQDFAG 641

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLR 665
            GGD ++ +    A Y+  L   SDIVG +    G +     N L++ D F +  N  +R
Sbjct: 642 VGGDVKFLKSAFDAKYYTPLV--SDIVGIVHLQAGNLSTYGGNQLRMLDHFQMGPN-LVR 698

Query: 666 GFAYKGIGPRVDKKY--------AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSAT 717
           GFA  GIGPR   +Y        A+GG  Y  AS  +  P   +P+  GL+GA + D+ +
Sbjct: 699 GFAPNGIGPRDIGQYAFYGYGGDALGGTNYWGASVELQMPFWFLPKEVGLKGAVYADAGS 758

Query: 718 LY---------------------ANHVALG-ADKLEGNDS-FWRVSTGVEIMWNSPLGMM 754
           L+                     A+  ++G    L  +D+   R S GV ++W SP G +
Sbjct: 759 LFDYKGPTSWTLTNEVNAPGCTPASQTSIGTCAGLNYDDTNLVRTSVGVGLIWASPFGPL 818

Query: 755 GVYYGIPLRHREGDKIQQFGF 775
              Y +P+   + D++Q+F F
Sbjct: 819 RFDYAVPITKGKYDRVQEFKF 839


>gi|75676042|ref|YP_318463.1| Outer membrane protein [Nitrobacter winogradskyi Nb-255]
 gi|74420912|gb|ABA05111.1| Outer membrane protein [Nitrobacter winogradskyi Nb-255]
          Length = 843

 Score =  325 bits (834), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 228/800 (28%), Positives = 382/800 (47%), Gaps = 81/800 (10%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I ++G   V  E I S         +  A +D A+K +   G F +V+I    S L++ +
Sbjct: 44  ISVQGNRRVELETIRSYFKPDASGRLDQASIDDALKALIETGLFQDVRIDRAGSGLVVSV 103

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           IE  +I  + F GN  +KDDQLK  ++S+    +    V +DV  I + Y   G  +V V
Sbjct: 104 IENPVIGRVAFEGNKKVKDDQLKTEIQSKPRGTFSRPMVQSDVQRIVEIYRRSGRYDVRV 163

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKT 229
             +        +++ + I EG K  + SI F+GN+ +S  RL+ VI    S + SF G  
Sbjct: 164 TPEFIEQPNNRVDLIFSIVEGDKTGVASIEFIGNQAFSSYRLKDVIKTHESNFLSFLGGG 223

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNI 288
           DVY  +R+  D + +R FY   GYA V++ + +  +D  + G+++ F+I+EG+ Y VG++
Sbjct: 224 DVYDPDRVEADRDLLRRFYLKNGYADVQIIAALTEYDPGRHGFLVTFKIEEGQQYRVGSV 283

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           +I+S++      +L S   +  G+LYN + +++S E++          F  V+ R +R+F
Sbjct: 284 AIESSIPTFDGNSLRSFSHVHVGSLYNAEALEKSVEEMQVEASRRGYAFAVVRPRGDRNF 343

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               V I + ID+G   Y++RI I GN ++ D VIRRE +LSEGD  N S+++RA+RR+ 
Sbjct: 344 DAHTVSIVFAIDEGPRTYIERINIRGNTRTRDYVIRREFDLSEGDAYNRSLVDRAERRLK 403

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
              +F  V I+  P +  SD VIL V V+  S G   ++  +   +G   E  + + N  
Sbjct: 404 NLDFFKTVKITTEPGSS-SDRVILDVEVEDKSTGDFSVSGGFSTTQGALAEVSVSERNLL 462

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDESAAV 527
           G+G  A+ +  +G+ + + Y+ S  +P+ L   ++ G DL Q+  L +  +  N ++   
Sbjct: 463 GRGLYAKASVQYGQWS-RGYSLSFVEPFLLDYRVALGLDLYQREQLSNQWISYNMKTLGF 521

Query: 528 --RMIVPITESISTSFKYDLRFLQYGAISEKEKI-------------PSIYTTL------ 566
             R+ + + E ++   +Y +   + G  S                  P+    +      
Sbjct: 522 SPRLGLGLREDLTLQLRYSIFQQEIGLPSALRNCNNSLTNGLPYNPSPAFMNAMGVWDGV 581

Query: 567 -----------------IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
                            +E G+  +  +  ++ YNTLDN   P  G+LI    D+AG GG
Sbjct: 582 NMGCYSDGEASLPIRQELERGRTLTSMLGYTLTYNTLDNNKNPTAGLLIDFRQDFAGIGG 641

Query: 610 DSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCV-----IPSNKNLQLFDQFSVSSNYYL 664
           D +Y +    A Y+  L   SDIVG +    G +           +++ D F +  N  +
Sbjct: 642 DVKYLKTALDAKYYQPLV--SDIVGLIHLQGGILNNVGAYAGQNGIRMLDNFQMGPN-LV 698

Query: 665 RGFAYKGIGPRVDKKY-----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           RGFA  GIGPR D  Y     A+GG  Y  AS  +  P   +P+  GL+GA + D+ +L+
Sbjct: 699 RGFAPYGIGPR-DVNYLSTMDALGGTKYWGASVELQMPFWFMPKEVGLKGAVYADAGSLW 757

Query: 720 -----------------------ANHVALGADKLEGNDS-FWRVSTGVEIMWNSPLGMMG 755
                                  +N        L+ +D+   R S GV ++W SP G + 
Sbjct: 758 GYQGPTSYALTNEFNAPGCSPSTSNANPGTCAGLQYDDTNVIRSSVGVGLIWQSPFGPLR 817

Query: 756 VYYGIPLRHREGDKIQQFGF 775
             Y +P+     D++Q+F F
Sbjct: 818 FDYAVPITKGRFDRVQEFRF 837


>gi|167646759|ref|YP_001684422.1| outer membrane protein assembly complex, YaeT protein [Caulobacter
           sp. K31]
 gi|167349189|gb|ABZ71924.1| outer membrane protein assembly complex, YaeT protein [Caulobacter
           sp. K31]
          Length = 785

 Score =  325 bits (833), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 219/757 (28%), Positives = 386/757 (50%), Gaps = 31/757 (4%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
           + +V+RI ++G   + +  +LS +P+  G+S+    LD A+K +     F++VKI++V  
Sbjct: 40  SGVVQRIVVQGNERIEQGTVLSYLPIQPGESVDPQRLDLALKTLARTDLFADVKIELVGG 99

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+ ++E  IIN + F GN+ LK+D+LK  V+ R    +    V ADV  I + Y   G
Sbjct: 100 DLIVKVVENPIINQVVFEGNSALKEDKLKDEVQIRPRGIFTRSKVQADVQRIIELYRRSG 159

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            ++  V  +   +    +++ + I EG K+ +  + F+GN  YS   L+ VI  + S ++
Sbjct: 160 RISATVTPKVVELPQKRVDLVFEINEGPKSGVLGVNFLGNTEYSDNDLKDVIVTKESHWY 219

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEI 282
            F    D Y  +R+ +D E +R FY +RGY   +V + V      K+G+ + + +DEG  
Sbjct: 220 KFLTSNDNYDPDRIEYDREQLRKFYRNRGYFDFRVVASVAELATDKNGFAVTYTLDEGPK 279

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y  G I++++ L+++    L  ++ +R+G LY  ++I+++++ ++    +    FV V+ 
Sbjct: 280 YKFGKITVETELKKLDGNLLAQILPVRTGQLYEDEKIEQATDALTFAAGAAGFAFVDVRP 339

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           R   +     VD+ + + +G  +YV RI+I GN ++ D V+RRELE++EGD  N  +++R
Sbjct: 340 RYVPNHETNTVDVVFSVREGPRVYVDRIDIVGNTRTLDYVVRRELEVAEGDAYNRVLVDR 399

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K  I A G+F +VNI ++P     D   LRV  ++   G +  +  Y     + ++  I
Sbjct: 400 SKNNIRALGFFKDVNIEEVPGAQ-PDRTALRVKTEEQPTGELSFSAGYSSVDKLVLDVGI 458

Query: 463 DDNNFFGQG--YRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKTHLED-GS 517
            + NF G+G   RAR++ G  R  +    F   +P FLG  + AG DL   +  L D  S
Sbjct: 459 TERNFRGRGQNLRARVSVGSLRQQID---FGFTEPRFLGRDLRAGLDLYSYRYDLSDYAS 515

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTL-IEHGKFSSHS 576
            D       +R+  P+T++ S   +Y LR  +           S+   L ++ G + +  
Sbjct: 516 YDTQSTGGTLRLGFPLTQNASMGLRYQLRQDKVSVADSLCTSGSVSQILCLQRGAYMTSL 575

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD--SDIVG 634
           I  ++  +  ++PI P +G     S D AGFGGD +Y +  +   +++  + D      G
Sbjct: 576 IGYNLRIDKRNDPIQPTRGWFADLSQDLAGFGGDVKYLKTDTDIGWYWGFNKDFIFSATG 635

Query: 635 SLRF--GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR--VDKKYAIGGKIYSSA 690
           S  +  G+G       N+++ D++    + + RGF   GIGPR    +  A+G K+Y+  
Sbjct: 636 SAGYIEGWG-----GDNIRINDRYYKGGSSF-RGFEIAGIGPRDTTTQTNALGAKLYAIG 689

Query: 691 SAAVSFPMPLVPERAGLRGAFFVD--SATLYANHVALGAD----KLEGNDSFWRVSTGVE 744
           +  ++ P  L+PE+ G++ A F D  +A    +   LGAD     L  +D   R S G+ 
Sbjct: 690 TFELTVPT-LLPEQYGIKAAVFTDFGTAGQLDDIDRLGADGKPNPLIKDDLGLRASAGLS 748

Query: 745 IMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           I W SP+G +   +   L     D+ + F F    R 
Sbjct: 749 IDWKSPMGPIRFDFSHILAKDSYDRTETFRFSTSTRF 785


>gi|217979934|ref|YP_002364081.1| outer membrane protein assembly complex, YaeT protein [Methylocella
           silvestris BL2]
 gi|217505310|gb|ACK52719.1| outer membrane protein assembly complex, YaeT protein [Methylocella
           silvestris BL2]
          Length = 821

 Score =  325 bits (832), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 240/773 (31%), Positives = 370/773 (47%), Gaps = 82/773 (10%)

Query: 77  SDAD-LDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMI 135
           SD D ++  VK +YA G FSNV++      ++I + E  +IN + F GN+ +K + L   
Sbjct: 57  SDQDSINKGVKALYATGLFSNVRVLHEGGRVVIAVTENNLINRVAFEGNSKVKTEILTAE 116

Query: 136 VRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAK 195
           V+S+S   Y +  V+AD+  IK  Y   G     V  +   +    L++ + I+EG K  
Sbjct: 117 VQSKSRGPYSQAIVDADIERIKDVYRRSGRAAAKVTARTVDLPNGKLDVVFTIDEGDKTG 176

Query: 196 INSIRFVGNKNYSHARLERVISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYA 254
           +  I FVGN+ +S  +L  ++      + SF KT DVY  ++++ D E IR FY   GYA
Sbjct: 177 VKQINFVGNQVFSSGKLRDLMQTTEMNFLSFFKTSDVYDPDKIASDLELIRRFYLKNGYA 236

Query: 255 AVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
             +V  S   ++  + GYV+   ++EG  YT+  + I+S L  +   TL  L+R+  G +
Sbjct: 237 DFRVIGSDAQYNPTEGGYVITITVEEGPQYTISAVDIESHLPSLDAATLRPLLRLAPGEI 296

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           YN   ++++ + ++K   +    F +V+ R +RD A   V I +++++G  +YV+RI + 
Sbjct: 297 YNGDMVEKTVDAMTKEVTTHGFAFSQVRPRGDRDPAAHTVSIVFVVEEGPKVYVERIVVR 356

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D VIRRE E+ EGD  N  +IERA+RR+   GYF +V I+        D VI+ 
Sbjct: 357 GNSRTRDYVIRREFEIGEGDAYNRVLIERAERRLNNLGYFKKVKITN-EQGSAPDRVIVI 415

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V+    GS+ ++  Y    G   E  + + NF G+G   RL+   G++A +   FS  
Sbjct: 416 VDVEDQPTGSLSVSGGYSTSDGFIAEVAVTETNFMGRGQYVRLSVSEGQYA-RGAEFSFT 474

Query: 494 DPYFLGSPISAGFDL-QKTHLEDGSLDIND--ESAAVRMIVPITESISTSFKYDLRFLQY 550
           +PYFLG+ ++AGFD+  K          N+      VR  +PIT+ I+ S +Y L F  Y
Sbjct: 475 EPYFLGNRLAAGFDVYAKQSSVSSYSYYNNFVTGGTVRFGLPITDEITFSPRYSL-FNTY 533

Query: 551 GAISEKEKIP------SIYTTL--IEHGKFSSHS------------------------IS 578
            +I      P       I+ T   + +G F S+S                          
Sbjct: 534 ISIPNNSSYPYNDCNSPIWGTTPGVYNGTFLSYSNNCLANGEASLALKQAAGNTLTSMFG 593

Query: 579 QSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRF 638
            ++ YNTLDN   P  G+      D AG GG SQ+ R      Y+  + D   +VG +  
Sbjct: 594 YTLSYNTLDNNKSPTAGIFAELRQDIAGAGGQSQFIRTTGDIRYYREIFD--QVVGIVHL 651

Query: 639 GYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKY------AIGGKIYSSA 690
             G +       L++ D F++  +  +RGFA  GIGPR V   Y      A+GG  Y  A
Sbjct: 652 QGGDIFSYGGDPLRIVDNFNLGPS-LVRGFAPNGIGPRDVSSGYYYSSGNALGGTSYVGA 710

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLY-------------------------ANHVAL 725
           S  V FP+  +P   GL+GA F D+ +L+                          N V L
Sbjct: 711 SLEVQFPIWGLPRDIGLKGALFADAGSLWNYTGQTNFSVNGVCTPNNAPPLYTQGNCVTL 770

Query: 726 GADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G     GN    R S G  ++W SPLG +   +   L     D+ Q F F  G
Sbjct: 771 G-----GNSFSIRSSVGASVIWASPLGPIRFDFAKALSKDNADQTQFFRFTGG 818


>gi|114327604|ref|YP_744761.1| outer membrane protein assembly factor yaeT [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315778|gb|ABI61838.1| outer membrane protein assembly factor yaeT [Granulibacter
           bethesdensis CGDNIH1]
          Length = 816

 Score =  324 bits (831), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 232/761 (30%), Positives = 372/761 (48%), Gaps = 34/761 (4%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           S + ++  I+I G   +    ILS + V  G       +DH++K +YA G FS+VK+   
Sbjct: 66  SRSGLIETIQIDGNHRIETGTILSYMAVQPGDPFDPERIDHSLKTLYATGLFSDVKLDRQ 125

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
            + L++ L+E  IIN + F GN+ L D+QL+ IV+ R  A +      AD   I  AYA 
Sbjct: 126 GNTLVVKLVENPIINRVAFEGNHKLTDEQLRKIVQLRQRAVFTPLQAQADRQAILAAYAG 185

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G     V+ +   +    +++ Y I EG    I+ I FVGNK +S  RL  V+  R + 
Sbjct: 186 SGRFAASVEPKIVRLPDNRVDVIYEITEGDATLISRIAFVGNKAFSEGRLREVVDSRETR 245

Query: 223 YFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEG 280
           ++ F   +D Y+ ER+++D+E +R FY   GY   KV  +     + +  + + + +DEG
Sbjct: 246 WWRFLSSSDTYNPERINYDKELLRRFYLQNGYVDFKVRDAHAELSQDRKSFFITYVLDEG 305

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           E Y VG I+++S L+ ++  TLL  I +RS + Y+   +++S + IS    +    FV+V
Sbjct: 306 ERYKVGKITVESKLRHVKGDTLLGDISLRSHHWYDGDAVEQSVQAISDDVQNRGYAFVQV 365

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
           K RI R     IVD+ + + +G  +YV+RI+I GN ++ D VIRRE  L+EGD  N + +
Sbjct: 366 KPRILRHPETHIVDLVFDVTEGPRVYVERIDISGNTRTKDKVIRREFRLAEGDAYNAANV 425

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
            R++ R+   GYF+ V+ISQ P +  +D V+L   V + S G + +   +    G  +  
Sbjct: 426 RRSRARLENLGYFNSVDISQSPGS-TADRVVLNGRVSEKSTGELTLGGGFSTTAGALLNV 484

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDI 520
            + + NF G G  A + +G    A      +V DPYFL   + AG DL  T L++    I
Sbjct: 485 GLRERNFIGSGIDAGI-SGVIAQAQSQANLNVTDPYFLDRNLVAGVDLYHTSLDNRYTGI 543

Query: 521 -----NDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKI---PSIYTTLIEHGKF 572
                    A+ RM     E +  S+ Y +       ++    I     + ++L+     
Sbjct: 544 ALYSERRTGASARMGYAFNEHLRQSWDYSITTRSVYNVATNASIFIRDQVGSSLLSQ--- 600

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLS--DDS 630
               I Q+   +  D+ + P  G ++    DYAG GG   Y R     SY+  L     +
Sbjct: 601 ----IGQTFTIDYRDSVVNPHTGFVVRFGLDYAGIGGGVNYVRGKLDGSYYIPLDYFSGN 656

Query: 631 DIVG-SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYS 688
            + G +L  G G +   + N ++ D F +     LRGF   G GP     + ++GG++  
Sbjct: 657 HLWGIALTAGAGYLYSPDDNERIIDHFFM-GGANLRGFMSGGAGPHDSVSRDSLGGRLLV 715

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVD--SATLYANH------VALGADKLEGN-DSFWRV 739
           + S  + FP+P+  +  GL G  FVD  S T  AN        ++G    E N D   RV
Sbjct: 716 TQSTELRFPLPISAD-LGLSGRAFVDIGSLTQAANKRTAAALASMGGTPGELNDDGIIRV 774

Query: 740 STGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
             GV + W +P G++ +    P+     D+ Q F F  G R
Sbjct: 775 GAGVGVSWQTPFGLINLDVAAPVSKGPYDQTQIFRFGFGTR 815


>gi|296446138|ref|ZP_06888086.1| outer membrane protein assembly complex, YaeT protein [Methylosinus
           trichosporium OB3b]
 gi|296256332|gb|EFH03411.1| outer membrane protein assembly complex, YaeT protein [Methylosinus
           trichosporium OB3b]
          Length = 829

 Score =  323 bits (829), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 236/803 (29%), Positives = 383/803 (47%), Gaps = 103/803 (12%)

Query: 70  VVVGQSISDA-------------DLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKII 116
           VVVG +  DA             D++  ++ +   G FSNV        L+I + E  +I
Sbjct: 33  VVVGNTRGDAEMIRSYFSGTSPEDVEQGLQALRNSGRFSNVSATREHGRLVIHVSESNLI 92

Query: 117 NHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHS 176
           N + F GN+ +K D L   VR+R+  ++++  ++ D+  + + Y   G     +  +   
Sbjct: 93  NRVVFEGNSKVKTDTLTSEVRTRAHGSFNKAVIDQDIARLLEIYKRSGRAGAKITYRTIE 152

Query: 177 ISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKT-DVYSKE 235
           +    +++ + +EEG K  +  I+FVGN  YS  RL  ++      + SF KT DVY  +
Sbjct: 153 LPNGRIDVVFNVEEGEKTGVKEIKFVGNNVYSTGRLVELMETTEMNFLSFLKTSDVYDPD 212

Query: 236 RMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTL 294
           R++ D E +R FY   GYA   V SS  +FD  + GY++   ++EG  Y V ++ I+S L
Sbjct: 213 RIASDLELVRRFYLKNGYADFHVVSSDAVFDPAQGGYIVNIVVEEGPEYRVSSVDIESHL 272

Query: 295 QEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVD 354
            +I  ++L   +RI +G++YN   ++++ E +++        F + + R  R+ A + V 
Sbjct: 273 PDIDPQSLRGDLRIEAGDVYNGDAVEKTVEALTREIAKKGYAFSQARPRGERNPAAQTVA 332

Query: 355 IEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFS 414
           I ++ID+G  +Y++RI I GN ++ D VIRRE E+ EGD  N  +I+RA+RR+   G+F 
Sbjct: 333 IRFVIDEGPRVYIERINIRGNTRTRDYVIRREFEIGEGDAYNRVLIDRAERRLNGLGFFK 392

Query: 415 EVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRA 474
           +V ++  P +  SD V++ V V+  + G+ G++  Y   +G   E  + ++NF G+G  A
Sbjct: 393 KVRVTNEPGSS-SDRVVINVDVEDQATGNFGVSGGYSTVQGFMGEVSVSESNFMGRGQAA 451

Query: 475 RLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL---QKTHLEDGSLDINDESAAVRMIV 531
           R +   G+ A +  +FS  +PYFL   +SAGFDL             +       +R+ V
Sbjct: 452 RASVEVGQRA-RGVSFSFTEPYFLDQRLSAGFDLFAKASNAYYYSYYNTTSVGGTLRLGV 510

Query: 532 PITESISTSFKYDLRFLQYGAISEKEKIP--------------------------SIYTT 565
           PIT+ IS S +Y + +  + +I      P                          S+Y  
Sbjct: 511 PITDEISISPRYSI-YNTHISIPNDSSRPYNDCQNPIWGYTPGFGYIYAPTPSDVSLYYN 569

Query: 566 LIEHGKFS-----------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYH 614
              +G+ S           +  I  S+ YNTLDN   P+ G+    S D AG GG S+Y 
Sbjct: 570 CQSNGEASLAIKETVGSRLTSMIGYSLSYNTLDNIRNPKNGVHAQLSQDVAGLGGVSRYV 629

Query: 615 RIGSRASYFYLLSDDSDIVGSLR------FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           R  +   YF+ L    D+VG  R      FG G     +   ++ D F++     +RGFA
Sbjct: 630 RTTADIRYFHELPFIDDVVGIARVQGGNMFGLG-----DYKFRVVDNFNLGPT-LVRGFA 683

Query: 669 YKGIGPRVDKKY------AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA-- 720
             G+GPR    +      ++GG  Y  AS  V FP+  +P+  GLRGA F D+ TL+   
Sbjct: 684 PGGLGPRDISNWTSTYGNSLGGTNYVGASLEVQFPIWGLPKDIGLRGALFADAGTLWGYD 743

Query: 721 -----NHVALGADK--------------------LEGNDSFWRVSTGVEIMWNSPLGMMG 755
                + V  G+                      + G+ +  R S G   +W SPLG + 
Sbjct: 744 GRTNFSQVLTGSYNPTCTYPYTAASNYGQGTCIIVSGDQAQIRSSVGASALWQSPLGPIR 803

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y + L    GD  Q+F F  G
Sbjct: 804 FDYAVVLSKAYGDVTQRFRFSGG 826


>gi|34497659|ref|NP_901874.1| outer membrane protein [Chromobacterium violaceum ATCC 12472]
 gi|34103515|gb|AAQ59877.1| probable outer membrane protein [Chromobacterium violaceum ATCC
           12472]
          Length = 771

 Score =  323 bits (828), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 214/755 (28%), Positives = 375/755 (49%), Gaps = 35/755 (4%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +++ I + G        + + +PV VG + +DA    A+K ++  G+F++V+++     L
Sbjct: 26  VIKDIRVEGLQRTEPGTVFNYLPVKVGDTFTDAKAKEAIKALFGTGFFNDVRVESRGDTL 85

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASI 163
           I+ + ER +I  L  +G      DQLK  ++    A    +D+  ++  V  +K+ Y S 
Sbjct: 86  IVTVAERPVITQLNINGAKEFSKDQLKKALKDNGFAESLIFDQALLDGAVQELKRQYYSR 145

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G  +V +      +    + +T  I EGV A+I  IR VG   ++ ++L    S+ T G+
Sbjct: 146 GKYSVEITPTVTKLERNRVAVTLDINEGVTARIREIRIVGANAFAQSKLLDEFSLTTGGW 205

Query: 224 FSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGE 281
            S+  K D YSK++++ D E ++AFY ++GY    + SSQV     K    L+  + EG+
Sbjct: 206 LSWITKDDQYSKQKLTGDLEKLKAFYQNQGYMEFGIDSSQVSIGADKKDMYLVINVHEGK 265

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            YTV ++ +   L+ + +  L+ L++++ G+ +N +++ ES + +S    +    F  V 
Sbjct: 266 KYTVSDVRLAGDLK-VPEAELMKLMQVKRGDTFNNEKVTESVKALSDRLGNEGYAFANVN 324

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
              + D  K+     + +D G   YV+R+ + GN ++ D VIRREL   EG P N + ++
Sbjct: 325 VLPDIDREKQTAAFTFFVDPGRKTYVRRVNVAGNSKTRDEVIRRELRQLEGAPYNAANVK 384

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
           R+K R+   GYF +VN+      D  D V + + +K+ S GS+  +  Y   +G+ +  +
Sbjct: 385 RSKERLELLGYFEDVNVETPAVADAPDQVDMNIGLKERSTGSISGSLGYVQGEGLVLGAN 444

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGS--- 517
           I  +N FG G    L    G+   +NY+ S  DPYF    +S G+DL  + +  D +   
Sbjct: 445 ISQSNIFGSGKYMSLGMSTGK-VNKNYSLSFTDPYFTPDGVSLGYDLYNRVYNPDATSIS 503

Query: 518 -LDINDESAAVRMIVPITESISTSFKYDLRFLQYGA----ISEKEKIPSIYTTLIEHGKF 572
               +   A +R  VPITE       YD      GA    I+     P  Y   ++    
Sbjct: 504 AYKTSTTGADMRFGVPITE-------YDRINFTIGAEKTDITTYSNSPQQYIDFVKQYGN 556

Query: 573 SSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDS 630
           S++++  ++ +  +T D+ + P +G  I  + D+   GG  QY+ +  + ++F+ LS D 
Sbjct: 557 SNYTVLGTVGWGRDTRDSALWPTRGASIRVNADFGLPGGSLQYYSLTHQQTWFFPLSKDF 616

Query: 631 DIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGP--RVDKKYAIGGKIYS 688
            ++ +   GY       K L  F  F +     +RG+    IGP   V   Y +GG   +
Sbjct: 617 TLMLNGELGYADGYGKTKQLPFFKNFYMGGLGSVRGYDSSSIGPYDSVANSY-LGGNRKA 675

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGV 743
            A+  + FP P + +   LR + F D+ TL+  ++   A+K +G     +D F R S G+
Sbjct: 676 VANVEILFPFPGMKDNKSLRTSLFFDAGTLWNTNLT-AAEKAQGITSSPSDGF-RYSAGL 733

Query: 744 EIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            + W SP+G M      PL+  +GDKIQ+F F++G
Sbjct: 734 ALTWLSPMGPMKFSIANPLKKEQGDKIQRFQFQLG 768


>gi|91977319|ref|YP_569978.1| surface antigen (D15) [Rhodopseudomonas palustris BisB5]
 gi|91683775|gb|ABE40077.1| surface antigen (D15) [Rhodopseudomonas palustris BisB5]
          Length = 844

 Score =  323 bits (827), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 226/801 (28%), Positives = 386/801 (48%), Gaps = 82/801 (10%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKI-KIVDSVLIID 109
           I++ G   V  + I S         +    +D  +K +   G F +V+I +     L++ 
Sbjct: 44  IQVEGNRRVEADTIRSYFKPGPSGRLDQGSIDDGLKALIETGLFQDVRINQGGGGRLVVS 103

Query: 110 LIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVM 169
           ++E  +I  L F GN  +KD+QL   ++S+         V +D   I + Y   G  +V 
Sbjct: 104 VVENPVIGRLAFEGNKKIKDEQLSAEIQSKPRGTLSRPMVQSDALRIAEIYRRSGRYDVR 163

Query: 170 VKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GK 228
           V  Q        +++ +V++EG K  + SI F+GN+ YS  RL+ VI  R S   SF G 
Sbjct: 164 VDPQIIEQPNNRIDLVFVVDEGAKTGVKSIEFIGNQAYSSYRLKDVIKTRESNLLSFLGS 223

Query: 229 TDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGN 287
            DVY  +R+  D + IR FY   GYA V+V + +  +D  + G+++ F+I+EG+ Y V +
Sbjct: 224 GDVYDPDRVEADRDLIRRFYLKNGYADVQVVAALTEYDPGRKGFLVTFKIEEGQQYRVSS 283

Query: 288 ISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRD 347
           ++  S +      +L S  R+  G+LYN + +++S E++          F  V+ R +R+
Sbjct: 284 VTFDSAIPNFDANSLRSYSRVSVGSLYNAEALEKSVEEMQIEMSRRGYAFATVRPRGDRN 343

Query: 348 FAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRI 407
           F    V I + I++G  +Y++RI + GN ++ D VIRRE +LSEGD  N ++++RA+RR+
Sbjct: 344 FESHTVSIAFSIEEGPRVYIERINLLGNTRTRDYVIRREFDLSEGDAYNRALVDRAERRL 403

Query: 408 MATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNF 467
               +F  V I+  P +  SD VIL V++++ S G   ++  Y    G   E  + + NF
Sbjct: 404 KNLDFFKSVKITTEPGSS-SDRVILVVNLEEKSTGDFSVSGGYSTSDGALGEVSVSERNF 462

Query: 468 FGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDESAA 526
            G+G  A+    +G++A + Y+ S  +PY L   ++ G DL Q+  L +  +    ++  
Sbjct: 463 LGRGLFAKATVQYGQYA-RGYSLSFVEPYLLDYRVALGLDLYQREQLANRYISYGTKTLG 521

Query: 527 V--RMIVPITESISTSFKYDL---------------------------RFLQY------- 550
           +  R+   + E +S   +Y L                           +++ +       
Sbjct: 522 ISPRLGFALREDLSLQLRYSLYRQEITLPGYLNNCNNNFGTVAYNPTPQYMNFIANNPNG 581

Query: 551 ----GAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
               G + + E    +   L  +  + + SI  ++ YNTLDN   P  G+L+    D+AG
Sbjct: 582 NPGLGCLGDGEASLPVRIGL-SNAAYWTSSIGYTLTYNTLDNTRNPTNGLLVDFRQDFAG 640

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLR 665
            GGD ++ +    A Y+  L   S++VG +R   G +     N L++ D F +  N  +R
Sbjct: 641 LGGDVKFIKSAFDAKYYTPLV--SEVVGIIRLQAGNLSSYGDNQLRMLDHFQMGPN-LVR 697

Query: 666 GFAYKGIGPRVDKKY--------AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSAT 717
           GFA  GIGPR   +Y        A+GG  Y  AS  +  P   +P+  GL+GA + D+ +
Sbjct: 698 GFAPNGIGPRDIGQYAFYGYGGDALGGTNYWGASVEMQMPFWFLPKEVGLKGAVYADAGS 757

Query: 718 LY---------------------ANHVALGADK-LEGNDS-FWRVSTGVEIMWNSPLGMM 754
           L+                     A   ++G+   L  +D+   R S GV ++W SP G +
Sbjct: 758 LFDYKGPTSWTLTNEVNGAGCSKATETSIGSCAGLNYDDTNLVRTSVGVGLIWASPFGPL 817

Query: 755 GVYYGIPLRHREGDKIQQFGF 775
              Y IP+   + D++Q+F F
Sbjct: 818 RFDYAIPITKGKYDRVQEFKF 838


>gi|220921525|ref|YP_002496826.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium nodulans ORS 2060]
 gi|219946131|gb|ACL56523.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium nodulans ORS 2060]
          Length = 857

 Score =  323 bits (827), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 222/767 (28%), Positives = 371/767 (48%), Gaps = 83/767 (10%)

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSA 141
           + A +N+ A G FS+V++       I+ + E   IN + F GN  ++   L+ IV ++S 
Sbjct: 69  EEARRNLIASGMFSDVRVSQSGGRTIVTVRENNTINRVVFEGNKKVEKSTLESIVEAKSR 128

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
           A ++   V ADV  I++ Y   G     V  +   +   ++++ Y I+EG K  I  I F
Sbjct: 129 AGFNPAVVQADVERIREVYRRSGRGLAKVTYRTVDLPNGSIDVIYTIDEGDKTGIKEIHF 188

Query: 202 VGNKNYSHARLERVISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN+ YS  RL+ +++       SF KT DVY  +R++ D + +R +Y   GYA  +V S
Sbjct: 189 VGNQAYSEGRLKDLMTSTEMNLLSFIKTSDVYDPDRIANDLDLVRRYYLKNGYADFRVVS 248

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +   FD+   G+++   ++EG  Y VG ++I S L  +   TL   +R   G++YN +++
Sbjct: 249 ADARFDEGAGGWIITITVEEGRQYRVGAVAIDSRLGGVDGATLRDEVRTEVGDIYNAEDV 308

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
           +++   ++        PF +V+    RD A   V + ++++ G  +YV+RI + GN ++ 
Sbjct: 309 EKTLTGVTTEVARRGHPFAQVRPTGERDRASGTVSLGFIVEDGPRVYVERINVRGNTRTR 368

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RREL+ +EGD  N  +++RA+RR+   G+F +V  S  P +   D V++ + V+  
Sbjct: 369 DYVVRRELDFAEGDAYNRVLVDRAERRLNGLGFFKKVRFSNEPGS-APDRVVVNIDVEDQ 427

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
             GS  +A  Y    G+  E  + ++NF G+G   RL    G++  +   FS  +PYFLG
Sbjct: 428 PTGSFSVAGGYSTADGVIGEVSVSESNFLGRGQYVRLGVSAGQY-TRGVDFSFTEPYFLG 486

Query: 500 SPISAGFDL--QKTHLEDGSLDINDESAA-VRMIVPITESISTSFKY-----DLRF---L 548
             ++AGFD+  + + L   S  + D +   +R+ +P+TE    + +Y     DL+    L
Sbjct: 487 YRLAAGFDVFSKYSDLTRYSRYVTDVTGGQLRLGLPVTEEFGVTLRYSIYNTDLKIPNTL 546

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQ----------------------------- 579
           +         IP    T       +  ++S                              
Sbjct: 547 KRPYNDCSVPIPGYTQTWPAGTVINGQNVSGLAQYPNCAFDGEASIALKSSVGSTLTSLA 606

Query: 580 --SIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLR 637
             ++ Y+TLDN  +PR G       ++AG GGDS++ RI   A Y+  L +  D++G ++
Sbjct: 607 GVTLAYSTLDNLQLPRNGFYGELKPEFAGLGGDSKFFRITGEARYYKELWE--DVIGFVK 664

Query: 638 FGYGCVIPS-NKNLQLFDQFSVSSNYYLRGFAYKGIGPR----VD-KKYAIGGKIYSSAS 691
              G ++P+   NL++ DQF +  +  +RGFA  GIGPR     D +  A+GG  Y   +
Sbjct: 665 LQGGHILPTEGNNLRITDQFFLGPS-LVRGFAPNGIGPRDIGTTDARSNALGGTTYVGGT 723

Query: 692 AAVSFPMPLVPERAGLRGAFFVDSATLYA-------------------------NHVALG 726
             V FP+  +P   GL+GA F D+ TL+                          N  ++G
Sbjct: 724 LEVQFPIWGLPRDIGLKGAVFADAGTLFGYKARRGFDVNGDAIINGFGPNGCNFNTFSIG 783

Query: 727 ADKLEGN---DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKI 770
            +    N       R S G  I+WNSPLG +   Y   L   EG K+
Sbjct: 784 VEPECVNVRDKPTLRSSIGASILWNSPLGPIRFDYAYALTRDEGQKV 830


>gi|115524568|ref|YP_781479.1| surface antigen (D15) [Rhodopseudomonas palustris BisA53]
 gi|115518515|gb|ABJ06499.1| surface antigen (D15) [Rhodopseudomonas palustris BisA53]
          Length = 847

 Score =  322 bits (826), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 230/811 (28%), Positives = 391/811 (48%), Gaps = 93/811 (11%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V  I + G   V  E I S      G  +    +D A+K++   G F +V+I      ++
Sbjct: 41  VASIVVEGNRRVEVETIRSYFRPGPGGRLDQGQIDDALKSLIQTGLFQDVQINQAGGRIV 100

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + ++E  +I  + F GN  +KD+QL   V+S++        V +D   I + Y   G  +
Sbjct: 101 VSVVENPVIGRVAFEGNKKVKDEQLTAEVQSKARGTLSRPMVQSDALRISEIYRRSGRYD 160

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
           V V  +        +++ + I+EG K  + SI F+GN  YS  RL+ VI    S + SF 
Sbjct: 161 VSVTPEIIEQPNNRVDLIFTIQEGSKTGVRSIEFIGNNAYSSYRLKDVIKTHESNFLSFL 220

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
              D+Y  +R+  D + IR FY   GYA V+V + +  +D  K G+++ F+I+EG+ Y V
Sbjct: 221 ASGDLYDPDRVEADRDLIRRFYLKNGYADVQVVAALTEYDPDKRGFLVTFKIEEGQQYRV 280

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKI----SKYFFSGERPFVRVK 341
            ++  Q+T+  ++  +L    R+  G +YN + +++S E++    S+  FS    F  V+
Sbjct: 281 SSVDFQTTIPSLEANSLRGFSRVSVGAVYNAEALEKSVEEMTIEASRRGFS----FATVR 336

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
            R +R+F    V I + ID+G+  Y++RI++ GN ++ D VIRRE ++SEGD  N ++++
Sbjct: 337 PRGDRNFDNHTVSIVFQIDEGARSYIERIDVRGNTRTRDYVIRREFDISEGDAYNRALVD 396

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
           RA+RR+    +F  V I   P +  SD V+L V +++ S G   ++  Y    G   E  
Sbjct: 397 RAERRLKNLDFFKSVKIVSEPGSS-SDRVVLIVDIEEKSTGDFSVSGGYSTSDGFLGEVS 455

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHL------- 513
           + + N  G+G  A+ +  +G+++ + Y+ S  +PY L   ++ G DL Q+  +       
Sbjct: 456 VSERNLLGRGLFAKASVTYGQYS-RGYSLSFVEPYLLDYRVALGLDLYQREQIANSYVSY 514

Query: 514 ----------------EDGSLDI-------------------NDESAAVRMIVPITESIS 538
                           ED +L +                   ND +++     P   + +
Sbjct: 515 TTKTLGFSPRLGFGLREDLTLQLRYSIYRQEISLPSSLNNCNNDTASSSYFPTPAFYAAN 574

Query: 539 TSFKY--DLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGM 596
               Y  +  + QYG I + E    +   L   GK  + +I  ++ YNTLDN   P +G+
Sbjct: 575 PGIPYTGESTYGQYGCIGDGEASLPVRREL-GSGKTLTSAIGYTLTYNTLDNNKNPTEGL 633

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQ 655
           L+    DYAG GGD  Y +    A Y+  L   +DIVG +    G +    + ++++ D 
Sbjct: 634 LLDFRQDYAGVGGDVTYLKSAFDAKYYTPLV--ADIVGLVHGQAGTLTKIGSDDIRMLDH 691

Query: 656 FSVSSNYYLRGFAYKGIGPR--------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGL 707
           F +  N  +RGFA  GIGPR         D   A+GG  Y  ASA +  P   +P+  G+
Sbjct: 692 FKMGPN-LVRGFAPNGIGPRDISYYALQGDNGDALGGTNYWGASAELQMPFWFLPKEVGI 750

Query: 708 RGAFFVDSATLY---------------------ANHVALG-ADKLEGNDS-FWRVSTGVE 744
           +GA + D+ +++                     A+  ++G    L+ +D+   R S GV 
Sbjct: 751 KGAVYADAGSVWGYKGPTSWAATGEVNAPGCTPASKTSVGTCSGLQYDDTNVVRTSVGVG 810

Query: 745 IMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
           ++W SP G +   Y +PL   + D++QQF F
Sbjct: 811 LIWASPFGPLRFDYAVPLTKGQFDRVQQFRF 841


>gi|144898240|emb|CAM75104.1| Bacterial surface antigen (D15) [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 757

 Score =  322 bits (824), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 224/771 (29%), Positives = 377/771 (48%), Gaps = 42/771 (5%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           +L   +  + A +  N   VR+I ++G   V  E + S + +  G   S   +D ++K +
Sbjct: 9   VLVAVLLAMPA-WAQNMGSVRQIVVQGNQRVEVETVKSYMAIAEGDPYSADRVDRSLKTL 67

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDT 148
           +  G F++V I+     L++ ++E  IIN + F GNN +KD+QL+   + R    Y    
Sbjct: 68  FNTGLFADVSIRQEGEALVVRVVENPIINRIAFEGNNRVKDEQLETETQLRPRVVYTRTK 127

Query: 149 VNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYS 208
           V  DV  I   Y   G     V+ +   +    +++ Y I EG  + +  I FVGN+ Y 
Sbjct: 128 VQNDVKRILDLYRRNGRFAATVEPKLIQLEQNRVDLAYEISEGEPSYVKRINFVGNRFYR 187

Query: 209 HARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDK 266
            +RL  V+S +   ++ F    D Y  +R+++D E +R +Y   G+A  +V S V     
Sbjct: 188 DSRLREVLSTKEERWYRFLSSDDTYDPDRLTYDRELLRRYYLKHGFADFRVVSGVAELTP 247

Query: 267 QKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKI 326
            + G+ L F ++EGE Y  G  +I + L+++    L  L+    G  YN  ++++  + +
Sbjct: 248 DRGGFFLTFTVEEGERYKFGTATINANLRDLDGNELNPLLTSVPGEWYNADQVEDIVQNL 307

Query: 327 SKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRE 386
           +    S    FV V+ ++NRD   ++++I Y + +G  +YV+RI+I GN ++ D VIRRE
Sbjct: 308 TDALGSKGFAFVDVRPQVNRDRENKVINITYDVHEGPRVYVERIDITGNVRTLDKVIRRE 367

Query: 387 LELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGI 446
             L EGD  N + + R+++RI   G+F +  ++ +P++   D  I++V V++ S G +  
Sbjct: 368 FRLVEGDAFNTAKVRRSRQRIKDLGFFDKAEVTNIPSDSAPDRTIIKVDVQEKSTGELSF 427

Query: 447 ATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFG-RHAVQNYTFSVEDPYFLGSPISAG 505
              +    G  VE  I + N  G+G   +L++  G R      +F+  +PYFL   +SAG
Sbjct: 428 GVGWSTVVGPLVEASIRERNLLGRGQDLKLSSSLGTRRTSAELSFT--EPYFLDRKLSAG 485

Query: 506 FD---LQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSI 562
           FD   L +    + S D N   AAVR    I +++    +Y ++  Q   + +     SI
Sbjct: 486 FDIFGLTRKMQRESSYDHNTMGAAVRSGYYIHDNLRQDVRYQVKRDQVENVDDD---ASI 542

Query: 563 YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIG-SRAS 621
           +    + G  S+ SI Q++ ++  D+ + P +G +   + + AG GG  ++ R   S A 
Sbjct: 543 FVRE-QMGSSSTSSIQQTLTWDYRDSRMEPTEGYVFKINNELAGLGGSQKWMRNNLSAAQ 601

Query: 622 YFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY-----LRGFAYKGIGPRV 676
           YF L  D+  I+G    G   VI    +    ++  ++  YY     LRGFA  G+ PR 
Sbjct: 602 YFQL--DEQVILGV--SGTAGVISGFGD----EKVRITERYYLGGDSLRGFANSGVSPR- 652

Query: 677 DKKY--AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD-----SATLYANHVALGADK 729
           DK    A+GG   ++ S  V FP+ L PE  G  G  F D     S   YAN   +    
Sbjct: 653 DKSSGDALGGLWQATGSVQVKFPLGL-PEELGFAGQAFTDFGSVGSTEDYANSATI---- 707

Query: 730 LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
                S  R S GV + W SP+G + +   +P+     D+ + F F  G R
Sbjct: 708 --NQASSLRASVGVGVTWKSPMGPVALDLAVPVMKESFDEDEFFHFNFGTR 756


>gi|92117249|ref|YP_576978.1| surface antigen (D15) [Nitrobacter hamburgensis X14]
 gi|91800143|gb|ABE62518.1| surface antigen (D15) [Nitrobacter hamburgensis X14]
          Length = 843

 Score =  322 bits (824), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 227/801 (28%), Positives = 379/801 (47%), Gaps = 83/801 (10%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I + G   V  E I S         +  A +D A+K +   G F +V+I  V   L++ +
Sbjct: 44  ISVEGNRRVELETIRSYFKPDANGRLDQASIDDALKALIGTGLFQDVRINRVGGRLVVSV 103

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E  +IN + F GN  +KD+QL   ++S+    +    V +DV  I + Y   G  +V V
Sbjct: 104 VENPVINRVAFEGNKKVKDEQLTAEIQSKPRGTFSRPMVQSDVQRIVEIYRHSGRYDVSV 163

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKT 229
             +        +++ + I EG K  + S+ F+GN  +S  RL+ VI    S + SF G  
Sbjct: 164 TPEIIEQPNNRVDLVFSISEGGKTGVKSVEFIGNHAFSSYRLKDVIKTHESNFLSFLGGG 223

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           DVY  +R+  D + +R +Y   GYA V+ V++   +D  + G+++ F+IDEG+ Y VG++
Sbjct: 224 DVYDPDRVEADRDLLRRYYLKHGYADVQIVAALTEYDPARHGFLVTFKIDEGQQYRVGSV 283

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           + +S++  +  K+L     +  G+LYN + +++S E++          F  V+ R +R+F
Sbjct: 284 TFESSIPALDGKSLSGFSHVHVGSLYNAEALEKSVEEMQVETSRRGYAFAVVRPRGDRNF 343

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               V I + ID+G   Y++RI I GN ++ D VIRRE ++SEGD  N S+++RA+RR+ 
Sbjct: 344 DAHTVSIVFAIDEGPRTYIERINIRGNTRTRDYVIRREFDISEGDAYNRSLVDRAERRLK 403

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
              +F  V I+  P +  SD VIL V V+  S G   ++  Y   +G   E  + + N  
Sbjct: 404 NLDFFKTVKITTEPGSS-SDRVILDVDVEDKSTGDFSVSGGYSTTQGALAEVSVSERNLL 462

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDG--SLDINDESA 525
           G+G  A+ +  +G++A + Y+ S  +PY L   ++ G D  Q+  L +   S +I     
Sbjct: 463 GRGLYAKASVQYGQYA-RGYSLSFVEPYLLDYRVALGLDFYQREQLANQYISYNIKTLGF 521

Query: 526 AVRMIVPITESISTSFKYDL---------------------------RFLQ--------- 549
           + R+   + E ++   +Y +                            FL          
Sbjct: 522 SPRLGFGLREDLTLQLRYSIFRQEIGLPTSLRNCNNNIGGPNYNPSPAFLNSIGQFNPNN 581

Query: 550 --YGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
              G  S+ E    I   L   G+  +  +  ++ YNTLDN   P  G+LI    D+AG 
Sbjct: 582 PTLGCYSDGEASLPIRQEL--GGQTLTSMLGYTLTYNTLDNNKNPTDGLLIDFRQDFAGV 639

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCV-----IPSNKNLQLFDQFSVSSNY 662
           GGD +Y +    A Y+  L   SDIVG +    G +           +++ D F +  N 
Sbjct: 640 GGDVKYLKTAIDAKYYQPLV--SDIVGLVHLQGGILNNVGAYAGQNGIRMLDNFQMGPN- 696

Query: 663 YLRGFAYKGIGPR----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
            +RGFA  GIGPR    +    A+GG  Y  AS  +  P   +P+  GL+GA + D+ +L
Sbjct: 697 LVRGFAPNGIGPRDINFLSTMDALGGTQYWGASVELQMPFWFLPKEVGLKGAVYADAGSL 756

Query: 719 YA-----NHVALGADKLEG-------------------NDSFWRVSTGVEIMWNSPLGMM 754
           +      +++A       G                   + +  R S GV ++W SP G +
Sbjct: 757 WGYKGPTSNLATNEFNAPGCMPSTSRSNPGTCAGLQFDDTNVVRTSVGVGLIWQSPFGPL 816

Query: 755 GVYYGIPLRHREGDKIQQFGF 775
              Y +P+   + D++Q+F F
Sbjct: 817 RFDYAVPITKGKYDRVQEFRF 837


>gi|170749839|ref|YP_001756099.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium radiotolerans JCM 2831]
 gi|170656361|gb|ACB25416.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium radiotolerans JCM 2831]
          Length = 856

 Score =  321 bits (822), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 247/826 (29%), Positives = 392/826 (47%), Gaps = 96/826 (11%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           I+L  A  GL  V  S  +  ++I ++G   V  + I S    V G +   A+   A +N
Sbjct: 17  IVLVTA--GLGVVL-SGAAQAQQIVVQGNQRVDADTIRS---YVTGTASGSAE--EARRN 68

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDED 147
           + A G FS+VK+       ++ + E  +IN + F GN  ++   L+ +V +++   Y E 
Sbjct: 69  LLASGMFSDVKVAQSGGRTVVTVRENNLINRVVFEGNKKIEKATLEGVVEAKARGPYSEA 128

Query: 148 TVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNY 207
            +NAD+  I+  Y   G     V  +   +    +++ Y I+EG K  I SI FVGN  Y
Sbjct: 129 IINADLARIRDVYKRFGRGTAKVTYRTVDLPNGRVDVIYQIDEGDKTGIISINFVGNNAY 188

Query: 208 SHARLERVISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQ--VLF 264
           S   L+ ++S     + SF KT DVY  +R++ D + +R +Y   GYA  +V S      
Sbjct: 189 SERTLKGLMSSSEMNFLSFIKTSDVYDPDRITNDLDQVRRYYLKNGYADFQVVSADARYV 248

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
           +  KSGYV+   ++EGE Y VG + + S L  +    L S I    G++YN  +++++  
Sbjct: 249 EGDKSGYVITITVNEGEQYKVGAVQVDSRLPGLDTTKLDSDIATSVGDIYNADDVEKTLN 308

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
            +++       PF +V+    RD A   V + ++++ G  +YV+RI I GN ++ D VIR
Sbjct: 309 NVTREVNRAGYPFAQVRPTGQRDPASHQVSLGFVVEDGPHVYVERINIRGNTRTRDYVIR 368

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           REL+++EGD  N  + +RA+RR+   G+F +V  S  P +   D V++ + V+    GS 
Sbjct: 369 RELDIAEGDAYNRVLTDRAERRLNGLGFFKKVRFSNEPGS-APDRVVINIDVEDQPTGSF 427

Query: 445 GIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISA 504
            +A  Y    G+  E  + ++NF G+G   RLA   G+++ +   FS  +PYFLG  ++A
Sbjct: 428 SVAGGYSTQDGIIGEVSVSESNFLGRGQYVRLAGTGGQYS-RGVDFSFTEPYFLGYRLAA 486

Query: 505 GFDL--QKTHLEDGS-LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEK--- 558
           GFD   + + L   S  +       +R+ +PITE    + +Y L   +    +  ++   
Sbjct: 487 GFDAFYKYSDLTRYSRYETTVYGGQLRLGLPITEEFGITLRYSLYNTELKVPNTLKRPYN 546

Query: 559 ---IP------------------------SIYTTLIEHGKFS-----------SHSISQS 580
              IP                        SIY      G+ S           +     +
Sbjct: 547 DCSIPIPGYTATYAAGTIDPNTGRNIGGQSIYPNCAYDGEASIAIKGSQGNTLTSLAGLT 606

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGY 640
           + Y+TLD    PR G+      D AG GGDS++ R+ + A Y+  + +  D+VG +RF  
Sbjct: 607 LAYSTLDVIGAPRNGLYAELKPDVAGLGGDSKFFRVTADARYYKEIFE--DVVGFIRFQG 664

Query: 641 GCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIGPR----VDKKY-AIGGKIYSSASAAV 694
           G +   N + L++ DQF +  +  +RGFA  GIGPR     D +  AIGG  Y   +  V
Sbjct: 665 GHISSLNNDPLRVTDQFFLGPS-LVRGFAPNGIGPRDVGIADARSNAIGGSTYIGGTLEV 723

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVAL-----------GADKLEGNDSFWRVSTGV 743
            FP+PLVP   GL+GA F D+ TL+  H              G     G  +F   + GV
Sbjct: 724 QFPLPLVPRDLGLKGALFADAGTLFGYHGQRNFNVNGDAFINGVSPTTGKCNFNAFTIGV 783

Query: 744 E-------------------IMWNSPLGMMGVYYGIPLRHREGDKI 770
           E                   I+WNSPLG +   Y   L   EG K+
Sbjct: 784 EPECVNVRDTAAIRSSIGASILWNSPLGPIRFDYAYALSKDEGQKV 829


>gi|146337393|ref|YP_001202441.1| putative outer membrane protein [Bradyrhizobium sp. ORS278]
 gi|146190199|emb|CAL74191.1| conserved hypothetical protein; putative signal peptide; putative
           outer membrane protein [Bradyrhizobium sp. ORS278]
          Length = 834

 Score =  319 bits (818), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 224/799 (28%), Positives = 376/799 (47%), Gaps = 81/799 (10%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I + G   +  + I S        ++    +D  +K +   G F++VKI      LI+ +
Sbjct: 37  ITVEGNRRIEADTIRSYFKPGPSGALDAGQVDDGLKALIETGLFADVKIDRQGGRLIVRV 96

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E  +I  + F GN  +KD+QL   V+S+         V +D   I + Y   G  +V V
Sbjct: 97  VENPVIGRVAFEGNKKVKDEQLSAEVQSKPRGTLSRPMVQSDAQRIAEIYRRSGRYDVRV 156

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKT 229
             +        +++ + + EGVK  + S+ FVGNK +S  RL  +I  R + + SF    
Sbjct: 157 TPEIIEQPNNRVDLVFTVVEGVKTSVKSVDFVGNKAFSATRLRDIIKTRATNWLSFLASN 216

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNI 288
           D+Y  +R+  D + IR FY   GYA V+V + +  +D ++ G+++ FQI+EG+ Y VG++
Sbjct: 217 DIYDPDRVEADRDLIRRFYLKNGYADVQVVAALTEYDPEQKGFLVTFQIEEGQQYRVGSV 276

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
             QST+  +   TL    R+  G LYN +++++S E++          F  V+ R +R+ 
Sbjct: 277 QFQSTIAALDGNTLRGYSRVNVGALYNVEQLEKSVEEMQIEASRRGFAFAVVRPRGDRNL 336

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               V I + +D+G   Y++RI I GN ++ D VIRRE ++SEGD  N ++++RA+RR+ 
Sbjct: 337 EAHTVAIVFSVDEGPRTYIERISIRGNTRTRDYVIRREFDISEGDAYNRALVDRAERRLK 396

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
              +F +V I+  P +  SD VIL V++++ S G   I+  Y    G   E  I + NF 
Sbjct: 397 NLDFFKDVKIATEPGSS-SDRVILVVNLEEKSTGDFSISGGYSTTDGALAEVSISERNFL 455

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQ-KTHLEDGSLDINDESAAV 527
           G+G  A+ +  +G++A +  + S  +PY L   ++ G D+  +  L +        +   
Sbjct: 456 GRGLFAKASVTYGQYA-RGVSLSFVEPYLLDYRVALGLDVSYRQQLANSYTSYGTRTVGF 514

Query: 528 --RMIVPITESISTSFKYDL-----------------------------RFLQ------- 549
             R+   + E +S   +Y L                              ++Q       
Sbjct: 515 SPRLGFQLREDLSLQLRYSLYRQEITLPSYLANCNNNAANGLLAFNPTPAYIQSVLGGVD 574

Query: 550 -----------YGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLI 598
                      YG   + E   ++   L +    +S ++  ++ YNTLDN   P +G+LI
Sbjct: 575 PTNSTTSGVYGYGCYGDGESSLAVRKELNQGASLTS-ALGYTLTYNTLDNTKNPTEGLLI 633

Query: 599 SSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFS 657
               D+AG GG+  Y +    A YF LL   S+IV  +    G +    +K+L++ D + 
Sbjct: 634 DWRQDFAGVGGNVSYLKSAVDAKYFTLLV--SEIVSVIHLQGGVLEKIGDKDLRMLDHYQ 691

Query: 658 VSSNYYLRGFAYKGIGPRVDKKY--------AIGGKIYSSASAAVSFPMPLVPERAGLRG 709
           +     +RGFA  GIGPR D  Y        A+GG  Y  ASA +  P   +P+  GL+G
Sbjct: 692 MGPT-LVRGFAANGIGPR-DITYRSFGATGDALGGTKYWGASAELQMPFWFLPKEIGLKG 749

Query: 710 AFFVDSATLYA-------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGV 756
           + + D+ +L+              N  A        +    R S GV ++W SP G +  
Sbjct: 750 SVYADAGSLWGYQGPTSWAATGEVNTSACKCAMQYDDSKVVRSSVGVGLIWASPFGPLRF 809

Query: 757 YYGIPLRHREGDKIQQFGF 775
            Y +PL   + D +Q+F F
Sbjct: 810 DYAVPLTKGKYDVVQEFRF 828


>gi|148251750|ref|YP_001236335.1| hypothetical protein BBta_0131 [Bradyrhizobium sp. BTAi1]
 gi|146403923|gb|ABQ32429.1| putative outer membrane protein of unknown function with surface
           antigen (D15) domain [Bradyrhizobium sp. BTAi1]
          Length = 834

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 230/806 (28%), Positives = 374/806 (46%), Gaps = 95/806 (11%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I + G   V  + I S        ++  A +D  +K +   G F++VKI      LI+ +
Sbjct: 37  ITVEGNRRVEADTIRSYFKPGPSGALDAAQVDDGLKALVETGLFADVKIDRQGGRLIVRV 96

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E  +I  + F GN  +KD+QL+  V+S+         V +D   I + Y   G  +V V
Sbjct: 97  VENPVIGRVAFEGNKKVKDEQLQAEVQSKPRGTLSRPMVQSDAQRIAEIYRRSGRYDVRV 156

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKT 229
             +        +++ + + EGVK  + SI FVGN  YS ARL  VI    S + SF G  
Sbjct: 157 TPEIIEQPNNRVDLVFTVVEGVKTGVKSITFVGNNAYSAARLRDVIKTHESNWLSFLGNN 216

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNI 288
           DVY  +R+  D + IR FY   GYA V+V + +  +D ++ G+++ F+IDEG+ Y VG++
Sbjct: 217 DVYDPDRVEADRDLIRRFYLKNGYADVQVVAALTEYDPEQKGFLVTFKIDEGQQYRVGSV 276

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
             QST+  +    L +  R+  G LYN +++++S E++          F  V+ R +R+ 
Sbjct: 277 DFQSTIAALDANALRTYSRVNVGALYNVEQLEKSVEEMQIEASRRGFAFAVVRPRGDRNL 336

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               V I + +D+G   Y++RI I GN ++ D VIRRE ++SEGD  N ++++RA+RR+ 
Sbjct: 337 EAHTVAIVFQVDEGPRTYIERITIRGNTRTRDYVIRREFDISEGDAYNRALVDRAERRLK 396

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
              +F +V I+  P +  SD VIL V +++ S G   I+  Y    G   E  I + NF 
Sbjct: 397 NLDFFKDVKITTEPGSS-SDRVILVVGLEEKSTGDFSISGGYSTTDGALAEVSISERNFL 455

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------------------- 508
           G+G  A+ +  +G++  +    S  +PY L   ++ G D+                    
Sbjct: 456 GRGLYAKASVSYGQY-TRGVALSFVEPYLLDYRVALGLDISYRQQLANSYTSYGTRTVGF 514

Query: 509 ---------QKTHLE------------------------DGSLDINDESAAVRMIV---- 531
                    + T L+                        +G L  N   A ++ ++    
Sbjct: 515 SPRLGFQLREDTSLQLRYSLYRQEITLPSYLANCNNNSANGLLAFNPTPAYIQSVLGGVD 574

Query: 532 PITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIV 591
           P   + S  + Y       G   + E   ++   L +    +S ++  ++ YNTLDN   
Sbjct: 575 PTNSTSSGVYGY-------GCYGDGESSLAVRKELNDGAALTS-ALGYTLTYNTLDNTKN 626

Query: 592 PRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNL 650
           P  G+LI    D+AG GG+  Y +    A YF  L   SDIV  +    G +    +K+L
Sbjct: 627 PTDGLLIDWRQDFAGVGGNVSYLKSAVDAKYFTPLV--SDIVSVIHLQGGVLNKIGDKDL 684

Query: 651 QLFDQFSVSSNYYLRGFAYKGIGPRVDKKY--------AIGGKIYSSASAAVSFPMPLVP 702
           ++ D + +     +RGFA  GIGPR D  Y        A+GG  Y  ASA +  P   +P
Sbjct: 685 RMLDHYQMGPT-LVRGFASNGIGPR-DITYRSLGATGDALGGTRYWGASAELQMPFWFLP 742

Query: 703 ERAGLRGAFFVDSATLYA-------------NHVALGADKLEGNDSFWRVSTGVEIMWNS 749
           +  GL+G+ + D+ +L+              N  A        +    R S GV ++W S
Sbjct: 743 KEVGLKGSVYADAGSLWGYQGPTSWAATGEVNTAACKCAMQYDDSKVVRSSVGVGLIWAS 802

Query: 750 PLGMMGVYYGIPLRHREGDKIQQFGF 775
           P G +   Y +PL   + D +Q+F F
Sbjct: 803 PFGPLRFDYAVPLSKGKYDVVQEFRF 828


>gi|83311589|ref|YP_421853.1| Outer membrane protein/protective antigen OMA87 [Magnetospirillum
           magneticum AMB-1]
 gi|82946430|dbj|BAE51294.1| Outer membrane protein/protective antigen OMA87 [Magnetospirillum
           magneticum AMB-1]
          Length = 771

 Score =  318 bits (815), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 219/765 (28%), Positives = 372/765 (48%), Gaps = 20/765 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           F +   +L   + G+          +R I I G   +  E + S + V  G       ++
Sbjct: 19  FVLWTAVLLGILVGVMPASAQEGGRIRSISILGTQRIEVETVKSYMTVAEGDLYDTDRVN 78

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA 142
            ++K ++  G F +V I+     L++ ++E  IIN + + GNN +K++QL   V+ R   
Sbjct: 79  RSLKALFNTGLFQDVAIRREGDQLLVRVVENPIINRIAYEGNNRIKEEQLNTEVQLRPRT 138

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            Y    V ADV  I + Y   G     V+ +   +    +++ Y I EG    +  I FV
Sbjct: 139 VYTRSKVQADVKRILELYRRSGRFAATVEPKIIQLEQNRVDLVYEISEGQPTYVRRIAFV 198

Query: 203 GNKNYSHARLERVISIRTSGYFSFGKTD-VYSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           GNK Y   +L  V+  +   ++ F  TD  Y  +R+++D E +R +Y  +G+A  +VSS 
Sbjct: 199 GNKRYDQDKLREVLQTKEERWYRFLTTDDTYDPDRVTYDRELLRRYYLKQGFADFRVSSA 258

Query: 262 VL-FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIK 320
           +      + G+ + + IDEGE Y  G+  I + L++++ + L  L+   +G  YN  +++
Sbjct: 259 IAELTPSREGFFITYTIDEGERYKFGSSVINAELRDLKPEDLQPLLISETGGWYNADQVE 318

Query: 321 ESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYD 380
           +  ++++    +    FV VK ++ R+     +DI Y I +G  ++V+RI+I GN ++ D
Sbjct: 319 DIVQRLTDAVGTKGYAFVDVKPQVQRNRETHTIDITYEIKEGPRVFVERIDISGNVRTLD 378

Query: 381 SVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLS 440
            VIRRE  L EGD  N + + R+++R+    +F +  ++ +P++   D  I++V V++ S
Sbjct: 379 QVIRREFRLVEGDAFNSAKLRRSRQRLKDLNFFEKAEVTNIPSDTAPDRTIIKVDVQEKS 438

Query: 441 AGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGS 500
            G +     +    G  +E  + + N  G+G   RL AG G     +   S  +PYF+  
Sbjct: 439 TGELMFGVGWASSAGPIIEASLRERNLLGRGQDLRLGAGLGTKR-SSLDLSFTEPYFMDR 497

Query: 501 PISAGFD---LQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKE 557
            ++AGFD   + +   ++ S D +     +R    ++ES+     Y L+      IS   
Sbjct: 498 EVAAGFDAFVIDRKLQKESSYDASSIGGDLRAGYRLSESLRQDVIYTLKQDTVKGISSTS 557

Query: 558 KIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIG 617
             P +   L + G   S  I QS++Y+  D+ + P +G  I    D AG GGD +Y R  
Sbjct: 558 --PYV---LEQIGSKVSSVIGQSLMYDRRDSRLDPTEGYFIKLGTDGAGLGGDIRYLRGT 612

Query: 618 SRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD 677
                ++ L+D   +  S   GY  +   ++ +++ D+F V  +  LRGFA  G+ PR D
Sbjct: 613 LTGGQYFTLTDKVILGVSSSVGY--IYGLDQRVRITDRFFVGGD-NLRGFANGGVSPR-D 668

Query: 678 KKY--AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS 735
           K    A+GG   +  SA V FP+ L PE  G+ G  F D   +     A  A   +   S
Sbjct: 669 KNTGDALGGIWQAVGSAQVKFPLGL-PEEFGVSGQAFTDIGAVGETDTADTAAVQQ--SS 725

Query: 736 FWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
             RVS GV I W SP+G + V  G PL   + DK + F F  G +
Sbjct: 726 SVRVSPGVGISWKSPMGPVSVDLGYPLVKEKFDKKEFFRFNFGTK 770


>gi|86747877|ref|YP_484373.1| surface antigen [Rhodopseudomonas palustris HaA2]
 gi|86570905|gb|ABD05462.1| surface antigen [Rhodopseudomonas palustris HaA2]
          Length = 840

 Score =  317 bits (813), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 222/774 (28%), Positives = 373/774 (48%), Gaps = 90/774 (11%)

Query: 81  LDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRS 140
           LD  +K + A G F +VKI      L++ ++E  +I  + F GN  +KD+QL   ++SR 
Sbjct: 72  LDDGLKGLIATGLFQDVKINGAGGRLVVAVVENPVIGRVVFEGNKKIKDEQLSAELQSRP 131

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
             A     V +D   I + Y   G  +V V  +        +++ + +EEG K  + SI 
Sbjct: 132 RGALSRAVVQSDTLRIAEIYRRSGRYDVRVTPEVIDRPNGRVDLVFRVEEGAKTGVKSIE 191

Query: 201 FVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVS 259
           FVGN  +S +RL  VI  R + + SF    D+Y  +R+  D + IR FY   G+A  +V 
Sbjct: 192 FVGNVAFSASRLRDVIRTRETNFLSFLASNDIYDPDRVEADRDLIRRFYLKNGFADAQVV 251

Query: 260 SQVL-FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
           + +  FD  K G+++ F+I+EG+ Y +G++  ++ +       L S  R+++G LYN + 
Sbjct: 252 AALTEFDPDKKGFLITFKIEEGQQYRIGSVDFRANIPGFDPNWLRSYSRVKAGALYNVEL 311

Query: 319 IKESSEKI----SKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEG 374
           +++S E++    S+  FS    F  VK   +R+F    V + +  D+G+ +Y++RIEI G
Sbjct: 312 LEKSVEEMQIEASRRGFS----FAVVKPSGDRNFDSHTVSVTFNADEGARIYIERIEIRG 367

Query: 375 NDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRV 434
           N ++ D V+RRE +++EGD  N ++++RA+RR+    +F  V I   P +  +D VIL V
Sbjct: 368 NTRTRDYVLRREFDVAEGDAYNRALVDRAERRLKNLDFFKSVKIVTEPGSS-TDRVILAV 426

Query: 435 SVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVED 494
            V++ S G   ++  Y    G   E  + + N  G+G   +++  +G+++ +  + S+ +
Sbjct: 427 EVEEKSTGDFSVSGGYSTSDGALGEVSVSERNLMGRGLFGKVSVSYGQYS-RGASLSIVE 485

Query: 495 PYFLGSPISAGFDL-QKTHLEDG--SLDINDESAAVRMIVPITESISTSFKYDL------ 545
           PY     ++ G DL  K  L++   S D+     + R+ + + E +S   +Y L      
Sbjct: 486 PYLFDYRLALGLDLYYKQQLQNSYTSYDMTTLGFSPRLGIALREDLSLQLRYSLYQQKVT 545

Query: 546 -----------------------------------------RFLQYGAISEKEKIPSIYT 564
                                                     +  YG  ++ E    +  
Sbjct: 546 LSDAYNNCNNNAANTSLSYNPTPAYIKEVLGGVDPTNASGSSYYGYGCYADGETSLPVRK 605

Query: 565 TLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFY 624
            L +  K +S SI  ++ YNTLDN   P  G+L+    D+AG GGD  Y +    A Y+ 
Sbjct: 606 ELADGAKITS-SIGYTLNYNTLDNTKNPTDGLLLDLRQDFAGVGGDVTYLKTVGDAKYYT 664

Query: 625 LLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY--- 680
            L   ++IVG +    G +    N  +++ D F + +N  +RGFA  GIGPR D  Y   
Sbjct: 665 PLV--AEIVGLIHLQGGVLSKLGNNEIRMLDHFQMGAN-LVRGFATNGIGPR-DISYWSM 720

Query: 681 -----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA-------------NH 722
                ++GG  Y  AS  +  P   +P+  GL+GA + D+ +L+              N 
Sbjct: 721 SESGDSLGGTKYWGASFELQMPFWFLPKEVGLKGAVYADAGSLWGYQGPTSWAATGEVNS 780

Query: 723 VALGADKLEGNDS-FWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
            A     L+ +DS   R S GV ++W SP G +   Y IPL   + D +Q+F F
Sbjct: 781 SACPHCGLQYDDSKIVRSSVGVGLIWASPFGPLRFDYAIPLSKGKYDTVQEFKF 834


>gi|296536120|ref|ZP_06898250.1| outer membrane protein assembly complex [Roseomonas cervicalis ATCC
           49957]
 gi|296263553|gb|EFH10048.1| outer membrane protein assembly complex [Roseomonas cervicalis ATCC
           49957]
          Length = 777

 Score =  313 bits (802), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 224/757 (29%), Positives = 372/757 (49%), Gaps = 26/757 (3%)

Query: 36  GLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFS 95
           G +A   +    V +I+++G   +  + I S + +  G +     LD +++ ++A G F 
Sbjct: 34  GAAAQQPAANGYVSQIDVQGNQRIEADTIRSYMLLQPGDAFDADRLDRSLRTLFATGLFR 93

Query: 96  NVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHN 155
           +VK+      +++ + E  I+N + F GN+ L DD L+  V+ R  A +   T  AD   
Sbjct: 94  DVKLSRQGDRILVQVQENPIVNRVAFEGNSKLSDDTLRPEVQLRPRAVFTPATAQADRQR 153

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           + + YA  G     V+ +   +    +++ + I E   A I+ I FVGN+ +S +RL+ +
Sbjct: 154 LLELYARRGRFAARVEPKVIELDQNRVDVVFEITENDAALISRINFVGNEAFSDSRLKEI 213

Query: 216 ISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVS-SQVLFDKQKSGYVL 273
           +S R + ++  F  +D Y  ER++FD E +R +Y  +GYA V+V+ +       +SG+ +
Sbjct: 214 VSSREAAWYRPFSSSDTYEPERLNFDRELLRRYYQRQGYADVEVTGAAAELAPDRSGFFV 273

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
            + + EG  Y VG ++I S+L+ +  + L  ++ I SG+ Y+   ++  ++ +       
Sbjct: 274 TYTLREGPRYRVGEVAINSSLRNVTGERLRPVLEIYSGDWYDGDAVERMTQALIDEANLA 333

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
             PFV V+ RI R+   + +DI + + +G   YV+RI+I GN ++ D VIRRE  L+EGD
Sbjct: 334 GAPFVEVEPRITRNRDAKTIDIAFEVREGPRQYVERIDINGNTRTQDRVIRREFRLAEGD 393

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             N + + R+++RI   GYF++V I+ +P +   D V L  +V + + G + I   Y  D
Sbjct: 394 AFNAAQMRRSRQRIRDLGYFNDVQITPVPGSS-PDRVNLNTTVSERATGEISIGGGYSTD 452

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKT 511
            G   +  I + N  G G  AR      +   Q    SV DP FL   +S G D+     
Sbjct: 453 SGALADFGIRERNILGTGVDARANTTLAQRRSQ-VDLSVTDPSFLDRNLSVGADVFYIVR 511

Query: 512 HLEDGS-LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHG 570
           +L D S  +      ++R      E +  S+ Y L       + E     SIY   IE  
Sbjct: 512 NLRDYSGYEERRAGFSLRAGYEFNERLRQSWAYTLSRRNVFNVREGA---SIY---IEEQ 565

Query: 571 KFSS--HSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASY---FYL 625
           K  +    + Q++ Y+T D+ + PR+G ++    D+AG GGD  Y R+    SY   F  
Sbjct: 566 KGVTLLSQVGQTLTYDTRDSRLDPREGYVLRLGTDFAGLGGDVSYVRLRLDGSYYIPFER 625

Query: 626 LSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIG 683
              D D V +L    G +    +K  ++ D+F +     LRGFA  G GPR V    A+G
Sbjct: 626 WLGDPDYVLALSASAGHLATYGSKRERIIDRFFLGGE-NLRGFAVAGAGPRDVSTDDALG 684

Query: 684 GKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGV 743
           G+   + +  + FP+PL P   GL G  FVD  +L  +           +DS  RV  GV
Sbjct: 685 GRTIWTQTTEMRFPLPL-PSELGLLGRAFVDVGSLSGSSSGTNV----VDDSAPRVGAGV 739

Query: 744 EIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
            + W SP G++ +     L  +  D+ Q F F  G R
Sbjct: 740 GLSWRSPFGLINIDLAQALVKKSYDETQVFRFGFGTR 776


>gi|117925145|ref|YP_865762.1| surface antigen (D15) [Magnetococcus sp. MC-1]
 gi|117608901|gb|ABK44356.1| surface antigen (D15) [Magnetococcus sp. MC-1]
          Length = 767

 Score =  313 bits (802), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 205/756 (27%), Positives = 382/756 (50%), Gaps = 25/756 (3%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           SA   SN   +  I+++GA  + KE + S + +  G +     L ++++ ++  G+F +V
Sbjct: 25  SASAQSNGETIVNIDVQGARWIEKETVKSYLELEPGDAFQAQKLANSLRALHKTGFFKDV 84

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIK 157
           K +   S L++ ++E  +I+ + FSGN+ L  D+LK +++ +    Y++    +D+ N++
Sbjct: 85  KFEREGSTLVVKVVENPMIHEITFSGNDALGTDELKGMIKLKVRDIYNQSKSQSDLANLQ 144

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           QAY   G     + ++  ++S   + +T+ I+EG K+K+  +R +GNKN S  +L   +S
Sbjct: 145 QAYRIKGLFLANIDLEVKTLSDNRVALTFDIKEGEKSKVREVRIIGNKNISEKKLRNALS 204

Query: 218 IRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIF 275
           I+ + + S+  + + Y KE++ +D+E +R  Y D G+A V+V+S +      K  +V+  
Sbjct: 205 IQPTDWLSWLTEKNTYDKEKLLYDKEQLRNVYQDEGFARVEVNSSIAELTPDKKAFVITH 264

Query: 276 QIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGER 335
            + EG+ Y  G  +I     E+ +  L   ++I  G  ++   ++ S EK++        
Sbjct: 265 ALTEGDRYKFGKTTISGDFDELPEAKLYEALKIYEGEWFSRSAVRLSIEKLTDLVGDFGY 324

Query: 336 PFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPI 395
            F+ ++ RI+ D   ++V + + I +G  +YV R+++ GN ++ DSVIRR +++ EGD  
Sbjct: 325 AFLDIQPRIDYDDEAKLVALHFEIIKGRRVYVNRVDVVGNTRTRDSVIRRMVQVVEGDRF 384

Query: 396 NYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKG 455
           + + + + K+ +    +F +V I + P     D V ++V V++   GS  I   +     
Sbjct: 385 SSTKVRQTKKDLQRLDFFEKVEI-ETPQTQDPDQVNVKVKVEEKPTGSFSIGAGFSTTDK 443

Query: 456 MGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLED 515
           +     I   NF G+G +   A+     +  ++  S  +PYFLG PISAG DL    +ED
Sbjct: 444 IVTSASISQKNFLGRG-QNLSASAALSASTADFDISFTEPYFLGKPISAGIDLYNRKVED 502

Query: 516 GSLDINDESA---AVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKF 572
            S    D S     +R+  P+++ +  S  Y+LR +      E   + S  +T I+    
Sbjct: 503 SSTSSYDRSTYGMGLRLGAPLSDELYNSVSYNLRHV------EIHNVDSTASTYIQAQYA 556

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLI-----SSSYDYAGFGGDSQYHRIGSRASYFYLLS 627
           +S  +   + YN   N +   +  L+     S + D +G GGD ++ R+ S    ++ + 
Sbjct: 557 NSPYLQSMLSYNLNWNMLQQEETGLVGGRSHSVTTDLSGLGGDVKFVRVSSDNHLYHSIR 616

Query: 628 DDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR--VDKKYAIGGK 685
               +V  LR   G V   + ++ ++++F +     +RGF   G+GPR  VD   ++GG 
Sbjct: 617 PMGKLVAHLRLKGGVVESWDGDVPIYEKFQLGGPQSVRGFKNSGLGPRAIVDGD-SMGGN 675

Query: 686 IYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEI 745
            Y+  +  + FPM +  E  G++G  F+D+  L +N   LG D  E      RVS GV +
Sbjct: 676 YYAMTNMELIFPM-IGLEDKGVKGITFIDAGIL-SNFDPLGVDVNESGAP--RVSAGVAV 731

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            W SP G +      P++    D  + F F +G  +
Sbjct: 732 DWKSPFGPLRFNLAFPVKKENWDSPRAFDFSVGTAL 767


>gi|146342185|ref|YP_001207233.1| putative protective surface antigen [Bradyrhizobium sp. ORS278]
 gi|146194991|emb|CAL79016.1| putative protective surface antigen precursor (Outer membrane
           protein D15) [Bradyrhizobium sp. ORS278]
          Length = 773

 Score =  312 bits (800), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 228/787 (28%), Positives = 365/787 (46%), Gaps = 38/787 (4%)

Query: 9   RRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRI 68
           RR +R  +     S      +L   I   SA           + ++G   V   ++ SR 
Sbjct: 6   RRPRRFGKSRHVTSVAAALTVLMCPILAASA---------ETLAVQGNRRVDAAMVTSRF 56

Query: 69  PVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLK 128
                     A LD  +K +   G F +VKI      +++ L E K+++ + F GN  +K
Sbjct: 57  HADASGRYDAAALDAGLKALVETGLFDDVKISRNGGQIVVRLAEAKLLDRVAFEGNKKVK 116

Query: 129 DDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVI 188
           D  L   V S+  +A    TV  DV  I QAY  +G  +V V  +        +++ + I
Sbjct: 117 DADLTSAVLSKPRSALQRATVQGDVARILQAYHRVGRDDVRVVPEIIDRGNDRVDLVFTI 176

Query: 189 EEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAF 247
            EG K  + +I F+GNK Y   +L  VI    S   SF    D Y  +R++ D E +R +
Sbjct: 177 TEGKKTPVRAISFIGNKAYDARQLRAVIKTSESTVLSFVTGGDAYDADRVNEDREQLRQY 236

Query: 248 YHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLI 306
           Y + G+A  +V++  V FD+  +G+ L F IDEG  Y  G I     +Q +    L + +
Sbjct: 237 YRNHGFADAEVTNVSVEFDRASNGFNLSFTIDEGVAYKFGAIDFACNVQGLACDGLRTQL 296

Query: 307 RIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLY 366
             + G+ ++  ++ +++E ++        PF +V+ R+NR+   R+ D+ + ID+G   Y
Sbjct: 297 LPQRGDTFDASKLDKTTEVLTAELGKLGFPFAQVEPRVNRNTPARLADVSFQIDEGQRSY 356

Query: 367 VKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDV 426
           V+RI+I GN ++ D VIRRE ++ EGD  N ++I+RA+RR+    YF  V I+  P +  
Sbjct: 357 VERIDIHGNTRTRDDVIRREFDIGEGDAYNKTLIDRAERRLRNLNYFKTVKITSRPGS-T 415

Query: 427 SDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ 486
            D V+L V V   + G   ++  Y    G+  E  + D N  G G  A+    +G+ A +
Sbjct: 416 RDRVVLDVEVVDQATGDFNVSGGYSSTDGLLAEVKVGDRNVLGTGNTAQATFTYGQFA-R 474

Query: 487 NYTFSVEDPYFLG--SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYD 544
             T S   PY LG  +P    F  Q       S   N    A  + +P++E  +  ++Y 
Sbjct: 475 GATLSFTSPYALGRLTPGVELFARQSMATTFQSFGNNTYGGAFTLGMPVSEQTAMLWRYS 534

Query: 545 LR----FLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           L      L  G       +P      I  G+ +   +  ++ Y+TLDN  +P  G+    
Sbjct: 535 LYDQKVVLAPGISPAAVSVP--VRQAIAAGRQTVSQLGNTVTYSTLDNAKMPTSGIRSQL 592

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP--SNKNLQLFDQFSV 658
           S D AG GGD ++  + + A   Y  S +SD+   +R G G  I     +   L + F  
Sbjct: 593 SQDLAGLGGDVRF--LKTTADVRYYRSINSDLTAMVR-GQGGYITGLGGQQAPLLNSF-F 648

Query: 659 SSNYYLRGFAYKGIGPR-------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAF 711
                +RGFA  G GPR       +D    +GG  Y + +A +   +P VP+  GLRG+ 
Sbjct: 649 GGPTMVRGFAPGGFGPRDLTAGSTMDN---VGGSFYWATTAELQSNIPGVPQEYGLRGSA 705

Query: 712 FVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQ 771
           FVD+ T++  +     +    N +  R S GV + W SP G + V Y +P+     D +Q
Sbjct: 706 FVDAGTVFG-YRGPAQNVQVANKNVLRSSVGVGMTWASPFGPLTVDYSVPISKAAYDVVQ 764

Query: 772 QFGFRIG 778
            F F  G
Sbjct: 765 PFRFSAG 771


>gi|312114741|ref|YP_004012337.1| outer membrane protein assembly complex, YaeT protein
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311219870|gb|ADP71238.1| outer membrane protein assembly complex, YaeT protein
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 784

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 219/768 (28%), Positives = 367/768 (47%), Gaps = 41/768 (5%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           + V+     +VR I++ G   +  E + S +    GQ       D +++ ++A G F +V
Sbjct: 22  TEVFAQGGGVVRDIKVVGNRRIEPETVKSYLTFTAGQRYDAYKADESLRALFATGLFQDV 81

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIK 157
           +I      ++I ++E  +IN + F GN  +K D L   V+ ++   Y    V ADV  + 
Sbjct: 82  RITPQGGSVVIAVVENPLINRVAFEGNTEVKSDTLSAEVQLKARTMYTRAKVQADVQRVL 141

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
             Y   GY    V  Q   +    +++ + I EG + K+  I F+GN+++S   L  VI+
Sbjct: 142 DVYRRQGYYATQVDAQIIELDNNRIDLVFEIREGPETKVVGINFIGNQSFSDTELRGVIT 201

Query: 218 IRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIF 275
              S +  F K T VY  +R + D E +R +Y   GYA ++V S V   D++  G+ L F
Sbjct: 202 TTESSFLDFLKPTSVYDPDRFNLDRELLRRYYLKNGYADMRVMSAVADVDQEGKGFFLTF 261

Query: 276 QIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGER 335
            IDEG  Y  G + ++STL     +T+   +  + G++YN + +  ++E+++        
Sbjct: 262 TIDEGPQYFFGGVDVESTLPAFAAETVRGNLLTKPGDVYNAELVDRTAERLTVSVAEQGF 321

Query: 336 PFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPI 395
            F +V+ RI+RD   R + + Y+++QG  LY++RI + GN ++ D VIRRE  ++EGD  
Sbjct: 322 AFGQVRPRIDRDPVNRTISVTYVVEQGPRLYIERINVVGNYRTEDYVIRREFRVAEGDAY 381

Query: 396 NYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKG 455
           N  M+++A+ R++A G+F +V +++ P +   D V+L V V++ S G +  A  Y   +G
Sbjct: 382 NKIMVDQARLRLLALGFFKDVKVNREPGS-APDRVVLSVVVEEQSTGELSFAAGYSSAEG 440

Query: 456 MGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD-------- 507
           +  E    + N  G G   ++    G         S  +P FL   +S G D        
Sbjct: 441 LLGEVSYTERNLLGTGQYLQVKVT-GSQVSGGAEVSWTEPRFLDRNLSFGLDAFARNSDY 499

Query: 508 LQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI 567
              ++ + G  D+     +VR    + +S+  +  Y L   +   ++E     S+    I
Sbjct: 500 TSSSYTDAGYADLK-IGGSVRFGFALIDSLWLNTNYTLMSDEVYDVAEGS---SLAVKQI 555

Query: 568 EHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLS 627
           E G     S+  S+IY+T +N   P +G   S + D AG GGD  Y R  +    +Y ++
Sbjct: 556 E-GTSVISSVGYSLIYDTRNNRKNPSRGFYFSFAQDVAGVGGDVNYIRSIAEGRGYYPIT 614

Query: 628 DDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYA---IGG 684
                VG    G       ++N+++ D F       +RGFA  G+GPR   KY    +GG
Sbjct: 615 KQITFVGRA-IGGNISGWDDQNVRIVDSF-FKGGETVRGFATAGLGPR--DKYTDDPVGG 670

Query: 685 KIYSSASAAVSFPMPLVPERAGLRGAFFVD-------SATLYANHVALGADKLEG----- 732
           K + +A+A V FP+P +P+  G  GA F D        A+ YA+     A    G     
Sbjct: 671 KNFWAATAEVRFPLPFIPDDLGFGGAVFADVGSVWGSDASKYAHQYCTNAGSSTGQCAPG 730

Query: 733 -----NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
                + +  R S G  I+WNSP+G +   +   L     D+ Q F F
Sbjct: 731 NIGTFDSNDIRASVGASILWNSPVGPLRADFAYALAKASYDETQVFRF 778


>gi|312115653|ref|YP_004013249.1| outer membrane protein assembly complex, YaeT protein
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311220782|gb|ADP72150.1| outer membrane protein assembly complex, YaeT protein
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 786

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 218/779 (27%), Positives = 366/779 (46%), Gaps = 46/779 (5%)

Query: 30  LFYAI--FGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           +F A+  F   A   SN +++R +++ GA+ +  E +   I +  G     A  D ++K 
Sbjct: 16  VFVAVTSFARDARAASNGAMIRTVKVVGASRIEPETVQHYISLKPGDRYDPAKADDSIKA 75

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDED 147
           ++  G F +  + +    L++ + E  ++  + F G  ++  D L   V+  +   + + 
Sbjct: 76  LFQTGLFRDASLTMQGGALVVKVAENPLVARVAFEGAKDVTSDTLAKEVQLNAGGTFSKA 135

Query: 148 TVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNY 207
               DV  I  AY   GY    V+ +        +++ + I EG + K+  I F+GN ++
Sbjct: 136 RAETDVQRILTAYRRQGYYTAQVEAKTIDREHDRIDVVFEITEGPQIKVVGINFIGNASF 195

Query: 208 SHARLERVISIRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL--- 263
           S A L   I+   SG   F + + VY  +R++ D E +R FY   G+A ++V S      
Sbjct: 196 SDAELRGEITTTESGLLDFLRNSSVYDPDRLNLDREMLRRFYVKSGFADMRVLSATADVD 255

Query: 264 ---FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIK 320
               D +K G+ + F +DEG  YT GN+ +++T   +  K L + I+ + G++YN + + 
Sbjct: 256 SDKVDAEKKGFFVTFTLDEGARYTFGNLDVEATAHGLDAKALAASIKGKPGDIYNAELVD 315

Query: 321 ESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYD 380
            S E ++K       PF +V+ RI+RD  +R + + ++++ G   YV+R+EI GN  + D
Sbjct: 316 RSVEALTKAAAEAGAPFAQVRPRIDRDPVRRTISVAFVVEDGPRAYVERVEISGNTATKD 375

Query: 381 SVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLS 440
            VIRRE  ++EGD  N  ++E+ + R+M TG+F +V + + P +   D V L + V +  
Sbjct: 376 EVIRREFRVAEGDAYNKVIVEQGRLRVMRTGFFKDVKVEKQPGS-APDRVDLALKVTEAE 434

Query: 441 AGSVGIATNYEVDKGMGVEGHIDDNNFFGQG--YRARLAAGFGRHAVQNYTFSVEDPYFL 498
            G++G A  Y  + G+  E    + N  G G   + +L+     +   N +++  +P FL
Sbjct: 435 TGNLGFALGYSSNDGIIGEVEYTERNLMGTGQYLQVKLSGSLSGNGAFNVSWT--EPRFL 492

Query: 499 GSPISAGFDL---QKTHLEDGSLDIND-----ESAAVRMIVPITESISTSFKYDLRFLQY 550
              +S G D       + E     +            R   PITE  ST   Y L   + 
Sbjct: 493 DRNVSFGVDAFVKSADYTESAGYTVAGYKDFRVGGTTRFGFPITEEFSTGVNYTLMMDRV 552

Query: 551 GAISEKEKIPSIYTTLIEHGKFSS--HSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
             + +   +       ++  K +S   SI  ++IY+T DN   P +G       D AG G
Sbjct: 553 YGVDDDASLA------VKQIKGTSVISSIGYNMIYDTRDNRKKPTRGFYFKGVQDLAGAG 606

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           GD  Y R  S A  +Y +S +  + G  + G        +++++ D F   S   + GF 
Sbjct: 607 GDVNYIRSTSEARAYYPISQEIVLAGRAQAG-NITGWGGQSVRVVDAFYKGSE-TIAGF- 663

Query: 669 YKGIGPR-VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
            K  GPR     YA+GG  + SA+A + FP+P VP   GL GA F  + T++    A  A
Sbjct: 664 -KSFGPRDATTGYALGGTQFYSATAELRFPLPFVPSDLGLSGAVFASAGTMFGTDAASFA 722

Query: 728 DK-----------LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
                        +  N S  R STG  ++W+SPLG +       L    GDK Q FGF
Sbjct: 723 KAYAAANGTSNTLVTTNSSKLRASTGFSLIWDSPLGPLRADIATVLSKANGDKTQTFGF 781


>gi|224825021|ref|ZP_03698127.1| outer membrane protein assembly complex, YaeT protein [Lutiella
           nitroferrum 2002]
 gi|224602692|gb|EEG08869.1| outer membrane protein assembly complex, YaeT protein [Lutiella
           nitroferrum 2002]
          Length = 762

 Score =  310 bits (794), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 213/765 (27%), Positives = 368/765 (48%), Gaps = 34/765 (4%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
            +F +SA   +   +V+ I + G        + + +P+ VG + +D     A+K ++A G
Sbjct: 12  GLFSMSAAMAAEPFVVKDIRVEGLQRTEPGTVFNYMPLKVGDTFTDEKAKEAIKALFATG 71

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA---AYDEDTV 149
           +F++V+++    VLI+ +IER +I  L  SG      DQLK  ++    A    +D+  +
Sbjct: 72  FFNDVRMEAQGDVLIVSVIERPVITQLNISGAKEFDKDQLKKALKENGLAESRVFDQGLL 131

Query: 150 NADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSH 209
           +  V  +K+ Y S G  +V +      +    + +T  I EGV AKI  IR VG K +  
Sbjct: 132 DGAVQELKRQYYSRGKYSVEITPSVTKLERNRVAVTLDIVEGVTAKIKEIRIVGAKAFDQ 191

Query: 210 ARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQ 267
             L    S+ T  + S+  K + YSK+++S D E ++AFY ++GY    + S+QV     
Sbjct: 192 DTLLGQFSLTTGDWLSWITKDNQYSKQKLSGDLEKLKAFYQNQGYLEFNIDSTQVSISAD 251

Query: 268 KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKIS 327
           K    L   I+EG+ YT+ ++ +   L+ + +  L  LI+ ++G++++ +++ +S   IS
Sbjct: 252 KEDMFLTININEGQRYTISDVKLAGDLK-VPEAELRKLIQFKAGDVFSREKVNDSVTAIS 310

Query: 328 KYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRREL 387
               +    F  V      D  KR V     +D G   YV+R+ I GN ++ D V+RREL
Sbjct: 311 DRLGNDGYAFANVNALPEIDREKRQVAFTLFLDPGRKTYVRRVNIAGNTKTRDEVVRREL 370

Query: 388 ELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIA 447
              EG P     I+R+K R+   GYF +VN+      D  D V + +++K+   GS+   
Sbjct: 371 RQLEGAPYASDKIKRSKERVELLGYFEDVNVETPAVADTPDQVDMNINLKERPTGSISAG 430

Query: 448 TNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV-QNYTFSVEDPYFLGSPISAGF 506
             +   +G+   G +  +N FG G    L+AG     V ++ + +  DPYF    +S G+
Sbjct: 431 IGFVQGQGLVFSGSVSQSNIFGSG--KSLSAGISTGKVNKSASIAFNDPYFTVDGVSLGY 488

Query: 507 DLQKTHLEDGSLD------INDESAAVRMIVPITESISTSFKYDLRFLQYG----AISEK 556
           +L  T   D   D           AA +  VPITE       +D   L  G    AI+  
Sbjct: 489 NLY-TRTYDAQEDNVSKYKTRTTGAAAKFGVPITE-------FDRINLSLGVEQTAITTF 540

Query: 557 EKIPSIYTTLIEHGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYH 614
              P  Y   ++    S++++  +I +  +T D+ + P +G ++ +  D    G D QY+
Sbjct: 541 SDSPQRYLDFVDKYGKSANTLLSTISWSRDTRDSALWPTRGAVLRAGVDIGLPGLDLQYY 600

Query: 615 RIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGP 674
           R+  + ++++ LS    ++ +   GY      +  L  F  F +     +RG+    IGP
Sbjct: 601 RLSHQQTWYFPLSKTFTLMLNGEVGYADGYGKSATLPFFQNFYMGGLGSVRGYETGSIGP 660

Query: 675 RVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND 734
           +      +GG      +  + FP P + +   +R + F D  +L+ ++V+ G+   +G  
Sbjct: 661 KDTNGDFLGGTTKVVGNVELLFPFPGMRDNKSVRTSVFFDVGSLWDSNVS-GSTPSDG-- 717

Query: 735 SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
              R STG  + W SP+G M   Y +PL+  EGDK Q F F++G 
Sbjct: 718 --LRYSTGAALTWLSPMGPMKFSYAVPLKKEEGDKKQSFQFQLGT 760


>gi|323137312|ref|ZP_08072390.1| outer membrane protein assembly complex, YaeT protein
           [Methylocystis sp. ATCC 49242]
 gi|322397299|gb|EFX99822.1| outer membrane protein assembly complex, YaeT protein
           [Methylocystis sp. ATCC 49242]
          Length = 830

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 226/807 (28%), Positives = 383/807 (47%), Gaps = 92/807 (11%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I ++G T    E+I S          S A++D  ++ + A G FS+V        +++ +
Sbjct: 34  IVVQGNTRADAEMIRSYF-----TGTSPAEIDQGLEALRASGRFSSVSASRQGGKVVVRV 88

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E  +IN +   GN+ +K + L   +R+R+  A+   T  +DV  + + Y   G     V
Sbjct: 89  SEGNMINRVALEGNSKVKTENLLPELRTRARTAFSPATAESDVARLTEIYRRSGRAAAKV 148

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKT- 229
             +   +    +++ + I EG K  +  I+FVGN  YS  RL  ++      + SF K+ 
Sbjct: 149 SYRTVDLPNGRIDVVFTIVEGDKTGVKEIKFVGNNVYSTRRLVGMMETTEMNFLSFLKSS 208

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           DVY  +R++ D E +R FY   GYA  +V SS   FD  + GY++   ++EG  Y V ++
Sbjct: 209 DVYDPDRIASDLELVRRFYLKNGYADFRVVSSDAQFDPAQGGYIITIVVEEGPQYRVSSV 268

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
            ++S L ++   +L  ++RI +G++YN   +++S E +++        F + + R  R+ 
Sbjct: 269 DVESHLPDVDAASLNDVLRISAGDVYNGDAVEKSVEALTREIAKKGYAFTQARPRGERNP 328

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
           A + V I +++D+G  +Y++RI I GN ++ D VIRRE E+ EGD  N  +I+RA+RR+ 
Sbjct: 329 AAQTVAIRFVLDEGPRVYIERINIRGNTRTRDYVIRREFEIGEGDAYNRVLIDRAERRLN 388

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
             GYF +V I+  P +   D VI+ V V+    G+ G++  Y   +G   E  + ++NF 
Sbjct: 389 GLGYFKKVKITNEPGSS-PDRVIVNVDVEDQPTGNFGVSGGYSTTQGFIAEVSVSESNFM 447

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESA--- 525
           G+G   R++   G+ + +  TFS  +PYFL   I+AGFD+    ++  +  I   ++   
Sbjct: 448 GRGQAVRMSVQAGQLS-RGVTFSFTEPYFLDQRIAAGFDVFAKRMDAYNYSIYSSTSVGG 506

Query: 526 AVRMIVPITESISTSFKYDLRFLQYGAISEKEKI---------------------PSIYT 564
            +R  VPIT+ ++ S  Y +        +   +                      PS++ 
Sbjct: 507 TIRFGVPITDELTFSPHYSIYQTTISIPNNWSRPYNDCWSPVPGLTPGFSPFFPEPSLFI 566

Query: 565 TLIEHGKFS-----------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
               +G+ S           +  +  S+ ++ +DN   P  G   + S D AG GGDS+Y
Sbjct: 567 NCQTNGEASLAIKESQGTLLTSLVGYSLTFDNVDNFKNPHNGWHATLSQDVAGVGGDSRY 626

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRF------GYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
            R      YF+ +    D+VG  R        +G   P     ++ D F++  +  +RGF
Sbjct: 627 LRTTGDIRYFHEIPYLDDVVGIARVQGGDLSTFGGYTP-----RIQDNFNLGPS-LVRGF 680

Query: 668 AYKGIGPR---------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           A  GIGPR          ++  ++GG  Y   S  V FP+  +P+  GLRGA F D+ TL
Sbjct: 681 APGGIGPRDSNIFTSFNNNRGNSLGGSDYFGGSLEVQFPLWGLPKDLGLRGALFADAGTL 740

Query: 719 --------YANHV------------------ALGADKLEGNDSF-WRVSTGVEIMWNSPL 751
                   Y+N++                   +G   +  +DS   R S G  ++WNSP+
Sbjct: 741 WNFQGRTNYSNNLPTIPGVTCLAPYSAQAAFGVGTCVIPVSDSMKLRSSVGASLLWNSPM 800

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y +      GD  Q F F  G
Sbjct: 801 GPIRFDYAVVTSKVYGDITQNFRFTGG 827


>gi|218530312|ref|YP_002421128.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium chloromethanicum CM4]
 gi|240138672|ref|YP_002963144.1| putative outer membrane protein assembly factor [Methylobacterium
           extorquens AM1]
 gi|254561268|ref|YP_003068363.1| outer membrane protein assembly factor [Methylobacterium extorquens
           DM4]
 gi|218522615|gb|ACK83200.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium chloromethanicum CM4]
 gi|240008641|gb|ACS39867.1| putative outer membrane protein assembly factor [Methylobacterium
           extorquens AM1]
 gi|254268546|emb|CAX24503.1| putative outer membrane protein assembly factor [Methylobacterium
           extorquens DM4]
          Length = 854

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 239/840 (28%), Positives = 391/840 (46%), Gaps = 106/840 (12%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           + + G   +  ++I + G   V  E I S +        +    + A +N+ A G FS+V
Sbjct: 25  TVILGGAAAQAQQIVVEGNRRVDSETIRSYV-----TGTATGSPEEARRNLLATGLFSDV 79

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIK 157
           ++       ++ + E  ++  +FF GN  ++   L+ +V ++   A     + ADV  I+
Sbjct: 80  QVSGRGGTTVVRVRENSVVGRVFFEGNKKVEKATLESVVETKDRGALSPAVIAADVERIR 139

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
             Y   G     V  +   +     ++ Y I+EG K  I  I F+GN+ YS + L+ ++S
Sbjct: 140 DVYKRSGRGTAKVSYRLVDLPSGRSDVIYAIDEGDKTGIREIHFIGNQAYSESTLKGLMS 199

Query: 218 IRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYA---AVKVSSQVLFDKQKSGYVL 273
                + SF KT DVY  +R+S D + +R +Y   GYA    V   ++ +     +G+V+
Sbjct: 200 SSEMNFLSFIKTSDVYDPDRISADLDIVRRYYLKNGYADFRVVNADARYVETGDDAGWVI 259

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
              ++EGE YTVG +++   +  I ++ L   IR + G++YN ++++++   ++      
Sbjct: 260 NVTVEEGEQYTVGAVAVDPRIAGIDREALDGQIRAQVGDVYNAEDVEKTLVGVTNEVNRQ 319

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
             PF +V+    RD A   V + ++++ G  +YV+RI I GN ++ D VIRREL+L+EGD
Sbjct: 320 GYPFAQVRPTGQRDRATHQVALGFVVEDGPRVYVERINIRGNTRTRDYVIRRELDLTEGD 379

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             N  +++RA+RR+   G+F +V  S  P +   D V++ + V+    GS  +A  Y   
Sbjct: 380 AYNRVLVDRAERRLNGLGFFKKVRFSNEPGS-APDRVVVNIDVEDQPTGSFSVAGGYSTQ 438

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKT 511
            G+  E  + ++NF G+G   RLA   G++A +   FS  +PYFLG  ++AGFD   + +
Sbjct: 439 DGIIGEVSVSESNFLGRGQYVRLAVQGGQYA-RGIDFSFTEPYFLGYRLAAGFDAFYKYS 497

Query: 512 HLEDGS-LDINDESAAVRMIVPITESISTSFKY-----DLRFLQ---------------Y 550
            L   S  +       +R+ +PITE    +F+Y     +LR                  Y
Sbjct: 498 DLTRWSRYETTVYGGQLRLGLPITEEFGVTFRYSVYNTELRVPNTIKRPYNDCSVAIPGY 557

Query: 551 GAISEKEKI-PS---------IYTTLIEHGKFSSHSISQ-----------SIIYNTLDNP 589
            AI+    I PS          Y      G+ S     Q           ++ Y+TLDN 
Sbjct: 558 TAINPAGTIDPSSGRDVGGLPAYPNCAFDGEASIALKGQQGNVLTSLAGVTLAYSTLDNL 617

Query: 590 IVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNK 648
             P  G       D AG GGDS++ R+   A Y+  L +  D+VG +R   G V    ++
Sbjct: 618 QRPTNGFYGELKPDVAGIGGDSKFFRVTGDARYYKELWE--DVVGFVRLQGGHVSNLDDQ 675

Query: 649 NLQLFDQFSVSSNYYLRGFAYKGIGPR----VDKKY-AIGGKIYSSASAAVSFPMPLVPE 703
            L++ DQF +  +  +RGFA  G+GPR     D +  AIGG  Y  A+  V FP+  +P 
Sbjct: 676 PLRITDQFFLGPS-LVRGFAPNGLGPRDIGIADARSNAIGGTTYFGATVEVQFPIWGLPR 734

Query: 704 RAGLRGAFFVDSATLY------------------------ANHVALGADKLE-------- 731
             GL+GA F D+ TL+                         N+   GA  +         
Sbjct: 735 DLGLKGALFADAGTLFGYDGRRNFDVNRDGFINGFAPGSGCNYTNFGAGAITVEPECVNV 794

Query: 732 GNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG----------DKIQQFGFRIGNRM 781
            + +  R S G  I+WNSPLG +   Y   L   EG          D++Q F F  G+R 
Sbjct: 795 RDKATIRSSVGASILWNSPLGPIRFDYAYALSKDEGVQTALGKVGKDQLQAFRFSGGSRF 854


>gi|163851505|ref|YP_001639548.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium extorquens PA1]
 gi|163663110|gb|ABY30477.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium extorquens PA1]
          Length = 864

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 239/840 (28%), Positives = 391/840 (46%), Gaps = 106/840 (12%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           + + G   +  ++I + G   V  E I S +        +    + A +N+ A G FS+V
Sbjct: 35  TVILGGAAAQAQQIVVEGNRRVDSETIRSYV-----TGTATGSPEEARRNLLATGLFSDV 89

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIK 157
           ++       ++ + E  ++  +FF GN  ++   L+ +V ++   A     + ADV  I+
Sbjct: 90  QVSGRGGTTVVRVRENSVVGRVFFEGNKKVEKATLESVVETKDRGALSPAVIAADVERIR 149

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
             Y   G     V  +   +     ++ Y I+EG K  I  I F+GN+ YS + L+ ++S
Sbjct: 150 DVYKRSGRGTAKVSYRLVDLPSGRSDVIYAIDEGDKTGIREIHFIGNQAYSESTLKGLMS 209

Query: 218 IRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYA---AVKVSSQVLFDKQKSGYVL 273
                + SF KT DVY  +R+S D + +R +Y   GYA    V   ++ +     +G+V+
Sbjct: 210 SSEMNFLSFIKTSDVYDPDRISADLDIVRRYYLKNGYADFRVVNADARYVETGDDAGWVI 269

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
              ++EGE YTVG +++   +  I ++ L   IR + G++YN ++++++   ++      
Sbjct: 270 NVTVEEGEQYTVGAVAVDPRIAGIDREALDGQIRAQVGDVYNAEDVEKTLVGVTNEVNRQ 329

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
             PF +V+    RD A   V + ++++ G  +YV+RI I GN ++ D VIRREL+L+EGD
Sbjct: 330 GYPFAQVRPTGQRDRATHQVALGFVVEDGPRVYVERINIRGNTRTRDYVIRRELDLTEGD 389

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             N  +++RA+RR+   G+F +V  S  P +   D V++ + V+    GS  +A  Y   
Sbjct: 390 AYNRVLVDRAERRLNGLGFFKKVRFSNEPGS-APDRVVVNIDVEDQPTGSFSVAGGYSTQ 448

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKT 511
            G+  E  + ++NF G+G   RLA   G++A +   FS  +PYFLG  ++AGFD   + +
Sbjct: 449 DGIIGEVSVSESNFLGRGQYVRLAVQGGQYA-RGIDFSFTEPYFLGYRLAAGFDAFYKYS 507

Query: 512 HLEDGS-LDINDESAAVRMIVPITESISTSFKY-----DLRFLQ---------------Y 550
            L   S  +       +R+ +PITE    +F+Y     +LR                  Y
Sbjct: 508 DLTRWSRYETTVYGGQLRLGLPITEEFGVTFRYSVYNTELRVPNTIKRPYNDCSVAIPGY 567

Query: 551 GAISEKEKI-PS---------IYTTLIEHGKFSSHSISQ-----------SIIYNTLDNP 589
            AI+    I PS          Y      G+ S     Q           ++ Y+TLDN 
Sbjct: 568 TAINPAGTIDPSSGRDVGGLPAYPNCAFDGEASIALKGQQGNVLTSLAGVTLAYSTLDNL 627

Query: 590 IVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNK 648
             P  G       D AG GGDS++ R+   A Y+  L +  D+VG +R   G V    ++
Sbjct: 628 QRPTNGFYGELKPDVAGIGGDSKFFRVTGDARYYKELWE--DVVGFVRLQGGHVSNLDDQ 685

Query: 649 NLQLFDQFSVSSNYYLRGFAYKGIGPR----VDKKY-AIGGKIYSSASAAVSFPMPLVPE 703
            L++ DQF +  +  +RGFA  G+GPR     D +  AIGG  Y  A+  V FP+  +P 
Sbjct: 686 PLRITDQFFLGPS-LVRGFAPNGLGPRDIGIADARSNAIGGTTYFGATVEVQFPIWGLPR 744

Query: 704 RAGLRGAFFVDSATLY------------------------ANHVALGADKLE-------- 731
             GL+GA F D+ TL+                         N+   GA  +         
Sbjct: 745 DLGLKGALFADAGTLFGYDGRRNFDVNRDGFINGFAPGSGCNYTNFGAGAITVEPECVNV 804

Query: 732 GNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG----------DKIQQFGFRIGNRM 781
            + +  R S G  I+WNSPLG +   Y   L   EG          D++Q F F  G+R 
Sbjct: 805 RDKATIRSSVGASILWNSPLGPIRFDYAYALSKDEGVQTALGKVGKDQLQAFRFSGGSRF 864


>gi|83592929|ref|YP_426681.1| surface antigen D15 [Rhodospirillum rubrum ATCC 11170]
 gi|83575843|gb|ABC22394.1| surface antigen D15 [Rhodospirillum rubrum ATCC 11170]
          Length = 785

 Score =  307 bits (787), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 205/745 (27%), Positives = 361/745 (48%), Gaps = 23/745 (3%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           + RI I G   +  E +L+ + V  G       +D ++KN++  G F++V ++     L+
Sbjct: 51  IDRIVIEGTQRIDPETVLTYMTVREGDVYDAGKVDRSLKNLFETGLFADVSMRHEGGRLV 110

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + + E  IIN + F GN  +KD QL+  ++ R    Y    V  DV  I + Y   G   
Sbjct: 111 VSVAENPIINRIAFEGNRRIKDPQLETEIQLRPRVVYTRAKVQEDVQRILELYRRSGRYA 170

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
           V V+ +  ++    +++ + I EG    +  I FVGNK Y  + L  V+      ++ F 
Sbjct: 171 VSVEPKVIALDQNRVDLAFEINEGPSTTVRRISFVGNKVYDDSALREVVETSEEAWYRFL 230

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
             TD Y  +R+++D E +R  Y   GYA  +V S +      +  + + F + EGE Y  
Sbjct: 231 SSTDTYDPDRLTYDRELLRRHYLKNGYADFQVKSAIAELSTDRQAFFMTFTVSEGERYRF 290

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G + +++TL E+  + L  +I  + G+ Y+  +++ + +K++    +    FV VK R+ 
Sbjct: 291 GPVGLETTLAELDPEALRGVITFKDGDWYSADKVEAAVQKLTDEVGNRGFAFVDVKPRVT 350

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           RD  KR + I + ID+G   +V+RI+I GN ++ D V+RRE+ LSEGD  N + + R+++
Sbjct: 351 RDADKRTIAITFQIDEGPRAFVERIDINGNVRTLDEVVRREMMLSEGDAFNSAKLRRSRQ 410

Query: 406 RIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDN 465
           RI   G+F +V ++  P+    D  +++V V + S G V     +    G  +E  + + 
Sbjct: 411 RIQDLGFFEKVEVNNEPSPTAPDRTVVKVDVTEKSTGEVSFGVGWSSSVGAIIEVGLRER 470

Query: 466 NFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL---QKTHLEDGSLDIND 522
           N  G+G   + +  + +   Q    S  +PYFL   + AG DL   ++   ++ S D   
Sbjct: 471 NLLGRGQDLKASVSWAQRRSQ-VDISFTEPYFLDRRLRAGVDLYAIERDLKKESSYDYRT 529

Query: 523 ESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH--SISQS 580
              A+R+     E++  +FKY   F      +E   + S  +  I++    ++   I   
Sbjct: 530 YGTALRLGYNYNENLGHTFKYTAEF------NEITDVKSDASRFIKNQDDKTYLSMIGHV 583

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVG----SL 636
           + Y+  D+ + P+ G ++S   D AG GG   + R  ++A+Y+  + D  D       ++
Sbjct: 584 LTYDRRDSKLDPKDGYVLSLGNDMAGLGGSEYFLRSDAKAAYYAPIGDWFDWNPTWGLTV 643

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSASAAVS 695
           + G G +    K++ +  ++++     LRGFA  G  PR  D   A+GG   ++ S  V+
Sbjct: 644 KGGAGYMFGLGKDVNINQRYNLGGT-NLRGFANAGASPRDADTDDALGGNWVTTGSVEVA 702

Query: 696 FPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
            P+ L P   GL G  F D   +           ++G  S  R+S G  + W SP+G + 
Sbjct: 703 VPLGL-PAELGLSGRLFSDFG-MIGKPDDFDEALMDGAVSP-RLSAGAGVTWVSPVGPIS 759

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNR 780
           V  G PL   + DK + F    G+R
Sbjct: 760 VDLGYPLVKEKFDKTEVFRLSFGSR 784


>gi|188581294|ref|YP_001924739.1| outer hypothetical protein assembly complex, YaeT protein
           [Methylobacterium populi BJ001]
 gi|179344792|gb|ACB80204.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium populi BJ001]
          Length = 854

 Score =  307 bits (786), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 233/840 (27%), Positives = 390/840 (46%), Gaps = 106/840 (12%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           S + G   +  ++I + G   V  + I S +        +    + A +N+ + G FS+V
Sbjct: 25  SVILGGAAAQAQQIVVEGNRRVDSDTIRSYV-----TGTASGSPEEARRNLLSTGLFSDV 79

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIK 157
           ++       ++ + E  ++  +FF GN  ++   L+ +V ++   A     + ADV  I+
Sbjct: 80  QVSARGGTTVVRVRENSVVGRVFFEGNKKVEKATLESVVETKDRGALSPAVIAADVERIR 139

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
             Y   G     V  +   +     ++ + I+EG K  I +I FVGN  YS + L+ ++S
Sbjct: 140 DVYKRSGRGTAKVSYRLVDLPTGRSDVVFAIDEGDKTGIRAINFVGNNVYSESTLKGLMS 199

Query: 218 IRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYA---AVKVSSQVLFDKQKSGYVL 273
                + SF KT DVY  +R+S D + +R +Y   GYA    V   ++ +    ++G+V+
Sbjct: 200 SSEMNFLSFIKTSDVYDPDRISADLDIVRRYYLKNGYADFRVVNADARYVESGDETGWVI 259

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
              ++EGE YTVG +++   +  I ++ L   IR + G++YN ++++++   ++      
Sbjct: 260 TVTVEEGEQYTVGAVAVDPRIAGIDREALDGQIRAQVGDVYNAEDVEKTLVGVTNEVNRQ 319

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
             PF +V+    RD A   V + ++++ G  +YV+RI I GN ++ D VIRREL+L+EGD
Sbjct: 320 GYPFAQVRPTGQRDRATHQVALGFVVEDGPRVYVERINIRGNTRTRDYVIRRELDLAEGD 379

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             N  +++RA+RR+   G+F +V  S  P +   D V++ + V+    GS  +A  Y   
Sbjct: 380 AYNRVLVDRAERRLNGLGFFKKVRFSNEPGS-APDRVVVNIDVEDQPTGSFSVAGGYSTQ 438

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKT 511
            G+  E  + ++NF G+G   RLA   G++A +   FS  +PYFLG  ++AGFD   + +
Sbjct: 439 DGIIGEVSVSESNFLGRGQYVRLAVQGGQYA-RGIDFSFTEPYFLGYRLAAGFDAFYKYS 497

Query: 512 HLEDGS-LDINDESAAVRMIVPITESISTSFKY-----DLRFLQ---------------Y 550
            L   S  +       +R+ +PITE    +F+Y     +LR                  Y
Sbjct: 498 DLTRWSRYETTVYGGQLRLGLPITEEFGVTFRYSIYNTELRVPNTIKRPYNDCSVAIPGY 557

Query: 551 GAISEKEKI-----------PSIYTTLI----------EHGKFSSHSISQSIIYNTLDNP 589
            A++    I           P+                + G   +     ++ Y+TLDN 
Sbjct: 558 TAVNPAGTIDPASGRDVGGLPAYPNCAFDGEASIALKGQQGNVLTSLAGVTLAYSTLDNL 617

Query: 590 IVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNK 648
             P  G       D AG GGDS++ R+   A Y+  L +  D+VG +R   G +    N+
Sbjct: 618 QRPTNGFYGELKPDVAGIGGDSKFFRVTGDARYYKELWE--DVVGFVRLQGGHISALDNQ 675

Query: 649 NLQLFDQFSVSSNYYLRGFAYKGIGPR----VDKKY-AIGGKIYSSASAAVSFPMPLVPE 703
            L++ DQF +  +  +RGFA  G+GPR     D +  AIGG  Y  A+  V FP+  +P+
Sbjct: 676 PLRITDQFFLGPS-LVRGFAPNGLGPRDVGIADARSNAIGGTTYFGATVEVQFPIWGLPK 734

Query: 704 RAGLRGAFFVDSATLY------------------------ANHVALGADKLE-------- 731
             GL+GA F D+ TL+                         N+   GA  +         
Sbjct: 735 DLGLKGAVFADAGTLFGYDGRRNFDVNRDGFINGFAPGSGCNYTNFGAGAITVEPECVNV 794

Query: 732 GNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG----------DKIQQFGFRIGNRM 781
            +    R S G  I+WNSPLG +   Y   L   EG          D++Q F F  G+R 
Sbjct: 795 RDKPTIRSSVGASILWNSPLGPIRFDYAYALSKDEGVQTALGKVGKDQLQAFRFSGGSRF 854


>gi|218532669|ref|YP_002423485.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium chloromethanicum CM4]
 gi|218524972|gb|ACK85557.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacterium chloromethanicum CM4]
          Length = 844

 Score =  307 bits (786), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 230/825 (27%), Positives = 395/825 (47%), Gaps = 98/825 (11%)

Query: 19  FPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISD 78
           F RS  +G + L +   G         ++  ++ I G   V  EVI S    +V  + +D
Sbjct: 18  FWRSCLVGIVALPHLAGG---------AVAAQLLIEGNRRVDAEVIRS----IVANAPAD 64

Query: 79  ADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS 138
           A      + + A GYFS+V +   +   ++ + E+ ++  +FF GN  ++   L+  + +
Sbjct: 65  AR-----RELMASGYFSDVTLTQANGRTLVRVQEKGVVGRVFFEGNKKVEKATLEATIVT 119

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R AA  D   V ADV  I+  Y   G     V  +   +     ++ Y I+EG K  I  
Sbjct: 120 RGAAPLDPAQVAADVERIRDVYKRSGRGTAKVSYRLVDLPSGRSDVIYAIDEGDKTGIRE 179

Query: 199 IRFVGNKNYSHARLERVISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYA--- 254
           I F+GN+ YS + L+ ++S     + SF KT DVY  +R+S D + +R +Y   GYA   
Sbjct: 180 IHFIGNQAYSESTLKGLMSSSEMNFLSFIKTSDVYDPDRISADLDIVRRYYLKNGYADFR 239

Query: 255 AVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLY 314
            V   ++ +     +G+V+   ++EGE YTVG +++   +  I ++ L   IR + G++Y
Sbjct: 240 VVNADARYVETGDDAGWVINVTVEEGEQYTVGAVAVDPRIAGIDREALDGQIRAQVGDVY 299

Query: 315 NPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEG 374
           N ++++++   ++        PF +V+    RD A   V + ++++ G  +YV+RI I G
Sbjct: 300 NAEDVEKTLVGVTNEVNRQGYPFAQVRPTGQRDRATHQVALGFVVEDGPRVYVERINIRG 359

Query: 375 NDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRV 434
           N ++ D VIRREL+L+EGD  N  +++RA+RR+   G+F +V  S  P +   D VI+ +
Sbjct: 360 NTRTRDYVIRRELDLTEGDAYNRVLVDRAERRLNGLGFFKKVRFSNEPGS-APDRVIVNI 418

Query: 435 SVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVED 494
            V+    GS  +A  Y    G+  E  + ++NF G+G   RLA   G++A +    S  +
Sbjct: 419 DVEDQPTGSFSVAGGYSTQDGIIGEVSVSESNFLGRGQYVRLAVQAGQYA-RGVDVSFTE 477

Query: 495 PYFLGSPISAGFDL--QKTHLEDGS-LDINDESAAVRMIVPITESISTSFKY-----DLR 546
           PYFLG  ++AG D   + ++L   S  +       +R+ +P+T+    +F+Y     DL+
Sbjct: 478 PYFLGYRMAAGIDAFYKYSNLARYSRYETTVVGTQLRLGLPVTDEFGVTFRYSIYNTDLK 537

Query: 547 FLQ---------------YGAISEKEKIPSIYTTLIEHGKFS-----------SHSISQS 580
                             Y A++   +  + Y      G+ S           +  +  +
Sbjct: 538 VPNTLSQPYNDCSSPISGYTAVNAAGQ--ATYPACTYDGEASIAIKSAQGSTLTSLVGAT 595

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGY 640
           + Y+TLDN   P  G       + AG GGDS ++R+   A  +   ++  D+VG ++F  
Sbjct: 596 LAYSTLDNLQRPTNGFYAELKPEIAGLGGDSNFYRVTGEARAYREFAE--DVVGFVKFQG 653

Query: 641 GCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIGPR-----VDKKYAIGGKIYSSASAAV 694
           G +  ++ N L++ DQF +  +  +RGFA  GIGPR       +  A+GG  Y   +  V
Sbjct: 654 GHMGSTDGNPLRVTDQFFLGPS-LVRGFAVNGIGPRDVGTGDARSNALGGTTYFGGTLEV 712

Query: 695 SFPMPLVPERAGLRGAFFVDSATLY----------------------------ANHVALG 726
            FP+P +P+  GL+GA F D+ TL+                            +  + + 
Sbjct: 713 QFPLPGIPKDLGLKGALFADAGTLFGYKGKRSFDVNGDGFINGYSPTGGCNYSSPSIGVQ 772

Query: 727 ADKLEGND-SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKI 770
            + +   D +  R S G  I+WNSPLG +   Y   L   EG ++
Sbjct: 773 PECVNVRDKATIRSSIGASILWNSPLGPIRFDYAYALTKDEGTRV 817


>gi|154253627|ref|YP_001414451.1| surface antigen (D15) [Parvibaculum lavamentivorans DS-1]
 gi|154157577|gb|ABS64794.1| surface antigen (D15) [Parvibaculum lavamentivorans DS-1]
          Length = 794

 Score =  306 bits (785), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 210/772 (27%), Positives = 370/772 (47%), Gaps = 43/772 (5%)

Query: 35  FGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYF 94
           FG+SA Y +   ++  I ++G   +  E + S + +  G        D ++K ++  G F
Sbjct: 37  FGVSAAYAAEQPVISEIVVQGNQRIEAETVRSYMLITPGTEYDPQVADQSLKQLFGTGLF 96

Query: 95  SNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVH 154
           +++ + +  S L++ ++E  I+N + F GN+ LK++ LK  V+ +    Y    V  DV 
Sbjct: 97  ADITMHLDGSRLVVSVVENPIVNRVAFEGNSALKEEDLKKEVQLQPRVVYTRAKVQGDVT 156

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
            + + Y   G  +  V+ +   +    +++ + I EG K KI SI F+GN  +S   L  
Sbjct: 157 RMIELYRRSGRFSATVEPKVIQLPQNRVDLVFEITEGPKTKIASINFIGNDEFSDGTLRE 216

Query: 215 VISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYV 272
           VIS   S ++ F   +D Y  +R+++D E +R +Y  RGYA  +V S V    +  + + 
Sbjct: 217 VISTGESAWWKFLSSSDSYDPDRLTYDRELLRRYYLQRGYADFRVVSAVADLSRGDAAFH 276

Query: 273 LIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFS 332
           + F ++EGEIY  G + + + L ++ K+ L +L+  +SG++YN   I E+ + ++    +
Sbjct: 277 ITFTVEEGEIYEFGEVEVTTELDKLNKEELEALLLPKSGDVYNAGLIDETIDALTFAAGT 336

Query: 333 GERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEG 392
               F  V+ RI R   +R++D+ + I +G  +YV+RI I GN ++ D V+RR++ ++EG
Sbjct: 337 SGYAFAEVRPRIKRRRDERVIDLTFQITEGPRVYVERINITGNSRTLDRVVRRQMRMAEG 396

Query: 393 DPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV 452
           D  N  +++R+++ I A  +FS+V ++Q P +   D  I+ V V++ S GS+ ++  +  
Sbjct: 397 DAFNKVLLDRSEKNIRALQFFSKVEVTQSPGS-APDKTIVNVDVQEQSTGSLSLSAGFST 455

Query: 453 DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QK 510
                    + + NF G+G +   A    +   Q   F   DPYFL   +  G DL   +
Sbjct: 456 LDNAVAGIQLSERNFLGRGLQLSTALSISKRR-QLIEFHYTDPYFLDRNLLGGIDLFGSE 514

Query: 511 THLE-DGSLDINDESAAVRMIVPITESISTSFKYDLRF-----LQYGAISEKEKIPSIYT 564
           T+ + + S D   +   +R   P++E      +Y  RF     ++Y + ++   +P  Y 
Sbjct: 515 TNFQNESSFDSRSQGFGLRFGFPLSEKSRFLLRYQFRFDEIFNVRYLSCTDPAYVPGTYC 574

Query: 565 TL-----IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR 619
                   E  +F S  +     Y+  ++P+ P  G     + ++AG GG  +Y      
Sbjct: 575 VSPIVKDAEGTEFRSI-VGYDYYYDNRNDPVEPTGGWDFLFTQNFAGLGGTVRYVSTEIL 633

Query: 620 ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---V 676
             Y+Y LS   + + S R   G +     ++ L D F    N  +RGFA  GIGPR    
Sbjct: 634 TRYYYELS--KEFLTSWRLDGGYIYGLGDDVPLNDHFFKGGN-NIRGFARGGIGPRDVVS 690

Query: 677 DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSA---------TLYANHVALGA 727
             + A+G   Y   +A ++FP  L PE  G++ + F D            LY   V    
Sbjct: 691 TNQDAVGATAYIFGTAEITFPNGL-PEALGIKTSLFTDGGFIGLSDYDQALYPGIV---- 745

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
                +D   R S GV + W SP G + +     L     D+ + F F  G 
Sbjct: 746 -----DDFAPRASVGVSLYWQSPFGPIRLDLAQVLLDEPYDEREAFRFSAGT 792


>gi|163795634|ref|ZP_02189600.1| surface antigen D15 [alpha proteobacterium BAL199]
 gi|159179233|gb|EDP63766.1| surface antigen D15 [alpha proteobacterium BAL199]
          Length = 748

 Score =  306 bits (784), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 220/766 (28%), Positives = 370/766 (48%), Gaps = 28/766 (3%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           + F +   A+  + A  G+ T  V  ++++G   +    + S + +  G       LD +
Sbjct: 2   IAFAVGMLAVGPVLAQSGAGT--VSEVQVQGTQRIDPGTVRSYLLIQPGDLFDPDRLDRS 59

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAY 144
           +K ++A G F++V ++   + L+++++E  IIN L F GNN +KD++L   V  R    +
Sbjct: 60  LKALFATGLFADVTMRRQGNALLVNVVENPIINRLAFEGNNRIKDEELSREVELRPRVVF 119

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
               V  DV  I + Y   G   V ++ +        +++ + I EG    + +I  VGN
Sbjct: 120 TRTRVQQDVQRIVEIYRRSGRYGVTIEPKVIQQPQNRVDLVFEINEGELTPVRTISIVGN 179

Query: 205 KNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL 263
           K +S + L  VI  + S ++ F    D Y  +R+SFD E +R FY + GYA  +V S V 
Sbjct: 180 KRFSDSTLRGVIQTKESAFYRFLSNADTYDPDRLSFDRELLRRFYLESGYADFQVLSAVA 239

Query: 264 -FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
                +  +V+ F I+EG+ YT G I     L  I +  L  L+   +G  YN  ++ ES
Sbjct: 240 ELTPNREAFVVTFTIEEGQPYTFGKIGFDIALPRINEDDLKELLVTETGERYNSTKVDES 299

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
            + I+    +    FV V+ +  R+   R +DI Y I + S ++V RI+I GN ++ D V
Sbjct: 300 VDAITDKLGNLGYAFVDVRPKAGRNPDDRTIDITYQIGEASKVFVDRIDIVGNVRTLDRV 359

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           IRRE+ L EGD  N S + R++RRI   G+F  V ++    +   D   ++V+V++   G
Sbjct: 360 IRREMNLVEGDAFNVSNMRRSERRIRNLGFFKSVKVTNAEGS-APDRTNVQVAVEEQPTG 418

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPI 502
            +     Y   + +  +  I + N  G+G   R     G  +   Y  S  +PYFLG  +
Sbjct: 419 EISFGIGYSSVEAVIGDVGIRERNLLGRGQDLRFGVS-GSASSTEYDISFTEPYFLGRDV 477

Query: 503 SAGFDLQKTHLE--DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
           SAGFDL +   E  + S D      A+R    +   +  +  Y LR       +E   I 
Sbjct: 478 SAGFDLFRIEREQKESSYDEVRTGGALRAGFDLAPDLRQTVNYTLR------STEITNID 531

Query: 561 SIYTTLI--EHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
           +  +  I  + G+     I Q++ Y+  D+ + PR G ++  + + AG GGD ++ R+  
Sbjct: 532 NDASRFIKEQEGETVVSQIGQTLTYDKRDSRLDPRDGYILQFTSEVAGAGGDERFLRLKG 591

Query: 619 RASYFYLLSDDSDIVGSLRFGY-GCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-V 676
           +++Y+  +    DI G    G  G ++   +++ + ++F +  N + RGF   G+GPR V
Sbjct: 592 KSAYYIPI---DDIWGLAFLGQAGYIVGLGQDVSIGERFFIGGNTF-RGFEKAGVGPRDV 647

Query: 677 DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND-S 735
           D   A+GG  Y   SA ++FP  L PE  GLR   F D  +L+     + A   E  D +
Sbjct: 648 DTGDALGGNQYYVGSAELTFPTGL-PEDLGLRAFVFTDVGSLW----NVDASGTEVRDLT 702

Query: 736 FWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             R S G+ + + +  G + V    P+   + DK + F F  G R 
Sbjct: 703 SVRASVGLGVEFVTAFGRIRVDAAQPVLKEDFDKTELFRFSYGTRF 748


>gi|197105235|ref|YP_002130612.1| outer membrane protein [Phenylobacterium zucineum HLK1]
 gi|196478655|gb|ACG78183.1| outer membrane protein [Phenylobacterium zucineum HLK1]
          Length = 793

 Score =  306 bits (784), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 216/773 (27%), Positives = 380/773 (49%), Gaps = 56/773 (7%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +++RI ++G   + +  ++S +P+ VG  +    +D A+K ++    F++VKI   +  L
Sbjct: 39  VIQRILVQGNERIEQATVVSYLPIQVGDQVDPERIDLALKALFRTDLFADVKIDFQNGDL 98

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYL 166
           II + E  IIN + F GN+ LK+D+L+  V  R    +    V +DV  I + Y   G +
Sbjct: 99  IITVEENPIINRVIFEGNSGLKEDKLRDEVSIRPRGIFTRAKVQSDVQRIVELYRRSGRI 158

Query: 167 NVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF 226
           +  V+ Q   +    +++ + I+EG K+ I S+ F+GN+ +S   L  V+    S ++ F
Sbjct: 159 SAQVEPQIIELPQKRVDLIFKIDEGPKSGILSVNFLGNRAFSDNDLRDVVVTEESRWYKF 218

Query: 227 GKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYT 284
              +  Y  +R+ +D+E +R  Y +RGY   +VSS V      K+G+V+ + +DEG  Y 
Sbjct: 219 FSNNANYDPDRLEYDKEQLRKHYRNRGYYDFRVSSAVAELAPDKNGFVVTYTLDEGPQYE 278

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
            G I +++ LQ++ +  L SL+ IRSG  Y  + I+++++ ++    +    FV V+   
Sbjct: 279 FGEIKVETELQKLDQAVLASLLPIRSGETYQDEVIEQATDALTFAAGAAGFAFVDVRPNY 338

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAK 404
             +   R VD+ + + +G  +YV RI+I GN Q+ D VIRRE+ + EGD  N ++++R++
Sbjct: 339 QANRETRKVDVTFQVREGPRVYVDRIDIVGNTQTLDYVIRREMSVVEGDAYNRALVDRSR 398

Query: 405 RRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDD 464
           R++   G+F +V I++ P +   D   L+V V++   G +  +  Y     + ++  +  
Sbjct: 399 RQVRGLGFFKDVEITETPGS-APDRTALQVRVEEQPTGELSFSAGYSSVDQLVLDLGVTQ 457

Query: 465 NNFFGQGY--RARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKTHLED-GSLD 519
            NF G+G   RAR++ G  R   Q   FS  +P FLG  ++AG DL   +  L D  S +
Sbjct: 458 RNFRGRGQDVRARVSVGSLR---QQLDFSFTEPRFLGRDVAAGIDLYGYRYDLSDYTSYE 514

Query: 520 INDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTT----------LIEH 569
                  +R   P++ +   S +Y LR        ++ KI   Y              + 
Sbjct: 515 TATVGTTLRANFPLSLNARGSLRYSLR-------QDEIKIDDFYCDPSQPLLALAICGQR 567

Query: 570 GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD 629
           G F +  +   I ++  ++ + P +G  +    D+AG  GD  Y R  +   +++  + D
Sbjct: 568 GSFITSLVGYGIRFDRRNDYLNPTRGYYVDFVQDFAGLAGDVNYVRTEAEGGWYHGFTRD 627

Query: 630 --SDIVGSLRF--GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---VDKKYAI 682
               + GS  +  G+G       N+++ D+F    N + RGF   GIGPR     +  ++
Sbjct: 628 FILSLTGSAGYVEGWG-----GDNVRINDRFYKGGNTF-RGFETAGIGPRDLSFTRADSL 681

Query: 683 GGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL-------------YANHVALGA-D 728
           GGK Y+  +  ++ P   +PE+ G++ A F D  TL                   LGA D
Sbjct: 682 GGKAYAIGTVELTVPT-FLPEQYGIKAALFSDFGTLGLLDKEDKQCPPPGTAECPLGARD 740

Query: 729 KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               +D   R S G+ I W SP+G +   +   L   + DK + F F    R 
Sbjct: 741 PNVQDDLSLRASAGLSIFWRSPMGPIRFDFSRVLAKEDYDKTETFRFSTSTRF 793


>gi|27379964|ref|NP_771493.1| outer membrane protein [Bradyrhizobium japonicum USDA 110]
 gi|27353117|dbj|BAC50118.1| bll4853 [Bradyrhizobium japonicum USDA 110]
          Length = 844

 Score =  306 bits (783), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 224/805 (27%), Positives = 369/805 (45%), Gaps = 83/805 (10%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKI-KIVDSVL 106
           V+ I + G   V  E I S      G  +    +D  +K +   G F +VKI +     +
Sbjct: 40  VQSISVEGNRRVEVETIRSYFKPGPGGRLDQGAIDDGLKALIETGLFQDVKINRGAGGQI 99

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYL 166
           ++ ++E  +I  + F GN  +KD+QL   V+S++   +    V +D   I + Y   G  
Sbjct: 100 VVSVVENPVIGRIAFEGNKKIKDEQLGTEVQSKARGTFSRAMVQSDTLRIAEIYRRSGRY 159

Query: 167 NVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF 226
           +V V  +        +++ + IEEG K  + SI FVGN  +S  RL  VI  R S   SF
Sbjct: 160 DVRVTPEVIEQPNNRVDLIFTIEEGAKTGVKSIEFVGNVAFSSYRLRDVIKTRESNLLSF 219

Query: 227 -GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYT 284
               D+Y  +R+  D + IR FY   G+A V+V + +  +D +K G+ + F+I+EG  Y 
Sbjct: 220 LASGDIYDPDRVEADRDLIRRFYLKNGFADVQVVAALTEYDPEKKGFNVTFKIEEGAQYR 279

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
           VG +  +S++      ++ +  R+  G+LYN + +++S E++          F  V+   
Sbjct: 280 VGALDFRSSIPNFDPNSMRAYSRVNVGSLYNVESVEKSVEEMQIEASRRGYAFAVVRPGG 339

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAK 404
           +R+F    V + + ID+G   Y++RI + GN ++ D VIRRE ++SEGD  N ++++RA+
Sbjct: 340 DRNFEAHTVSVVFNIDEGPRTYIERINLRGNTRTRDYVIRREFDISEGDAYNRALVDRAE 399

Query: 405 RRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDD 464
           RR+    YF  V I+  P +  SD VIL V +++ S G   I+  Y    G   E  + +
Sbjct: 400 RRLKNLDYFKSVKITTEPGSS-SDRVILIVDMEEKSTGDFSISGGYSTTDGALAEVSVSE 458

Query: 465 NNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-QKTHLEDGSLDINDE 523
            N  G+G  A+ +  +G++A + Y+ S  +PY L   ++ G DL Q+    +  +    +
Sbjct: 459 RNLLGRGLFAKASVTYGQYA-RGYSLSFVEPYLLDYRVALGLDLYQREQKSNSYISYGTK 517

Query: 524 SA--AVRMIVPITESISTSFKYDLRFLQ-------------------------------- 549
           +   + R+   + E ++   +Y +   +                                
Sbjct: 518 TLGFSPRLGFSLREDLALQLRYSIYRQEITLPFYLANCNNIAGPAFNPSPAFAASQVPPI 577

Query: 550 -------YGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
                   G  S+ E    +   L  +GK  + ++  S+ YNTLDN   P  G+L+    
Sbjct: 578 DLSSTNGLGCYSDGEASLPVRKEL-ANGKTLTSALGYSLSYNTLDNNKNPTDGLLVDFRQ 636

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNY 662
           D+AG GGD  Y +    A Y+  L   SDIV   R   G +     +L++ D F +  N 
Sbjct: 637 DFAGVGGDVTYLKSVIDAKYYTPLV--SDIVAVARLQSGILTKMGSDLRMLDHFQMGPN- 693

Query: 663 YLRGFAYKGIGPR----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
            +RGFA  GIGPR       + A+GG  Y  AS  +  P   +P+  GL+GA + D+  L
Sbjct: 694 LVRGFAPNGIGPRDLNPFGTQDALGGTKYWGASMELQMPFWFLPKEVGLKGAVYADAGGL 753

Query: 719 Y-----ANHVALGADKLEGNDSF-----------------------WRVSTGVEIMWNSP 750
           Y         A G      N +                         R S GV ++W SP
Sbjct: 754 YDYQGPTTWSATGETTTTRNSNCIPSTINPATAGTCTGLVYDDSKVIRSSVGVGLIWQSP 813

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGF 775
            G +   Y +PL   + D+ Q+F F
Sbjct: 814 FGPLRFDYAVPLSKGKYDRTQEFRF 838


>gi|304320064|ref|YP_003853707.1| outer membrane protein [Parvularcula bermudensis HTCC2503]
 gi|303298967|gb|ADM08566.1| outer membrane protein [Parvularcula bermudensis HTCC2503]
          Length = 843

 Score =  306 bits (783), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 227/826 (27%), Positives = 371/826 (44%), Gaps = 95/826 (11%)

Query: 36  GLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFS 95
           G + V      ++RRIE+ G   +    + S +P+   Q +S   +D ++K ++  G F+
Sbjct: 27  GAATVPDETGGLIRRIEVVGNQRIEASTVRSYLPIGPEQRVSQVAIDASLKTLFGTGLFA 86

Query: 96  NVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHN 155
           +  I   + VL + + E  I+N + F GN    +D+    ++    A Y    V AD   
Sbjct: 87  DAGISFDNGVLTVAVQENPIVNRVIFEGNRT-NEDKFTEEIQLAPRAIYTRAKVQADTQR 145

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           I   Y + G     V  +   +    +++ + IEEG K  + +I FVGN+ ++ A+L + 
Sbjct: 146 ILGVYRATGRFGASVTPKIVELPQNRVDVIFEIEEGPKTGVAAINFVGNEAFTDAQLRKA 205

Query: 216 ISIRTSGYFSFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVL 273
           I    S +++F ++ D Y  +R+ +D + +R FY  +GYA   V+S V      +  + +
Sbjct: 206 ILTSESAWWNFLESNDNYDPDRLEYDRQLLREFYTKQGYADFSVASAVAELTPDREDFFI 265

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
            F ++EG  YT G + +++TL +I+   L +++ IR G  +N + I+++ E I+      
Sbjct: 266 TFTVEEGPQYTFGKVDVRTTLYKIEGDALKAVLPIREGTQFNSELIEKAEEAIAYATGIN 325

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
              FV V  R+ R+   + VD+ + +++G  +YV RI I GN Q+ D VIRRE+ L+EGD
Sbjct: 326 GYAFVDVAPRLTRNADTKTVDVVFEVNEGPRVYVDRINIRGNTQTLDRVIRREMRLTEGD 385

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             N  ++ER++RRI   G+FSEV I + P +   D  +L V+V + S GS  I       
Sbjct: 386 AFNRVLVERSERRIKGLGFFSEVAIEEQPGS-APDRTVLDVAVTEQSTGSFQIGAGLSSA 444

Query: 454 KGMGVEGHIDDNNFFGQGYRARL---AAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-- 508
               +   ++  N  G+G    L    +   R A  ++T    +PYFLG  + AGF    
Sbjct: 445 DSFIINFQLEQRNLLGRGQYLLLDLQTSSRTRRARVSFT----EPYFLGRRLRAGFSFTA 500

Query: 509 QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLR---------------------- 546
            +T  E+     +     + +  P++E  S S  Y LR                      
Sbjct: 501 NRTDFEEAGFISDSIGGGLNIGFPVSEFGSMSLSYLLRQDDVTLERSTTQVVEASEGEVI 560

Query: 547 --FLQYGAISEK--EKIP----------------SIYTTLIEHGKFSSHSISQSIIYNTL 586
             FL  GA + +  E  P                S+  T    GKF +  +  S+ ++  
Sbjct: 561 EDFLVNGASTPEIVETAPNGDLTYQVEICDLLTRSLDPTCESRGKFLTSQVGYSLRFDRR 620

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP- 645
           D+PI P +G  +  S   AG GGD  Y +  +R S +  L    D VG+L+F  G +   
Sbjct: 621 DDPITPSRGWRVDLSQALAGVGGDVNYLQSTARGSLYRPLP--LDFVGALKFDVGYIDGF 678

Query: 646 SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-------------VDKKYAIGGKIYSSASA 692
            +  +++ D+F    N   RGF   G+GPR                  AIG K Y+  + 
Sbjct: 679 GDDGVRVSDRFFKGGNRGFRGFDVAGVGPRYFEPGATVNGVTQAGFDRAIGAKAYAIGTV 738

Query: 693 AVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSF---------------- 736
               P+PL P + G+R A F D     A  V    DKL  ND                  
Sbjct: 739 EAVLPLPL-PPQYGIRAALFSD---FGAVGVVDEDDKLLNNDPVNFVDFDDDGIPDPPVQ 794

Query: 737 ----WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                R + G+ I W SP G + +     ++  E D+ Q F F  G
Sbjct: 795 DDFSMRATAGLSINWRSPFGPVQIDLAEAIQKEEYDETQVFRFSAG 840


>gi|148261429|ref|YP_001235556.1| surface antigen (D15) [Acidiphilium cryptum JF-5]
 gi|146403110|gb|ABQ31637.1| surface antigen (D15) [Acidiphilium cryptum JF-5]
          Length = 785

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 210/747 (28%), Positives = 366/747 (48%), Gaps = 25/747 (3%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           IE+RG   +    ILS I +  G   S   +D ++K +YA G F  V +    + L++D+
Sbjct: 48  IEVRGNQRIDASTILSYILLRPGDRFSQRRMDLSLKTLYATGLFHTVSLTRQGNDLVVDV 107

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E  ++N +FF GN+ L D  LK +V  +  + +      AD   I   YA  G+ +  V
Sbjct: 108 QENPVVNQVFFRGNSVLTDANLKKVVSLKPGSVFTPAAAAADTRTILDQYAKQGHYSATV 167

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKT 229
             +   +    +N+ +   +G +  I+ I F+GN++Y   RL  VIS R + +F F   +
Sbjct: 168 TPEIVKLPENRVNVVFRCHDGPETLISRIDFIGNRHYGQTRLREVISSRENAWFRFLSSS 227

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D Y+ ER+ +DE  +  FY   GYA  KV S+       +  + L F +DEG  Y + ++
Sbjct: 228 DEYNPERVKYDEALLSRFYFHHGYADFKVKSATAQLAPDRKSFFLTFVVDEGPRYHIASV 287

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
            ++S++  +  K+L +L+ I  G++++   I+ + + ISK   +    F +V   ++ + 
Sbjct: 288 KVESSVTNLSAKSLRALVPIEKGDIFDGDAIQTAVKNISKAAQNRGFAFAQVVPDVHENH 347

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
           A   +D+ + + +G  +YV  + I GN ++ D VIRR++EL+ GD  N   ++++K+ + 
Sbjct: 348 ANHTIDLTFRVVEGPKVYVNDVVIRGNTRTEDQVIRRQVELAPGDAYNQDAVDQSKQNLE 407

Query: 409 ATGYFSE---VNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDN 465
             GYF +   V I+  P +   D V L V V + + G   +   Y  D G      +  N
Sbjct: 408 NLGYFKKQDGVKIATSPTS-TPDRVNLDVDVAEQATGQFSLGGGYSTDLGALANIGLSQN 466

Query: 466 NFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESA 525
           NF G G  A ++A   +   Q +   V +PYFLG  + AGFDL +T   + +  +  E +
Sbjct: 467 NFLGTGISASISALLAQKGTQ-FNLGVTNPYFLGRNLIAGFDLFRTDTYNSTAYVFSERS 525

Query: 526 A---VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSII 582
               +R+     + +S +F Y L       I+      S+Y  L E GK +   +  ++ 
Sbjct: 526 IGGDLRLGFRYNDHVSQAFTYTLSTRDIYNIASSA---SLY-ILSEEGKTTLSQLGTTLT 581

Query: 583 YNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLS---DDSDIVGSLRFG 639
           ++  +N I P  G +++ S D+AG GG ++Y R+ +R +Y+  L     D   V      
Sbjct: 582 FDYRNNRIDPSSGEILALSGDFAGLGGTAKYIRLEARGAYYIPLERYFGDKAWVLEFDGH 641

Query: 640 YGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY--AIGGKIYSSASAAVSF 696
            G +         L D+F +  +  L GF   G GP  D +Y  +IGG    +    + F
Sbjct: 642 VGKIFGIEGYRTTLADRFFLGGDSML-GFQTGGAGPH-DTQYGDSIGGNFIWTQDTVLHF 699

Query: 697 PMPLVPERAGLRGAFFVDSATLYA-NHVALGADKLEGND-SFWRVSTGVEIMWNSPLGMM 754
           P+P+ P+  G+ G  F D  +L   + + +    L   D +  R+S GV + WN+P G++
Sbjct: 700 PLPVSPD-LGVSGFAFTDIGSLTGVSPITVNGQTLGVYDNAAPRISAGVGVAWNTPFGLI 758

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            + Y  P++  + D+++QF    G R 
Sbjct: 759 DLSYAQPIKKYKYDQVEQFRVSFGTRF 785


>gi|148257092|ref|YP_001241677.1| putative protective surface antigen [Bradyrhizobium sp. BTAi1]
 gi|146409265|gb|ABQ37771.1| putative protective surface antigen precursor (Outer membrane
           protein D15) [Bradyrhizobium sp. BTAi1]
          Length = 782

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 208/712 (29%), Positives = 349/712 (49%), Gaps = 19/712 (2%)

Query: 79  ADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS 138
           A LD  +K++ A G F +V+I   D  + + + E ++++ + F GN  +KD +L   V+S
Sbjct: 76  AALDSGLKSLVATGLFEDVRIDRADGRIAVRVSEAQVLDRVAFEGNKKVKDAELSAAVQS 135

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           +  A     TV  DV  I +AY  +G  +V V  +        +++ + I EG K  + S
Sbjct: 136 KPRAGLQRATVQGDVARIIEAYHRVGRDDVRVVPEIIDRGNERVDLVFTITEGKKTPVRS 195

Query: 199 IRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           + F+GN  Y   +L+ VI    +   SF    DVY  +R++ D E +R +Y + GYA  +
Sbjct: 196 VSFIGNHAYGARQLQAVIKTSATHLLSFVTGGDVYDPDRINADREQLRQYYRNHGYADAE 255

Query: 258 VSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNP 316
           V+S  V +D+  SG+ + F I+EG  Y  G I +   + E+  + L SL+  + G++++ 
Sbjct: 256 VTSVNVDYDRATSGFDVTFAIEEGPPYRFGAIELSCNVPELNCERLRSLLLAQEGDVFDD 315

Query: 317 QEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGND 376
            ++ +++E ++        PF +V+  I R+ A  +  + + +DQG   YV+RIEI GN 
Sbjct: 316 GKLVKTTEAVTAELGRIGFPFAQVEPVILRNPAAHLAGVRFQVDQGRRTYVERIEIHGNS 375

Query: 377 QSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSV 436
           ++ D V+RRE + SEGD  N ++I+RA+RR+    YF  V IS    +   D V+L V V
Sbjct: 376 RTRDDVVRREFDFSEGDAYNKTLIDRAERRLRNLNYFKTVKISSTQGSS-RDRVVLDVEV 434

Query: 437 KQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPY 496
              + G   ++  Y    G+  E  I D N  G G  A+ A  +G+ A +    S   PY
Sbjct: 435 VDQATGDFNVSGGYSNTDGLLAEVKIGDRNVLGTGNTAQAAFTYGQFA-RGANLSFTSPY 493

Query: 497 FLG--SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
            LG  +P    F  Q       +   N    A+ + +P++E  +  ++Y L + Q   +S
Sbjct: 494 ALGRTTPGIELFARQSAATTFQAFGSNTYGGALTLGMPVSEQTAILWRYSL-YDQNVVLS 552

Query: 555 EKEKIPSIYTTLIEHGKFSSHSISQ---SIIYNTLDNPIVPRKGMLISSSYDYAGFGGDS 611
                 ++   + +        +SQ   ++ Y+TLDN  +P  G+    S D AG GGD 
Sbjct: 553 PGTNPAAVSPAVRQAAAAGRQLVSQLGHTVTYSTLDNNKIPTNGIRSQLSQDLAGLGGDV 612

Query: 612 QYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYK 670
           ++ R      Y+   S ++D+ G +R   G +     +   L + F       +RGFA  
Sbjct: 613 RFLRTTEDVRYYR--SINNDLTGMVRAQGGYITGWGGRQAPLLNSF-FGGPTMVRGFAPG 669

Query: 671 GIGPR----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALG 726
           G GPR       +  +GG +Y + +A +   +P +P+  GLR + FVD+ T++  +    
Sbjct: 670 GFGPRDLTAGSTRDNVGGSVYWATTAELQSNIPGLPQEYGLRASAFVDAGTVFG-YRGPT 728

Query: 727 ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            +    N +  R S GV + W SP G + V Y +PL     D +Q   F  G
Sbjct: 729 QNLQVANKNVIRSSVGVGMTWASPFGPLTVDYAVPLSKAAYDVVQPLRFSAG 780


>gi|326404909|ref|YP_004284991.1| hypothetical protein ACMV_27620 [Acidiphilium multivorum AIU301]
 gi|325051771|dbj|BAJ82109.1| hypothetical protein ACMV_27620 [Acidiphilium multivorum AIU301]
          Length = 772

 Score =  305 bits (782), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 210/747 (28%), Positives = 365/747 (48%), Gaps = 25/747 (3%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           IE+RG   +    ILS I +  G   S   +D ++K +YA G F  V +    + L++D+
Sbjct: 35  IEVRGNQRIDASTILSYILLRPGDRFSQRRMDLSLKTLYATGLFHTVSLTRQGNDLVVDV 94

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E  ++N +FF GN+ L D  LK +V  +  + +      AD   I   YA  G+ +  V
Sbjct: 95  QENPVVNQVFFRGNSVLTDANLKKVVSLKPGSVFTPAAAAADTRTILDQYAKQGHYSATV 154

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKT 229
             +   +    +N+ +   +G +  I+ I F+GN++Y   RL  VIS R + +F F   +
Sbjct: 155 TPEIVKLPENRVNVVFRCHDGPETLISRIDFIGNRHYGQTRLREVISSRENAWFRFLSSS 214

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D Y+ ER+ +DE  +  FY   GYA  KV S+       +  + L F +DEG  Y + ++
Sbjct: 215 DEYNPERVKYDEALLSRFYFHHGYADFKVKSATAQLAPDRKSFFLTFVVDEGPRYHIASV 274

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
            ++S++  +  K+L +L+ I  G++++   I+ + + ISK   +    F +V   ++ + 
Sbjct: 275 KVESSVTNLSAKSLRALVPIEKGDIFDGDAIQTAVKNISKAAQNRGFAFAQVVPDVHENH 334

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
           A   +D+ + + +G  +YV  + I GN ++ D VIRR++EL+ GD  N   ++++K+ + 
Sbjct: 335 ANHTIDLTFRVVEGPKVYVNDVVIRGNTRTEDQVIRRQVELAPGDAYNQDAVDQSKQNLE 394

Query: 409 ATGYFSE---VNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDN 465
             GYF +   V I+  P +   D V L V V + + G   +   Y  D G      +  N
Sbjct: 395 NLGYFKKQDGVKIATSPTS-TPDRVNLDVDVAEQATGQFSLGGGYSTDLGALANIGLSQN 453

Query: 466 NFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDE-- 523
           NF G G  A ++A   +   Q +   V +PYFLG  + AGFDL +T   + +  +  E  
Sbjct: 454 NFLGTGISASISALLAQKGTQ-FNLGVTNPYFLGRNLIAGFDLFRTDTYNSTAYVFSERS 512

Query: 524 -SAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSII 582
               +R+     + +S +F Y L       I+      S+Y  L E GK +   +  ++ 
Sbjct: 513 IGGDLRLGFRYNDHVSQAFTYTLSTRDIYNIASSA---SLY-ILSEEGKTTLSQLGTTLT 568

Query: 583 YNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLS---DDSDIVGSLRFG 639
           ++  +N I P  G +++ S D+AG GG ++Y R+ +R +Y+  L     D   V      
Sbjct: 569 FDYRNNRIDPSSGEILALSGDFAGLGGTAKYIRLEARGAYYIPLERYFGDKAWVLEFDGH 628

Query: 640 YGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY--AIGGKIYSSASAAVSF 696
            G +         L D+F +  +  L GF   G GP  D +Y  +IGG    +    + F
Sbjct: 629 VGKIFGIEGYRTTLADRFFLGGDSML-GFQTGGAGPH-DTQYGDSIGGNFIWTQDTVLHF 686

Query: 697 PMPLVPERAGLRGAFFVDSATLYA-NHVALGADKLEGND-SFWRVSTGVEIMWNSPLGMM 754
           P+P+ P+  G+ G  F D  +L   + + +    L   D +  R+S GV + WN+P G++
Sbjct: 687 PLPVSPD-LGVSGFAFTDIGSLTGVSPITVNGQTLGVYDNAAPRISAGVGVAWNTPFGLI 745

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            + Y  P++  + D+++QF    G R 
Sbjct: 746 DLSYAQPIKKYKYDQVEQFRVSFGTRF 772


>gi|58040249|ref|YP_192213.1| Outer membrane protein [Gluconobacter oxydans 621H]
 gi|58002663|gb|AAW61557.1| Outer membrane protein [Gluconobacter oxydans 621H]
          Length = 822

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 215/781 (27%), Positives = 376/781 (48%), Gaps = 54/781 (6%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSV 105
           +I++ I ++G T +    +LS +    G + +  DLD ++K +YA G F +V +    + 
Sbjct: 49  NIIQAISVKGNTRIETSTVLSYMVAQPGDTFNQDDLDRSLKTLYATGLFKDVTLHRDGNT 108

Query: 106 LIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGY 165
           L++DL+E  I+N + F GN+ LKD+ L+  +  R  A +   T  AD   I   YA    
Sbjct: 109 LLVDLVENPIVNRIVFEGNHALKDEDLRKEISLRPRAVFSSQTTAADRQKILNQYAGKAR 168

Query: 166 LNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS 225
               V  Q   +S   +++ + I E  +  I  I FVGN  +S ARL +VIS + + ++ 
Sbjct: 169 FGATVTPQIVKLSHNRVDVVFNINEAQQTLIKKIVFVGNHAFSEARLSQVISSKETIWYR 228

Query: 226 -FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV--SSQVLFDKQKSGYVLIFQIDEGEI 282
            F  +D Y+ ER+ +D E +R FY   G+    +  ++  L    KS Y+  F + EG+ 
Sbjct: 229 FFSSSDEYNPERVKYDAELLRRFYLHNGFVDFHMVDATGELAPDHKSFYI-TFTVHEGDR 287

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y +G + ++S+++ +  + L   + +    +Y+   I+ +++ + ++  +   PF  V++
Sbjct: 288 YRLGKMDVRSSVRHVTPEMLRPHVELFPHQIYDGTAIQNNTKNMQEWLQASGHPFAMVRS 347

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I R+  K IVD+ + + +G  +YV+RI+I GN  ++D VIRR L ++EGDP  Y+  +R
Sbjct: 348 EIARNPEKHIVDLLFDVTEGPHVYVERIDINGNTITHDDVIRRNLPMAEGDP--YTPFDR 405

Query: 403 --AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K  +   GYFS V++ Q   +   D V +  +V +   G   +   Y  D G+    
Sbjct: 406 KYSKLGLQDLGYFSSVSVDQTQGS-APDRVNVSANVVEKPTGEFSLGGGYSTDVGILGNA 464

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD---LQKTHLEDGS 517
            I  +N  G G  A ++     +  Q    S+ DPYFL   + AG D   +Q  +    S
Sbjct: 465 SIKQHNLLGTGVDAGISGTVAYYEKQA-DISITDPYFLNRNLVAGADFYFIQNNYQTYQS 523

Query: 518 LDINDESAAVRMIVPITESISTSFKYDL------RFLQYGAISEKEK----IPSIYTTLI 567
              +    ++R+       +S S+ Y L       F    A+++       +PSIY    
Sbjct: 524 YKESQYGMSLRLGYAYNRYLSQSWNYTLVDRQVGNFYDASAVAQDPSLIRWVPSIYVQQS 583

Query: 568 EHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLS 627
                 S  +S S+ Y+  D    P  G +     D+AG GG+S+Y R+ +  +Y+  L 
Sbjct: 584 AGWSLLSQ-LSTSVTYDRRDRRSNPHSGYMFKVGGDFAGIGGNSKYARVKADGAYYLPLD 642

Query: 628 D---DSDIVGSLRFGYGCV--IPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV------ 676
           D   + D     + G G +    SN N  + D F +     LRGF   G+GPR       
Sbjct: 643 DLTGNHDWTFQFKGGVGYMGDWSSNGNRNIIDNFYLGGE-NLRGFLQGGVGPRSGHLKIN 701

Query: 677 -------DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSAT--------LYAN 721
                   ++  +GG+   +ASA ++FP+P+  +  G+ G  F+D+ +        LY N
Sbjct: 702 GVYIPAQGQEDLLGGRFMYTASAQLNFPLPM-GDDLGISGRGFIDAGSLAGLRVKHLYTN 760

Query: 722 HVALGAD--KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
            +  G +   + G++   RVS G+ + W SP G++ +   +P+R   GD++    F  G 
Sbjct: 761 RMNDGDNYTPITGDNLIPRVSGGLGVSWKSPFGLVNIDGAVPIRKEHGDRLYPLRFGFGQ 820

Query: 780 R 780
           +
Sbjct: 821 Q 821


>gi|163731908|ref|ZP_02139355.1| outer membrane protein, putative [Roseobacter litoralis Och 149]
 gi|161395362|gb|EDQ19684.1| outer membrane protein, putative [Roseobacter litoralis Och 149]
          Length = 786

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 220/791 (27%), Positives = 374/791 (47%), Gaps = 31/791 (3%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSI-------VRRIEI 53
           M     D + ++    + F +  Q G   L      +SA + + T +       +  + I
Sbjct: 1   MKPGKTDAQSVQGATRRTFTKPLQAGVFCL-----AISATWIAPTGVALAQQIEINSVNI 55

Query: 54  RGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIER 113
            G   +G   ILSR  +V GQSIS  +L+  ++ + A G F +V  +   + L I ++E 
Sbjct: 56  EGNARIGDSAILSRAGIVPGQSISAGELNAGLQRLVASGLFESVDFEPRGNSLNITVVEY 115

Query: 114 KIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQ 173
             IN + F GN  + D+ L   + S     ++      D   I  AYAS G +   V   
Sbjct: 116 PTINRINFEGNARIGDETLAAAINSNERRVFNPAQAERDAALIADAYASEGRIAARVTPT 175

Query: 174 HHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDVY 232
               S   +++ + I EG   +I  + F GN+ YS  RL RV+  + +G F +F ++D  
Sbjct: 176 IIRRSDNRVDLIFEIFEGDNIEIERLSFTGNRVYSDRRLRRVLETKQAGLFRAFVRSDTL 235

Query: 233 SKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQ 291
            ++R+ FD + +R FY  RGY   + +S      +++ GY L+F + EG+ + VG I++ 
Sbjct: 236 VEDRIEFDRQILRDFYLSRGYVDFRTNSVNAELTEERDGYFLVFDVQEGQQFRVGEITVA 295

Query: 292 STLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKR 351
           S L E         ++ RSG +Y+P  I+    ++ +        F+RV+ RI RD    
Sbjct: 296 SELAEADSDLYRETVKTRSGVVYSPTLIEADIARMERQAIIDGVDFMRVEPRITRDERNL 355

Query: 352 IVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATG 411
            +++EY++++G  ++V+RI+IEGN  + D VIRR+    EGDP N   I  +  RI A G
Sbjct: 356 TINVEYVLNRGPRVFVERIDIEGNTTTLDQVIRRQFNSVEGDPFNPREIRESAERIRALG 415

Query: 412 YFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQG 471
           +F+  +++    +   D VI+ V V++   GS+    ++  + G+G      + NF G+G
Sbjct: 416 FFTVADVNAREGSS-PDQVIIDVDVEEQPTGSLSFGASFSTNDGIGFAIQFTERNFLGRG 474

Query: 472 YRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESA----AV 527
            R  L+        Q Y  +  +P FLG  +  G  L  +     ++  + E A    ++
Sbjct: 475 QRLGLSLSTAADD-QLYRVNFFEPAFLGRDVGFGLRLDISESTSSTVTYDTERAVLTPSL 533

Query: 528 RMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLD 587
              V     +  ++KYD   ++    S+ +  P I    I+ G+  + SI    IY++  
Sbjct: 534 SFPVGANSRLELNYKYDQSEMKDRG-SDSDNGP-IIGRDIDEGELVNSSIGYRYIYDSRT 591

Query: 588 NPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCVIPS 646
             + P  G L     D+AG GGD+ + R  ++A     + ++D  +  +L  G      S
Sbjct: 592 TGLDPNAGYLFEFGQDFAGVGGDNTFIRTSAKAVGERKVFNEDVTLRATLE-GGALNYQS 650

Query: 647 NKNLQLFDQFSVSSNYYLRGFAYKGIGPR---VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
             N +  D+F +S+N  +RGF   GIGPR      +  +GG +Y +A     FP+ L PE
Sbjct: 651 GAN-RAVDRFLLSTN-TIRGFEPGGIGPRDLSESNEDPLGGNLYVTARFEAEFPVGL-PE 707

Query: 704 RAGLRGAFFVDSATLY-ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPL 762
             G+ G  F D   L+  N V L    + G    +R   GV I+W +P+G +   +   +
Sbjct: 708 EYGITGGLFYDVGNLWDLNDVNLSGGNVVGESGSFRHVIGVSILWETPVGPLRFNFSDAI 767

Query: 763 RHREGDKIQQF 773
           R  + D+ Q F
Sbjct: 768 RKEDFDREQTF 778


>gi|149915221|ref|ZP_01903749.1| outer membrane protein, putative [Roseobacter sp. AzwK-3b]
 gi|149810942|gb|EDM70781.1| outer membrane protein, putative [Roseobacter sp. AzwK-3b]
          Length = 774

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 208/756 (27%), Positives = 368/756 (48%), Gaps = 21/756 (2%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
            G +++ +A+   + V  + +     +EI G   V    ILS   +  GQ++S A+L+ A
Sbjct: 25  FGLVMVTFAVLAFAGVASAQSYRFSTVEIEGNQRVEAGTILSYAGIERGQTVSAAELNDA 84

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAY 144
            + I A G F +V I+   + L I ++E   IN + F GN  LKD+ L+  V+SR    +
Sbjct: 85  YQKILASGLFESVTIEPRGNRLFISVVEYPTINRIAFEGNRRLKDEDLEGFVQSRVRQVF 144

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
                  D   + +AYA  G L+  V  +    S   +++ + I EG K ++  I FVGN
Sbjct: 145 SPTQAERDAATLTEAYAQNGRLSARVSPKVIRRSDNRVDLVFEIFEGGKIEVQRIGFVGN 204

Query: 205 KNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVS-SQV 262
           K +S  RL RVI  + +G   +  + D + ++R+ FD + +  FY  RGY   +V+ +  
Sbjct: 205 KAFSDRRLRRVIDSKQAGLLRALIERDTFVEDRIEFDRQVLTDFYQSRGYVDFRVTGTNA 264

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
              +++  Y + F I EG+ +T G I+  S L E+      +++++R G +Y+P  ++ +
Sbjct: 265 ELARERDAYFVTFNIQEGQQFTFGEITTISDLPEVDPDVYQAVLKLRPGMVYSPTRVENA 324

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
             ++ +        F+RV+ RI+R+     +D+E+ + +G  ++V+RI+IEGN  + D V
Sbjct: 325 ISRMERLAIKEGVDFLRVEPRISRNDRDLTLDVEFALVRGPRVFVERIDIEGNTTTVDQV 384

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           IRR+ ++ EGDP N   I  A  RI A  YFS+V +     +   D V++ V+V++ + G
Sbjct: 385 IRRQFDVVEGDPFNPRQIREAAERIRALRYFSDVEVDAREGSR-PDQVVVDVNVEETTTG 443

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPI 502
           S+    +Y  + G+G+     + NF G+G +   A         NY  S  +P FLG  +
Sbjct: 444 SLSFGGSYSTNSGLGISVGFSERNFMGRG-QELTAQIAAAENNANYNISFVEPAFLGRDV 502

Query: 503 SAGFDLQKTHLEDGSLDINDESAAVR--MIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
           + G D      +      N  +   R  +  P++E+   S  YD     Y  +++     
Sbjct: 503 AFGLDFALIESDSDFSLFNTTTGIFRPSLTFPVSENGRLSLFYD---ASYDEMTDYRGFS 559

Query: 561 SIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA 620
           S+  + +      S  I     Y+T    + P  G+L+S   ++AG GGD+++ +  +R 
Sbjct: 560 SVLRSEVARKGLWSSGIGYEYTYDTRRGGLDPNSGVLLSFGQEFAGLGGDTEFIKTNARV 619

Query: 621 -SYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKK 679
            +   +L+++  +  +L    G +    +  +  D+F   S+  +RGF   G+GP ++  
Sbjct: 620 IAQTMVLNEEVTLRATLE--GGALDFQKETSRAVDRF---SSQVMRGFEPNGMGP-IEGT 673

Query: 680 YAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA--NHVALGADKLEGNDSFW 737
             +GG  Y+ A     FP+ L PE  G+ G  F D  +++      A G  + +G  +  
Sbjct: 674 EHLGGDFYAVAKFEAEFPLGL-PEEYGISGGAFYDVGSIWGLDTRNATGLIRSKGFKA-- 730

Query: 738 RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQF 773
           R   GV + W SP G + + +   L    GD  Q F
Sbjct: 731 RHVVGVSMFWASPFGPLRLNWSTALEKEPGDIEQTF 766


>gi|260427307|ref|ZP_05781286.1| outer membrane protein assembly complex, YaeT protein [Citreicella
           sp. SE45]
 gi|260421799|gb|EEX15050.1| outer membrane protein assembly complex, YaeT protein [Citreicella
           sp. SE45]
          Length = 787

 Score =  300 bits (768), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 207/739 (28%), Positives = 354/739 (47%), Gaps = 18/739 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + I G   +    ILS   +  G  +S A+L+ A + I A G F  V+I    + L+I +
Sbjct: 51  VSIEGNQRIEPGTILSYAGIARGAPVSAAELNDAYQRIVASGLFETVEILPQGNTLVIRV 110

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   +N + F GN  +KD+ L  IVRS+    Y       D  +I  AY   G ++  V
Sbjct: 111 VEYPTVNRIAFEGNRRIKDEDLAAIVRSQPRRVYSPSMAEQDAQSIADAYTQQGRISARV 170

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ Y I EG   +I  I FVGN+ YS  RL RV+  + +G   +  ++
Sbjct: 171 TPKLIRRSENRVDLVYEIFEGGVTEIERIGFVGNQAYSDGRLRRVLETKQAGLLRAIIRS 230

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D Y ++R++FD + ++ FY  RGY   +++       +++  Y + F I+EG+ +  GNI
Sbjct: 231 DTYIEDRIAFDRQLLQDFYASRGYVDFRITGVNSELAQERDAYFVTFNIEEGQQFNFGNI 290

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           S++S L E+        + ++ G +Y+P  ++    ++ +        FVR++ R+ R+ 
Sbjct: 291 SVESDLAEVNVPLFRDALTVKPGKVYSPSVVENQIARLERLAVEEGLQFVRIEPRVTRNE 350

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+ + + +G  ++V+RI+IEGN  + D VIRR+ + +EGDP N   I ++  RI 
Sbjct: 351 RNLTLDVSFHLTRGPRIFVERIDIEGNTTTLDRVIRRQFDTAEGDPFNPRAIRQSAERIR 410

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A GYFS+  +     +     VI+ V+V +   GS+G   +Y    G+G      + NF 
Sbjct: 411 ALGYFSDAQVDAREGS-TPQQVIVDVNVTEQPTGSIGFGGSYSTTSGIGASISFGETNFL 469

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGF--DLQKTHLEDGSLDINDESAA 526
           G+G    L       +  +Y F+  +PYFLG  ++ G     ++T  E    D       
Sbjct: 470 GRGQALSLGVNTA-SSSSSYNFNFVEPYFLGRDLAFGLGASYRETDNEYAEFDTRRGQFR 528

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
                PI+E+   S +Y L +       + +    I     +  +F S S+  +  Y+T 
Sbjct: 529 PSFSFPISENGRLSLRYTLGYSDIRNTEDGDAGQVIRAEEEDGARFDS-SLGYTFSYDTR 587

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPS 646
              + P  G+L+    D  G GGD+ + +   RA     + ++ +I     F  G +  S
Sbjct: 588 RTGLNPNAGVLLEFGQDLGGVGGDTTFIKTNVRAIAQTRVWNE-EITLRASFEGGALNYS 646

Query: 647 NKNLQLFDQFSVSSNYYLRGFAYKGIGPRV-----DKKYAIGGKIYSSASAAVSFPMPLV 701
           N + ++ D++ +S +  LRGF Y GIGPR      D   ++GG  Y+ A     FP+ L 
Sbjct: 647 NGSSRVTDRYLLSDS-TLRGFEYGGIGPREYSAADDVDDSLGGDYYAVARFEAEFPLGL- 704

Query: 702 PERAGLRGAFFVDSATLYA---NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
           PE  G+ G  F D  +++    + V    + +   D   R   G  I+W+S LG + + +
Sbjct: 705 PEEYGISGGLFYDMGSVWGLEDSTVNSTTNDVLYQDFSLRHVVGFSILWDSALGPLRLDF 764

Query: 759 GIPLRHREGDKIQQFGFRI 777
              L+  + DK Q F F I
Sbjct: 765 SKALKKEKRDKEQNFSFTI 783


>gi|295689590|ref|YP_003593283.1| outer membrane protein assembly complex YaeT protein [Caulobacter
           segnis ATCC 21756]
 gi|295431493|gb|ADG10665.1| outer membrane protein assembly complex, YaeT protein [Caulobacter
           segnis ATCC 21756]
          Length = 787

 Score =  298 bits (764), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 210/753 (27%), Positives = 370/753 (49%), Gaps = 23/753 (3%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
           T +V+RI ++G   + +  +LS +P+  G ++    LD A+K +     F++VKI++   
Sbjct: 41  TGLVQRIVVQGNERIEQGTVLSYLPIQPGDTVDSQRLDLALKTLARTDLFADVKIEMQGG 100

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            L++ ++E  IIN + F GN++LK+D+LK  V+ R    +    V ADV  I + Y   G
Sbjct: 101 DLVVRVVENPIINQVVFEGNSSLKEDKLKDEVQIRPRGIFTRAKVQADVQRIIELYRRSG 160

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            ++  V  +   +    +++ + I EG K+ +  I F+GN  +S   L  VI  + S ++
Sbjct: 161 RISATVTPKVVELPQKRVDLVFEISEGPKSGVLGINFLGNAEFSDNDLRDVIVTKESHWY 220

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEI 282
            F    D Y  +R+ +D E +R FY +RGY   +V S V      K+G+ + + +DEG  
Sbjct: 221 KFLTSNDNYDPDRIEYDREQLRKFYRNRGYFDFRVISSVAELAPDKNGFAVTYTLDEGPK 280

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y  G +++++ L+++    L  ++ IR+G LY  ++I+++++ ++    +    FV V+ 
Sbjct: 281 YKFGKVTVETELKKLDGNLLAQILPIRAGQLYEDEKIEQATDALTFAAGAAGFAFVDVRP 340

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           R   +   + VD+ + + +G  +YV RI+I GN ++ D V+RRELE++EGD  N  +++R
Sbjct: 341 RYVPNRETKTVDVVFQVREGPRVYVDRIDIVGNTRTLDYVLRRELEVAEGDAYNRVLVDR 400

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K  I   G+F EV I     +   D   LRV V++   G +  +  Y     + ++  I
Sbjct: 401 SKNNIRRLGFFKEVEIDDTQGS-APDRTSLRVKVEEQPTGELSFSAGYSSVDKLVLDVGI 459

Query: 463 DDNNFFGQG--YRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQ--KTHLED-GS 517
            + NF G+G  +RAR + G  R  V    F   +P FLG  + AG +L   +  L D  +
Sbjct: 460 TERNFRGRGQNFRARASVGSLRQQVD---FGFSEPRFLGRNLVAGVNLYTFRYDLSDYAA 516

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTL-IEHGKFSSHS 576
            D       +R   P+T   S S +Y +R              S+   L ++ G + +  
Sbjct: 517 YDTKSVGGDIRFGFPLTNDASMSLRYTVRQDDVSVADSLCTSGSVSQILCLQRGAYITSM 576

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           I   +  +  ++PI P +G     + D AG GGD +Y +  + A +++  + D     + 
Sbjct: 577 IGYGLRIDKRNDPINPTRGWFADLNQDLAGIGGDVKYLKTEADAGWYWGFTKDLVFSATG 636

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR--VDKKYAIGGKIYSSASAAV 694
            FGY        N+++ D+F      + RGF   GIGPR       ++G K+Y+ ++  +
Sbjct: 637 SFGY-IQGWGGDNVRINDRFYRGGTSF-RGFEIAGIGPRDVSSTNNSLGAKLYAISTFEL 694

Query: 695 SFPMPLVPERAGLRGAFFVDSAT---LYANHVALGADKLEGN--DSF-WRVSTGVEIMWN 748
           + P   +PE+ G++ A F D  T   L        A   + N  D+   R + G+ I W 
Sbjct: 695 TIPT-FLPEQYGIKAALFSDVGTAGLLDDEDRQSSAGVFDPNIKDNLGLRATAGISIDWK 753

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           SP+G +       L     D+ + F F    R 
Sbjct: 754 SPMGPIRFDISRILAKESYDRTETFRFSTSTRF 786


>gi|225024879|ref|ZP_03714071.1| hypothetical protein EIKCOROL_01767 [Eikenella corrodens ATCC
           23834]
 gi|224942359|gb|EEG23568.1| hypothetical protein EIKCOROL_01767 [Eikenella corrodens ATCC
           23834]
          Length = 798

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 208/772 (26%), Positives = 365/772 (47%), Gaps = 44/772 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I I G        +L  +PV VG + +D + +  +KN+YA G F +V+++ + + ++
Sbjct: 27  IQDIRIEGLQRTDPSTVLGHLPVKVGSTFTDGEGEQIIKNLYATGLFDDVRVETMGNQVL 86

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAYDEDTVNADVHNIKQAYASIG 164
           + ++ER IIN L  +G   L  D +K  + S     +  +++  +N  V  ++Q YA+ G
Sbjct: 87  LTVVERPIINTLTVTGGKTLPSDAIKKNLDSFGLGQSQPFNQSILNQAVAGLQQEYANQG 146

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            L+  +  +   +S   ++IT  I+EG    I  I F GN+++S+  L R + +   G  
Sbjct: 147 KLSATITPEISRLSRNRVDITLKIDEGPTTHIKEIDFEGNQHFSNRTLRRQMQMDRHGML 206

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVS-SQVLFDKQKSGYVLIFQIDEGEI 282
           S+  K D +S E+   D ++I  FY + G+   +V  + V ++  ++   L  ++ EGE 
Sbjct: 207 SWLSKDDRFSDEKFRQDLQSITDFYQNEGFFEGRVQDADVRYNADRTEQTLWIKVHEGER 266

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y  G + I+   +E+ ++ L +L+++R G  YN  ++ ES + I            +V  
Sbjct: 267 YRWGKVRIEGDTREVPREELEALLKMREGRRYNRSQMVESLQAIQDRMGQAGYALAQVGV 326

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   D A  IVD    ++ G   YV +I I GN+++ D+VIRRE+  +E  P + + + R
Sbjct: 327 QPQPDQANHIVDFVLTVNPGRKYYVNQIHISGNNKTRDAVIRREMRQTEAAPYDSAKLNR 386

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K RI   GYF +V +   P  D  D V + VSVK+ S GSV +A  +  D G+ +   +
Sbjct: 387 SKDRIQLLGYFDDVKVETRPLPDTPDQVDVDVSVKERSTGSVEVAAGWVQDTGLVLSAGV 446

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNY-TFSVEDPYFLGSPISAGFDL---------QKTH 512
             +N FG G  A      G+   QN  + S  DPYF    +S G+D+           + 
Sbjct: 447 AQDNLFGTGKSANFRIARGK--TQNTASLSFTDPYFTPDGVSLGYDIYYRGFMPYKSSSS 504

Query: 513 LEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI-EHGK 571
               + +        RM VP+TE    +F   +  L      +    P  Y   + EHG+
Sbjct: 505 SSSNNYETTRIGLGARMGVPVTEYDRVNFGLAVEHLNVKLHGDVNYQPYRYRQFLQEHGE 564

Query: 572 FSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD 629
             +  +  +I +  N  D+ + P +G   S + D    GGD +Y+ +     +F+ LS  
Sbjct: 565 -KNWILKGNIGWGRNKTDDALWPTRGYTTSVNADLGLPGGDLKYYILTHDQRWFFPLSKS 623

Query: 630 SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYA-------I 682
             ++     GY        ++  F+ F       +RG+    +GP+V + Y         
Sbjct: 624 FTLMLGGEVGYAGSYGGTSSVPFFNNFYGGGLGSVRGYESGSLGPKVYEIYGNSRNIVNY 683

Query: 683 GGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA----NHVALGADKLEGNDSFW- 737
           GG   + ASA + FP P V ++  +R + F D+ +++     N  A  +    G + ++ 
Sbjct: 684 GGTYKAYASAELLFPFPGVKDQRSVRLSVFADAGSVWDGKTYNTGAYSSANPYGTNGYYS 743

Query: 738 -----------RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                      R S G  + W SPLG M   +  P+R R+ D+IQ+F F++G
Sbjct: 744 QDHRSTFSNELRYSVGAALTWLSPLGPMKFSFAHPMRRRDNDQIQRFQFQLG 795


>gi|226941202|ref|YP_002796276.1| outer membrane protein [Laribacter hongkongensis HLHK9]
 gi|226716129|gb|ACO75267.1| probable outer membrane protein [Laribacter hongkongensis HLHK9]
          Length = 767

 Score =  297 bits (761), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 215/750 (28%), Positives = 356/750 (47%), Gaps = 26/750 (3%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +VR I + G        + + +P+ VG + +D     A+K ++A G+F +V+I+    V+
Sbjct: 25  VVRDIRVEGLQRTEPGTVFNYLPLKVGDTFTDTRAQDAIKALFATGFFDDVRIESESDVV 84

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASI 163
           I+ + ER ++  L  +G      DQLK  ++    A    +D+  ++  V  +K+ Y + 
Sbjct: 85  IVSVDERPVVAQLSITGAKEFDKDQLKKALKENGFAESRIFDQALLDQAVQELKRQYFTK 144

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G  +V +K     +    + +   I EG  A+I  I FVGN+ +S   L   + + T G+
Sbjct: 145 GKYSVEIKPTVTKLDRNRVAVALDISEGPAARIKRIDFVGNQAFSADDLSEQMQLATPGW 204

Query: 224 FS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGE 281
           FS F K D YS+++++ D E +RAFY ++GY    + S+QV     K    +   + EG+
Sbjct: 205 FSWFTKDDQYSRQKLTGDLEKLRAFYLNQGYFEFNIDSTQVSISPDKEDMFITVNVSEGK 264

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            YTV ++ +   +  + +  LL L+ ++ G+ +   +I +S   I+    +    F  + 
Sbjct: 265 KYTVSDVRLAGDMI-VPEAELLPLLVVKKGDTFTRDKITDSVTAITDRLGAEGYAFANIN 323

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
                D  K  V   + +D G   YV++I I GN ++ D VIRRE+   E    + + I+
Sbjct: 324 AVPEVDKEKGEVGFTFFVDPGRRTYVRKINIVGNTRTRDEVIRREMRQMEAGWYDAAKIK 383

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
           R+K R+   GYF++VN+      D +D V +   V +   G+V +   Y  D+G+ +   
Sbjct: 384 RSKERLDLLGYFTDVNVETPAVPDTADQVDVNFKVTEKPTGNVTLGAGYAQDEGLILSAG 443

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNY-TFSVEDPYFLGSPISAGFDLQKTHLEDGSLD- 519
           I  +NFFG G    ++A F    +  Y   S  DPYF    +S G+DL          D 
Sbjct: 444 ISQSNFFGSG--KAVSASFNTSKLNRYLNLSFTDPYFTNDGVSIGYDLYTRRYSPNKTDT 501

Query: 520 ----INDESAAVRMIVPITE--SISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFS 573
                +   AAVR   PITE  +I+TS   +   ++  A S     P  Y   +     +
Sbjct: 502 YQYQTDTTGAAVRFGFPITEYDTINTSLGVEQVKVKTFAGS-----PQRYKDYVNQFGDN 556

Query: 574 SHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           + +    + +  +T D+ + P KG +   + + A  G D QY RI +   +F+ LS    
Sbjct: 557 NLNYLAKVGWGRDTRDSFLWPTKGRVSRINLEVALPGSDIQYGRIVASQQFFWPLSKTFT 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSAS 691
           +  +   G      S  ++  F  F +     +RGF    IGPR +   A G    +  +
Sbjct: 617 LALNGEIGAVQSYGSTSSVPFFQNFYLGGIGSVRGFETGSIGPRDELNDAYGATRRAIVN 676

Query: 692 AAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGAD--KLEGNDSFWRVSTGVEIMWNS 749
           A V FP P + +   LR + FVD+ TL+    A  AD   L   D+  R STGV + W S
Sbjct: 677 AEVLFPFPGMKDDKTLRMSGFVDAGTLWGGDYATAADGKPLSWQDNL-RYSTGVALSWLS 735

Query: 750 PLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
           PLG M   +  PL+  EGD+IQ+F F +G 
Sbjct: 736 PLGPMKFSFAYPLKKEEGDQIQRFQFTLGT 765


>gi|255262892|ref|ZP_05342234.1| outer membrane protein assembly complex, YaeT protein
           [Thalassiobium sp. R2A62]
 gi|255105227|gb|EET47901.1| outer membrane protein assembly complex, YaeT protein
           [Thalassiobium sp. R2A62]
          Length = 777

 Score =  296 bits (759), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 212/777 (27%), Positives = 379/777 (48%), Gaps = 37/777 (4%)

Query: 24  QMGFIILFYAIFGLSAVYGSNTSIVR--RIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
           Q+G ++L   I   +  + +     R   ++++G   +    IL+   +  G+++S A L
Sbjct: 19  QIGAVVLMLVI---ATSHAAQAQAFRFNSVDVQGNQRIETATILTFAGITRGEAVSGAQL 75

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSA 141
           + A + I   G F +V ++    +L+I + E   IN + F GNN L D++L  +VRS+S 
Sbjct: 76  NDAAQRIRQTGLFESVDVQPQGGMLVIIVKEFPTINRINFEGNNRLSDEELGAVVRSQSR 135

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
             Y      ADV  I QAY + G ++  V  Q    S   +++ + + EG   +I  I F
Sbjct: 136 RVYSPTQAEADVSAITQAYVNDGRISATVTPQIIRRSDNRVDLVFEVFEGGVTEIERISF 195

Query: 202 VGNKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSS 260
           VGN  YS  RL RV++ + +G   +  + D +  +R+ FD++ +  FY  RGY    V +
Sbjct: 196 VGNSEYSDRRLRRVLATKQAGLLRAIVQRDTFVADRIEFDKQILTDFYRSRGYIDFNVQN 255

Query: 261 -QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
             V   +++  Y++ F + EG+ + VG++S+ S + E   +     +R+RSG +Y+P+ +
Sbjct: 256 VDVALTRERDAYLITFNVQEGQSFRVGDVSVFSEIAEADPQEFEDALRLRSGVVYSPEHV 315

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +  ++          FVRV+ RI+R+     +D+E+++ +G  ++V+RI+IEGN  + 
Sbjct: 316 DNAIARLEVLAIRKGLNFVRVEPRISRNDRDLTLDVEFVLTRGERIFVERIDIEGNSTTL 375

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D VIRR+  + EGDP N   I  +  RI A GYF+  ++ +       + VI+ V V + 
Sbjct: 376 DRVIRRQFRVVEGDPFNPRQIRASAERIRALGYFANADV-EAREGSTPNQVIVDVDVAEQ 434

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
             GS+    NY  D G G+     + NF G+G +          + Q   FS  +P FLG
Sbjct: 435 PTGSLSFGANYSSDGGFGLVASFSERNFLGRGQQLSFDLSTASSSRQ-LGFSFAEPSFLG 493

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAV--RMIVPITES--ISTSFKYDLRFLQYGAISE 555
             +   F +     ++ +   N E+  V   +  P++E+  +   + Y+ + L  GA  +
Sbjct: 494 RDLRFAFSIDYATTDNDNALYNTETFRVSPSLTFPVSENGRLQVRYSYESQSLS-GADVD 552

Query: 556 KEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
           +  I  ++    +    SS ++  +  Y++  +   P  G +     D+AG GGD  + +
Sbjct: 553 ESAI--VFAEAADGETLSSSALGYTYSYDSRRSGFNPTGGFVFRFGQDFAGLGGDQAFVK 610

Query: 616 IGSRA-SYFYLLSDDSDIV-----GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAY 669
               A +   +L+++  +      G+L FG G       + ++ D++ + S   +RGF  
Sbjct: 611 TSIFAGAETKVLNEEVTLRAIFEGGALTFGEG-------DSRVTDRYFLGSR-VMRGFEP 662

Query: 670 KGIGPR----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY-ANHVA 724
            GIGPR     D   A+GG  ++       FP+ L PE  G+ G  F+D  +++  +  +
Sbjct: 663 GGIGPRENDGADIDIALGGNYFTVVRLEADFPLGL-PEEYGISGGAFIDYGSVWDVSGRS 721

Query: 725 LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            GA+ L  ND   R   G+ I W++P+G +   +  PL   E D+ + F   I  R 
Sbjct: 722 TGANVLY-NDFTPRAVAGLSIFWDTPVGPLRFNFTEPLMAEEFDRPKSFDVTISTRF 777


>gi|221234929|ref|YP_002517365.1| outer membrane protein assembly factor [Caulobacter crescentus
           NA1000]
 gi|220964101|gb|ACL95457.1| outer membrane protein assembly factor [Caulobacter crescentus
           NA1000]
          Length = 787

 Score =  295 bits (756), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 206/752 (27%), Positives = 366/752 (48%), Gaps = 23/752 (3%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
           T +V+RI ++G   + +  +LS +P+  G ++    LD A+K +     F++VKI+++  
Sbjct: 41  TGVVQRILVQGNERIEQGTVLSYLPIQPGDTVDSQRLDLALKTLARTDLFADVKIEMLGG 100

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            L++ ++E  IIN + F GN++LK+D+LK  V+ R    +    V ADV  I + Y   G
Sbjct: 101 DLVVKVVENPIINQVVFEGNSSLKEDKLKDEVQIRPRGIFTRAKVQADVQRIIELYRRSG 160

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            ++  V  +   +    +++ + I EG K+ +  I F+GN  YS   L  VI  + S ++
Sbjct: 161 RISATVTPKVVELPQKRVDLVFEINEGAKSGVLGINFLGNAEYSDNDLRDVIVTKESRWY 220

Query: 225 S-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEI 282
                 D Y  +R+ +D E +R  Y +RGY   +V S V      K+G+ + + ++EG  
Sbjct: 221 KILTSNDNYDPDRIEYDREQLRKHYRNRGYFDFRVISSVAELAPDKNGFAVTYTLEEGPK 280

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y  G I++++ L+++    L  ++ +R+G LY  + I+++++ ++    +    FV V+ 
Sbjct: 281 YKFGKITVETELKKLDGNLLAQILPVRTGQLYEDERIEQATDALTFAAGAAGFAFVDVRP 340

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           R   +   + VD+ + + +G  +YV RI+I GN ++ D V+RRELE++EGD  N  +++R
Sbjct: 341 RYVPNRETKTVDVVFQVREGPRVYVDRIDIVGNTRTLDYVLRRELEVAEGDAYNRVLVDR 400

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K  +   G+F EV I   P +   D   LRV V++   G +  +  Y     + ++  I
Sbjct: 401 SKNNMRRLGFFKEVEIEDAPGS-APDRTSLRVKVEEQPTGELSFSAGYSSIDKLVLDVGI 459

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL---EDGSLD 519
            + NF G+G   R  A  G    Q   F   +P FLG  + AG +L        E  + D
Sbjct: 460 TERNFRGRGQNLRARASVG-SLRQQIDFGFSEPRFLGRNLVAGVNLYTFRYDLSEFAAYD 518

Query: 520 INDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTL-IEHGKFSSHSIS 578
                  VR   P+T   S S +Y +R  +           S+   L ++ G + +  I 
Sbjct: 519 TKSVGGDVRFGFPLTNDSSMSLRYTVRQDEVSVADSLCASGSVSQILCLQRGAYITSLIG 578

Query: 579 QSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRF 638
             +  +  ++PI P +G     + D AG GGD +Y +  + A +++  + D     +  F
Sbjct: 579 YGLRIDKRNDPINPTRGWFADLNQDLAGVGGDVKYLKTEADAGWYWGFTKDLVFSATGSF 638

Query: 639 GY--GCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKY-AIGGKIYSSASAAV 694
           GY  G       N+++ D+F      + RGF   GIGPR +   + ++G K+Y+ ++  +
Sbjct: 639 GYIEGW---GGDNVRINDRFYRGGTSF-RGFEIAGIGPRDISSSFNSMGAKLYAISTFEL 694

Query: 695 SFPMPLVPERAGLRGAFFVDSATL-----YANHVALGADKLEGNDSF-WRVSTGVEIMWN 748
           + P   +PE+ G++ A F D  T           + G       D+   R S G+ I W 
Sbjct: 695 TVPT-FLPEQYGIKAALFSDVGTAGLLDDVDRQRSPGVFDPNIKDNLGLRASAGISIDWK 753

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           SP+G +       L   + D+ + F F    R
Sbjct: 754 SPMGPIRFDISRILSKEDYDRTETFRFSTSTR 785


>gi|162147929|ref|YP_001602390.1| outer membrane protein assembly factor yaeT [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786506|emb|CAP56088.1| Outer membrane protein assembly factor yaeT precursor
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 770

 Score =  295 bits (754), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 219/770 (28%), Positives = 359/770 (46%), Gaps = 45/770 (5%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           ++  I+I G   +    +LS + V  G   +   LD ++K +YA G F +V +    +VL
Sbjct: 9   VIESIDISGNDRIETNTVLSYMVVQPGDPFNQDQLDRSLKTLYATGLFRDVTLHRAGNVL 68

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYL 166
            + L+E  I+N + F GN+  KD+ L+ ++  R  A +   T  AD   I   YA     
Sbjct: 69  QVHLVENPIVNRIVFEGNHAAKDEDLRKVIALRPRAVFSTQTTAADRQKILGVYAEKARY 128

Query: 167 NVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS- 225
              V  Q   +S   +++ + I E  +  I  I FVGN+ +S ARL +V+S + + ++  
Sbjct: 129 AATVTPQIIRLSHNRVDVVFQINEATQTLIKKISFVGNRAFSEARLAQVVSSKETAWYRF 188

Query: 226 FGKTDVYSKERMSFDEEAIRAFYHDRGYA--AVKVSSQVLFDKQKSGYVLIFQIDEGEIY 283
           F  +D Y+ ER+ +D E +R FY   G+    VK ++  L   +KS YV  F +DEG  Y
Sbjct: 189 FASSDEYNPERLRYDGELLRRFYLRNGFVDFQVKNATGELSPDRKSFYV-TFTVDEGLRY 247

Query: 284 TVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTR 343
            +G ++I+S+L+ +   +L   I + +   Y+   ++ ++  + +       PF  V+  
Sbjct: 248 RLGRVNIRSSLKHVPAASLRKYIELFANQWYDGSAVQHNATDMEEILQGQGHPFAMVRPE 307

Query: 344 INRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERA 403
           I R+  KR VD+ + + +G  +YV+RI+I GN  + D VIRR L ++EGDP   S  + A
Sbjct: 308 IARNPEKRTVDLLFDVSEGPRVYVERIDINGNTITEDKVIRRNLPMAEGDPYTPSERKYA 367

Query: 404 KRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHID 463
           K  +   GYFS V+I Q P +   D + +  ++ +   G   +   Y  D G+     + 
Sbjct: 368 KAMLQDLGYFSSVSIDQSPGS-APDKINVAANLVEKPTGEFSLGGGYSTDVGILGNIGLK 426

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD---LQKTHLEDGSLDI 520
            +N  G G  A ++     +  Q    SV DPYFL   + AG D   +Q  +    +   
Sbjct: 427 QHNLLGSGVDAGISGTMAYYQRQA-DISVSDPYFLNRNMVAGVDIFAIQNNYQTYQNYSE 485

Query: 521 NDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQS 580
                + RM       +S SF Y L       I       S Y  L + G      +S +
Sbjct: 486 GRYGISFRMGYSYNNHLSQSFSYSLTDRD---IDNAYSDASWY-VLKQTGWSLLSQLSTT 541

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSD---DSDIVGSLR 637
           + Y+T DN + P  G ++  + D+AG GG+ +Y R    A+Y+  L D   + D   +L 
Sbjct: 542 LTYDTRDNRMNPHSGYVVRLAGDFAGIGGNERYLRGKLDAAYYIPLDDLMGNHDWTVALT 601

Query: 638 FGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----------------DKKY 680
            G G ++        + D F +  +  LRGF   G GPR                  ++ 
Sbjct: 602 AGAGDIVNWGGGRSDIIDNFYLGGS-TLRGFMDGGAGPRTMGIPAYTWQGVTYPMHSQED 660

Query: 681 AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFW--- 737
            +GG+   + SA V+FPMPL  +  G++G +FVD   L    +         +  ++   
Sbjct: 661 FLGGRFMYTGSATVNFPMPLAAD-MGIKGRYFVDMGGLDGLRIPRRYTAYPQDMPYYTPV 719

Query: 738 -------RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
                  RVSTGV   W SP G++ +  GIP+   + D+ Q F F  G +
Sbjct: 720 YSDTIKPRVSTGVGFSWKSPFGLINIDLGIPVLKEKHDRTQLFRFGFGQQ 769


>gi|16126158|ref|NP_420722.1| outer membrane protein [Caulobacter crescentus CB15]
 gi|13423368|gb|AAK23890.1| outer membrane protein [Caulobacter crescentus CB15]
          Length = 769

 Score =  295 bits (754), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 207/755 (27%), Positives = 369/755 (48%), Gaps = 27/755 (3%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
           T +V+RI ++G   + +  +LS +P+  G ++    LD A+K +     F++VKI+++  
Sbjct: 23  TGVVQRILVQGNERIEQGTVLSYLPIQPGDTVDSQRLDLALKTLARTDLFADVKIEMLGG 82

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            L++ ++E  IIN + F GN++LK+D+LK  V+ R    +    V ADV  I + Y   G
Sbjct: 83  DLVVKVVENPIINQVVFEGNSSLKEDKLKDEVQIRPRGIFTRAKVQADVQRIIELYRRSG 142

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            ++  V  +   +    +++ + I EG K+ +  I F+GN  YS   L  VI  + S ++
Sbjct: 143 RISATVTPKVVELPQKRVDLVFEINEGAKSGVLGINFLGNAEYSDNDLRDVIVTKESRWY 202

Query: 225 S-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEI 282
                 D Y  +R+ +D E +R  Y +RGY   +V S V      K+G+ + + ++EG  
Sbjct: 203 KILTSNDNYDPDRIEYDREQLRKHYRNRGYFDFRVISSVAELAPDKNGFAVTYTLEEGPK 262

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y  G I++++ L+++    L  ++ +R+G LY  + I+++++ ++    +    FV V+ 
Sbjct: 263 YKFGKITVETELKKLDGNLLAQILPVRTGQLYEDERIEQATDALTFAAGAAGFAFVDVRP 322

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           R   +   + VD+ + + +G  +YV RI+I GN ++ D V+RRELE++EGD  N  +++R
Sbjct: 323 RYVPNRETKTVDVVFQVREGPRVYVDRIDIVGNTRTLDYVLRRELEVAEGDAYNRVLVDR 382

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K  +   G+F EV I   P +   D   LRV V++   G +  +  Y     + ++  I
Sbjct: 383 SKNNMRRLGFFKEVEIEDAPGS-APDRTSLRVKVEEQPTGELSFSAGYSSIDKLVLDVGI 441

Query: 463 DDNNFFGQG--YRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL---EDGS 517
            + NF G+G   RAR + G  R  +    F   +P FLG  + AG +L        E  +
Sbjct: 442 TERNFRGRGQNLRARASVGSLRQQID---FGFSEPRFLGRNLVAGVNLYTFRYDLSEFAA 498

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTL-IEHGKFSSHS 576
            D       VR   P+T   S S +Y +R  +           S+   L ++ G + +  
Sbjct: 499 YDTKSVGGDVRFGFPLTNDSSMSLRYTVRQDEVSVADSLCASGSVSQILCLQRGAYITSL 558

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           I   +  +  ++PI P +G     + D AG GGD +Y +  + A +++  + D     + 
Sbjct: 559 IGYGLRIDKRNDPINPTRGWFADLNQDLAGVGGDVKYLKTEADAGWYWGFTKDLVFSATG 618

Query: 637 RFGY--GCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKY-AIGGKIYSSASA 692
            FGY  G       N+++ D+F      + RGF   GIGPR +   + ++G K+Y+ ++ 
Sbjct: 619 SFGYIEGW---GGDNVRINDRFYRGGTSF-RGFEIAGIGPRDISSSFNSMGAKLYAISTF 674

Query: 693 AVSFPMPLVPERAGLRGAFFVDSATL-----YANHVALGADKLEGNDSF-WRVSTGVEIM 746
            ++ P   +PE+ G++ A F D  T           + G       D+   R S G+ I 
Sbjct: 675 ELTVPT-FLPEQYGIKAALFSDVGTAGLLDDVDRQRSPGVFDPNIKDNLGLRASAGISID 733

Query: 747 WNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           W SP+G +       L   + D+ + F F    R 
Sbjct: 734 WKSPMGPIRFDISRILSKEDYDRTETFRFSTSTRF 768


>gi|67459513|ref|YP_247137.1| Outer membrane protein omp1 [Rickettsia felis URRWXCal2]
 gi|67005046|gb|AAY61972.1| Outer membrane protein omp1 [Rickettsia felis URRWXCal2]
          Length = 768

 Score =  293 bits (751), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 211/756 (27%), Positives = 371/756 (49%), Gaps = 33/756 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++R+I I G   V +  I S + + VG++ +++  D A+KN+YA   F N+ I I  + 
Sbjct: 26  SVIRKITIEGNHRVERSTIESYLKLKVGETYNNSKEDEAIKNLYATSLFRNINIHITNEG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  NLIVNVTETPFISSVVFSGNSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +  ++    + + + I EG K  I  I F GN+NYS + L+ ++  + S +F
Sbjct: 146 RFATTVTPKIENLENNRVKVIFDIAEGPKTGIKYIYFSGNENYSDSELKSIVLTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +R+ +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRVEYDKELLREFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GN++I + L  I    L  ++ I+ G ++N + + E +EKI +YF +   P V V  
Sbjct: 266 YSFGNVTIDNKLTNINITPLNKIVNIKQGKVFNMKTVDEIAEKIGEYFTANGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y+ +I I  N ++ D VIRRE +  EGD IN S IE+
Sbjct: 326 DIMKN-ANHTADIKFIIEKADKVYINKINIINNLKTEDHVIRREFKTEEGDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 385 GERNLRNLDYFEKVAISLAPTKAKDKYDV-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          +++   Y   + +P+FL   +S G +  + +   G+  L+ 
Sbjct: 444 LERNLVGTGKLLNAGVQVSKNSTSYYG-GITEPHFLDRDLSLGVNAFRNYTGRGASVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGK 571
            D+S  +  I      + TS  Y+++          ++   +S      SI+    + G+
Sbjct: 503 TDQSYKLHSI-----GVKTSLGYEIKEDLGHEIDYLIKRDILSAPSPSSSIFLNE-QMGR 556

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y +      Y+     +  
Sbjct: 557 FITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKL 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
            +     G        K +++ D+F++  +Y LRGFA  G+GPR       +GG+ Y + 
Sbjct: 617 TLKLSASGGDIAGLGGKIIRISDRFNL-GDYSLRGFASGGVGPREKVTNEGLGGERYYTF 675

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEI 745
           S  ++FP P VPE   L GA F+D  +++   V L   + +      ND   R S G   
Sbjct: 676 STELNFPTP-VPEEFNLTGAVFMDLGSVWG--VGLNKKQYQTPNGFYNDKSLRASVGFGF 732

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 733 IWVTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 768


>gi|209542547|ref|YP_002274776.1| outer membrane protein assembly complex, YaeT protein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530224|gb|ACI50161.1| outer membrane protein assembly complex, YaeT protein
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 804

 Score =  293 bits (749), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 218/770 (28%), Positives = 359/770 (46%), Gaps = 45/770 (5%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           ++  I+I G   +    +LS + V  G   +   LD ++K +YA G F +V +    +VL
Sbjct: 43  VIESIDISGNDRIETNTVLSYMVVQPGDPFNQDQLDRSLKTLYATGLFRDVTLHRAGNVL 102

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYL 166
            + L+E  I+N + F GN+  KD+ L+ ++  R  A +   T  AD   I   YA     
Sbjct: 103 QVHLVENPIVNRIVFEGNHAAKDEDLRKVIALRPRAVFSTQTTAADRQKILGVYAEKARY 162

Query: 167 NVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS- 225
              V  Q   +S   +++ + I E  +  I  I FVGN+ +S ARL +V+S + + ++  
Sbjct: 163 AATVTPQIIRLSHNRVDVVFQINEATQTLIKKISFVGNRAFSEARLAQVVSSKETAWYRF 222

Query: 226 FGKTDVYSKERMSFDEEAIRAFYHDRGYA--AVKVSSQVLFDKQKSGYVLIFQIDEGEIY 283
           F  +D Y+ ER+ +D E +R FY   G+    VK ++  L   +KS YV  F +DEG  Y
Sbjct: 223 FASSDEYNPERLRYDGELLRRFYLRNGFVDFQVKNATGELSPDRKSFYV-TFTVDEGLRY 281

Query: 284 TVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTR 343
            +G ++I+S+L+ +   +L   I + +   Y+   ++ ++  + +       PF  V+  
Sbjct: 282 RLGRVNIRSSLKHVPAASLRKYIELFANQWYDGSAVQHNATDMEEILQGQGHPFAMVRPE 341

Query: 344 INRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERA 403
           I R+  KR VD+ + + +G  +YV+RI+I GN  + D VIRR L ++EGDP   S  + A
Sbjct: 342 IARNPEKRTVDLLFDVSEGPRVYVERIDINGNTITEDKVIRRNLPMAEGDPYTPSERKYA 401

Query: 404 KRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHID 463
           K  +   GYFS V+I Q P +   D + +  ++ +   G   +   Y  D G+     + 
Sbjct: 402 KAMLQDLGYFSSVSIDQSPGS-APDKINVAANLVEKPTGEFSLGGGYSTDVGILGNIGLK 460

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD---LQKTHLEDGSLDI 520
            +N  G G  A ++     +  Q    SV DPYFL   + AG D   +Q  +    +   
Sbjct: 461 QHNLLGSGVDAGISGTMAYYQRQA-DISVSDPYFLNRNMVAGVDIFAIQNNYQTYQNYSE 519

Query: 521 NDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQS 580
                + RM       +S SF Y L       I       S Y  L + G      +S +
Sbjct: 520 GRYGISFRMGYSYNNHLSQSFSYSLTDRD---IDNAYSDASWY-VLKQTGWSLLSQLSTT 575

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSD---DSDIVGSLR 637
           + Y+T DN + P  G ++  + D+AG GG+ +Y R    A+Y+  L D   + D   +L 
Sbjct: 576 LTYDTRDNRMNPHSGYVVRLAGDFAGIGGNERYLRGKLDAAYYIPLDDLMGNHDWTVALT 635

Query: 638 FGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----------------DKKY 680
            G G ++        + D F +  +  LRGF   G GPR                  ++ 
Sbjct: 636 AGAGDIVNWGGGRSDIIDNFYLGGS-TLRGFMDGGAGPRTMGIPAYTWQGVTYPMHSQED 694

Query: 681 AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFW--- 737
            +GG+   + SA V+FPMPL  +  G++G +FVD   L    +         +  ++   
Sbjct: 695 FLGGRFMYTGSATVNFPMPLAAD-MGIKGRYFVDMGGLDGLRIPRRYTAYPQDMPYYTPV 753

Query: 738 -------RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
                  RVSTGV   W SP G++ +  GIP+   + D+ + F F  G +
Sbjct: 754 YSDTIKPRVSTGVGFSWKSPFGLINIDLGIPVLKEKHDRTRLFRFGFGQQ 803


>gi|110679823|ref|YP_682830.1| outer membrane protein, putative [Roseobacter denitrificans OCh
           114]
 gi|109455939|gb|ABG32144.1| outer membrane protein, putative [Roseobacter denitrificans OCh
           114]
          Length = 776

 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 206/734 (28%), Positives = 351/734 (47%), Gaps = 19/734 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + I G   +G   ILSR  +V GQSIS  +L+  ++ +   G F +V  +   + L I +
Sbjct: 43  VNIEGNARIGDSAILSRAGIVPGQSISAGELNAGLQRLQDSGLFESVDFEPRGNALNITV 102

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   IN + F GN  + D+ L   + S     ++      D   I  AYAS G +   V
Sbjct: 103 VEYPTINRINFEGNARIGDETLAAAIGSNERRVFNPAQAERDAALIADAYASEGRIAARV 162

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
                  S   +++ + I EG   +I  + F GN+ YS  RL RV+  + +G F +F ++
Sbjct: 163 TPTIIRRSDNRVDLIFEIFEGDNIEIERLSFTGNRVYSDRRLRRVLETKQAGLFRAFVRS 222

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D   ++R+ FD + +R FY  RGY   + +S      +++ GY L+F + EG+ + VG I
Sbjct: 223 DTLVEDRIEFDRQVLRDFYLSRGYVDFRTNSVNAELTEERDGYFLVFDVQEGQQFRVGEI 282

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ S L E         ++ RSG +Y+P  I+    ++ +        F+RV+ RI RD 
Sbjct: 283 TVASELAEADSDLYRETVKTRSGVVYSPTLIEADIARMERQAIIDGVDFMRVEPRITRDE 342

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +++EY++ +G  ++V+RI+IEGN  + D VIRR+    EGDP N   I  +  RI 
Sbjct: 343 RNLTINVEYVLTRGPRVFVERIDIEGNTTTLDQVIRRQFNSVEGDPFNPREIRESAERIR 402

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+FS   ++    +   D VI+ V V++   GS+    ++  + G+G      + NF 
Sbjct: 403 ALGFFSAAEVNAREGSS-PDQVIVDVDVEEQPTGSLSFGASFSTNDGIGFAIQFTERNFL 461

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESA--- 525
           G+G R  L         Q Y  +  +P FLG  +  G  L  +     ++  + + A   
Sbjct: 462 GRGQRLGLTLSTAEDD-QLYRVNFFEPAFLGRDVGFGLRLDVSESTSSTVTYDTDRAVLT 520

Query: 526 -AVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYN 584
            ++   V     +  ++KYD   ++    S+ +  P I    I+ G+  + SI    +Y+
Sbjct: 521 PSLSFPVGANSRLELNYKYDQSEMKDRG-SDSDNGP-IIGRDIDEGELVNSSIGYRYVYD 578

Query: 585 TLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR-ASYFYLLSDDSDIVGSLRFGYGCV 643
           +    + P  G L     D+AG GGD+ + R  ++      + ++D  +  +L  G    
Sbjct: 579 SRTTGLDPTAGYLFEFGQDFAGVGGDNTFIRTSAKVVGERKIFNEDVTLRATLE-GGALN 637

Query: 644 IPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---VDKKYAIGGKIYSSASAAVSFPMPL 700
             S  N +  D+F +S+N  +RGF   GIGPR      +  +GG ++ +A     FP+ L
Sbjct: 638 YQSGAN-RAVDRFLLSTN-TIRGFEPGGIGPRDLSESNEDPLGGNLFVAARFEAEFPVGL 695

Query: 701 VPERAGLRGAFFVDSATLY-ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            PE  G+ G  F D   L+  N V L   ++ G    +R   GV ++W +P+G +   + 
Sbjct: 696 -PEEYGITGGLFYDVGNLWDLNDVDLSGGRVVGESGSFRHVIGVSVLWETPVGPLRFNFS 754

Query: 760 IPLRHREGDKIQQF 773
             +R  + D+ Q F
Sbjct: 755 DAIRKEDFDREQTF 768


>gi|34580844|ref|ZP_00142324.1| outer membrane protein omp1 [Rickettsia sibirica 246]
 gi|28262229|gb|EAA25733.1| outer membrane protein omp1 [Rickettsia sibirica 246]
          Length = 768

 Score =  291 bits (745), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 211/756 (27%), Positives = 368/756 (48%), Gaps = 33/756 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++R I I G   V +  I S + + VG++ +++  D  +K +YA   F N+ + I  D 
Sbjct: 26  SVIRTITIEGNHRVERSTIESYLKLKVGETYNNSKEDEVIKRLYATSLFRNINMHITNDG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  NLIVNVTETPFISSVVFSGNSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +  ++    + + + I EG K  IN I F GN+NYS + L+ +I  + S +F
Sbjct: 146 RFATTVTPKIENLENNRVKVIFDIAEGPKTGINYIYFSGNENYSDSELKSIILTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +RM +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRMEYDKELLREFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GNI+I + L  I    L  ++ I+ G ++N +++ + +EKI +YF +   P V V  
Sbjct: 266 YSFGNITIDNKLTNIDITPLNKIVNIKQGKVFNMKKVNDIAEKIGEYFTANGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y+ +I I  N ++ D VIRRE ++ EGD IN S IE+
Sbjct: 326 DIMKN-ANHTADIKFIIEKADKVYINKINIINNLKTEDPVIRREFKIEEGDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y I  V V + S  S+G    Y    G+      
Sbjct: 385 GERNLRNLDYFEKVAISLAPTKAKDKYDI-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          ++    Y   +  P+FL   +S G +  + +   G+  L+ 
Sbjct: 444 LERNLVGTGQLLNAGVQVSKNTTSYYG-GITAPHFLDRDLSLGVNTFRNYTGRGASVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGK 571
            D+S  +  I      + TS  Y+++          ++   +S      SI+    + G+
Sbjct: 503 TDQSYKLHSI-----GVKTSLGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKE-QMGR 556

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y +      Y+     +  
Sbjct: 557 FITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKL 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
            +     G        K +++ D+F++  +Y LRGFA  G+GPR       +GG+ Y + 
Sbjct: 617 TLKLSASGGDIAGLGGKIIRISDRFNL-GDYSLRGFASGGVGPREKVTNEGLGGERYYTF 675

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEI 745
           S  ++FP P +PE   L G  F+D  +++   V L   + +      ND   R S G   
Sbjct: 676 STELNFPTP-IPEEFNLTGTVFMDLGSVWG--VGLNKKQYQTPNGFYNDKSLRASIGFGF 732

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 733 IWVTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 768


>gi|254487207|ref|ZP_05100412.1| outer membrane protein assembly complex, YaeT protein [Roseobacter
           sp. GAI101]
 gi|214044076|gb|EEB84714.1| outer membrane protein assembly complex, YaeT protein [Roseobacter
           sp. GAI101]
          Length = 749

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 201/735 (27%), Positives = 361/735 (49%), Gaps = 22/735 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           ++I G   +G   +LSR  +  G++IS   L+ A +N+ A G F  V I+   + L+I++
Sbjct: 17  VQINGNERIGDSAVLSRAGIARGRAISGGQLNDAYQNLLASGLFETVTIEPRGNTLVINV 76

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   IN + F GN  +KD+ L  ++ S     ++      D + I QAY++ G +   V
Sbjct: 77  VEYPTINRISFEGNARIKDEALAALIGSNERRVFNPSQAEKDANAIAQAYSNEGRIAARV 136

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-FGKT 229
           + +    S   +++ + + EG   +I  + FVGN+ YS  RL RV+  + +G F    K 
Sbjct: 137 QPKIIKRSQNRVDLVFEVFEGDNVEIERLSFVGNRVYSDRRLRRVLGTKQAGLFRRLVKR 196

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D +  ER   D E +R FY  RGY  +++S+      +++ GY + F + EG+ +  G +
Sbjct: 197 DTFVAERTDLDRELLRTFYLSRGYVDMRISAVNAQLTEERDGYFVQFNVQEGQQFNFGQL 256

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ ST+  +  +  + +I+ RSG +Y+P  ++    ++ +        F+RV+  I R+ 
Sbjct: 257 TVTSTINGVDAQDYMDVIKTRSGAVYSPSLVETDIARMERKAIRDGVDFLRVEPVITRNE 316

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+EY I +G  ++V+RI+IEGN  + D VIRR+ +  EGDP N   I  +  RI 
Sbjct: 317 RDLTLDVEYRITRGPRVFVERIDIEGNTTTLDRVIRRQFDSVEGDPFNPREIRASAERIR 376

Query: 409 ATGYF--SEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNN 466
           A GYF  +EVN  +       + +++ V+V++   GS+     +  + G+GV     ++N
Sbjct: 377 ALGYFETAEVNARE---GSSPEQIVVDVNVEEKPTGSLNFGGTFSSNDGVGVAISFAEDN 433

Query: 467 FFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQ--KTHLEDGSLDINDES 524
           F G+G +  L+      A + Y  S  +P  LG  ++ G +L   +T+    S D     
Sbjct: 434 FLGRGQKLSLSVSTATDA-RRYGLSFVEPSLLGRDVAFGLNLDYAETNSSFASFDTKRFI 492

Query: 525 AAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYN 584
               +  P++E+ + + +Y    L+    +     P I    I  G   + S+  +  Y+
Sbjct: 493 FQPSLSFPVSENGNLTLRYSYDDLEMIERTTPVNGPVIADD-ISAGAQVASSLGYTYSYD 551

Query: 585 TLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCV 643
           T    + P  G L+    D+AG GGDS++ +  ++      +L+++  +  SL    G +
Sbjct: 552 TRRTGLDPTAGYLVQFGQDFAGVGGDSKFIKTTAKVIGEKRILNEEVTLRASLE--GGAL 609

Query: 644 IPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYA----IGGKIYSSASAAVSFPMP 699
             S  N ++ D+F +  +  +RGF   GIGPR D+       +GG +Y  A     FP+ 
Sbjct: 610 AWSEGNNRVADRFLIGPS-VMRGFESGGIGPR-DQSAGFDDPLGGNMYVVARFEAEFPLG 667

Query: 700 LVPERAGLRGAFFVDSATLY-ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
           L PE  G+ G  F D   ++    V      + G    +R   G+ + W++P+G +    
Sbjct: 668 L-PEEYGIGGGVFYDVGNVWDLADVNYNGGTVVGESGSFRHVIGLSLFWDTPVGPLQFNV 726

Query: 759 GIPLRHREGDKIQQF 773
              L+  + D+ Q+F
Sbjct: 727 SKALKKEDFDQEQKF 741


>gi|239948526|ref|ZP_04700279.1| outer membrane protein assembly complex, YaeT protein [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922802|gb|EER22826.1| outer membrane protein assembly complex, YaeT protein [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 768

 Score =  290 bits (743), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 207/756 (27%), Positives = 366/756 (48%), Gaps = 33/756 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++R+I I G   V    I S + + VG++ +++  D A+K +YA   F N+ + I  + 
Sbjct: 26  SVIRKITIEGNHRVEHSTIDSYLKLKVGETYNNSKEDEAIKRLYATSLFRNINMHITNEG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  NLIVNVTETPFISSVVFSGNSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +  ++    + + + I EG K  I  I F GN+NYS + L+ ++  + S +F
Sbjct: 146 RFATTVTPKIENLENNRVKVIFDIAEGPKTGIKYIYFSGNENYSDSELKSIVLTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +R+ +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRVEYDKELLREFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GNI+I + L  I    L  ++ I+ G ++N +++ + +EKI +YF +   P V V  
Sbjct: 266 YSFGNITIDNKLTNIDITPLNKIVNIKQGKVFNMKKVDDIAEKIGEYFTANGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y  +I I  N ++ D VIRRE +  EGD IN S IE+
Sbjct: 326 DIMKN-ANHTADIKFIIEKADKVYTNKINIINNFKTEDHVIRREFKTEEGDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 385 GERNLRNLDYFEKVAISLAPTKAKDKYDV-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          ++    Y   + +P+FL   +  G +  + +   G+  L+ 
Sbjct: 444 LERNLVGTGKLLNAGVQVSKNTTSYYG-GITEPHFLDRDLLLGVNAFRNYTGRGASVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGK 571
            D+S  +  I      + TS  Y+++          ++   +S      SI+    + G+
Sbjct: 503 TDQSYKLHSI-----GVKTSLGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKE-QMGR 556

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y +      Y+     +  
Sbjct: 557 FITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKL 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
            +     G        K +++ D+F++  +Y LRGFA  G+G R       +GG+ Y + 
Sbjct: 617 TLKLSASGGDIAGLGGKIIRISDRFNL-GDYSLRGFASGGVGAREKVTNEGLGGERYYTF 675

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEI 745
           S  ++FP P VPE   L GA F+D  +++   V L   + +      ND   R S G   
Sbjct: 676 STELNFPTP-VPEEFNLTGAVFMDLGSVWG--VGLNKKQYQTPNGFYNDKSLRASVGFGF 732

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 733 IWVTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 768


>gi|254511067|ref|ZP_05123134.1| outer membrane protein assembly complex, YaeT protein
           [Rhodobacteraceae bacterium KLH11]
 gi|221534778|gb|EEE37766.1| outer membrane protein assembly complex, YaeT protein
           [Rhodobacteraceae bacterium KLH11]
          Length = 751

 Score =  290 bits (742), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 198/736 (26%), Positives = 358/736 (48%), Gaps = 17/736 (2%)

Query: 52  EIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLI 111
           E+ G   +    I++R  +  GQ+++   L+ A + +   G F  V++    + L+I++ 
Sbjct: 19  EVEGNRRIETSTIIARTGIEAGQTVTAGQLNDAFQRLLDSGVFETVELTPRGNTLVIEVE 78

Query: 112 ERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVK 171
           E   IN +   GNN +KDD L  ++ S++   +      AD   I + Y++ G ++  V 
Sbjct: 79  EYPTINQISIEGNNRVKDDVLLEVISSQTRRVFTPQAAEADADLIAEVYSAQGRVSATVI 138

Query: 172 VQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTD 230
            +    S   +++ + + EG   ++  + FVGN+ YS  RL RV+  + +    +F + D
Sbjct: 139 PRIIRRSDNRVDLIFEVAEGTTIEVERVSFVGNRAYSDRRLRRVLETKQANILRTFLRGD 198

Query: 231 VYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNIS 289
            +  +R+ FD++ +R FY  RGY   +V S+ V F +++  + L+  I EG+ ++ G IS
Sbjct: 199 TFIADRIEFDKQVLRDFYLSRGYVDFRVNSTNVEFTRERDAFFLVMNITEGQQFSFGQIS 258

Query: 290 IQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFA 349
             S ++ +        ++++ G +Y+P  ++ S  ++ +        F+RV+ R+ R+  
Sbjct: 259 TVSEIEGVDAAPYQEALKVKPGVIYSPSLVENSIARMERLGLKNGVDFLRVEPRVTRNPR 318

Query: 350 KRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMA 409
              +D+++++ +G  ++V+RI+IEGN  + D VIRR+ +  EGDP N   I ++  RI A
Sbjct: 319 DLTLDVQFVLTRGPRIFVERIDIEGNTTTLDRVIRRQFDTVEGDPFNPREIRQSAERIRA 378

Query: 410 TGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFG 469
            G+FS  ++     +  S  VI+ V V++   GS+ +  ++    G G+   + ++NF G
Sbjct: 379 LGFFSAADVQTREGSSPSQ-VIVDVDVEEQPTGSLSLGGSFSASDGFGIAVGLSESNFLG 437

Query: 470 QGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPI--SAGFDLQKTHLEDGSLDINDESAAV 527
           +G    +     + A Q Y+ +  +PY LG  +    G  L  T+    S D        
Sbjct: 438 RGQTLGVTLSTAQDAEQ-YSINFTEPYLLGRKLRFDLGLGLSTTNSSFASFDTKTVFFNP 496

Query: 528 RMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLD 587
           ++   I E  +   +Y     +       E   ++  + I  G+ +S S+  S +Y++  
Sbjct: 497 QISYAIGELSALRLRYGWERSEM-TQQNNETNGAVVASEIAQGERTSSSVGISYVYDSRL 555

Query: 588 NPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCVIPS 646
             + P  G+L  +  D AG GGD++Y +  +RA +   +L+++  +  SL  G       
Sbjct: 556 GGLNPTAGVLFEAGVDAAGLGGDNEYIQATARAIAQKRVLNEEVVLRASLELG-ALNWTG 614

Query: 647 NKNLQLFDQFSVSSNYYLRGFAYKGIGPR---VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
           +   +  D+F +  + + RGF   GIGPR     +  AIGG  Y  A     FP+ L PE
Sbjct: 615 DDFSRTIDRFVLGPSVF-RGFEPAGIGPRDLSNGQDDAIGGNYYWVARFESDFPLGL-PE 672

Query: 704 RAGLRGAFFVDSATLYA--NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
             GLRG  F D   LY   N    GAD +  N S   V  GV ++W +P G +   +   
Sbjct: 673 EFGLRGGVFYDVGNLYNIDNVDTAGADIVGANGSIRHV-VGVSVLWTTPFGPLRFNFSKA 731

Query: 762 LRHREGDKIQQFGFRI 777
           L+  E D  + F   I
Sbjct: 732 LKKEEFDNERNFDLTI 747


>gi|84500827|ref|ZP_00999062.1| outer membrane protein, OMP85 family protein [Oceanicola batsensis
           HTCC2597]
 gi|84390894|gb|EAQ03312.1| outer membrane protein, OMP85 family protein [Oceanicola batsensis
           HTCC2597]
          Length = 786

 Score =  290 bits (742), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 193/740 (26%), Positives = 356/740 (48%), Gaps = 19/740 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           +++ G   +    +LS   +  G++IS A+L+ A + + A G F  V+I      L+I++
Sbjct: 49  VQVDGNARIETGTVLSYAGIARGETISAAELNDAYQRLVASGLFETVEIVPRGGTLVINV 108

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   +N + F GN  L D+ L  +V+S+    +      +D   I +AY+  G ++  V
Sbjct: 109 VEYPTVNRVTFEGNRRLDDEALASVVQSKPRLVFSPTRAESDAARIAEAYSQEGRISARV 168

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ Y + EG   +IN I FVGN+ YS  RL RV+  + +G      + 
Sbjct: 169 TPRIIRRSDNRVDLVYEVFEGRNTEINRIGFVGNRVYSDRRLRRVLETKQAGLLRQLIRR 228

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D + ++R+ FD++ +R FY  RGY   + ++      +++  Y + F + EG+ +  G+I
Sbjct: 229 DTFQEDRLQFDQQVLRDFYLSRGYIDFRTTAVDAELARERDAYFVTFNVQEGQQFRFGDI 288

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ S       +    ++R+R G +Y+P  ++ +  ++          F+RV+ RI R+ 
Sbjct: 289 TVVSNYPAADAEAYEQVVRLRPGIVYSPNHVENAIARMENLAVREGLDFLRVEPRITRNE 348

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+E+++ +G  ++V+RI++EGN  + D V+RR+  + EGDP N   I  A  RI 
Sbjct: 349 RDLTLDVEFVLSRGPRVFVERIDVEGNTTTLDRVVRRQFRIVEGDPFNPRQIREAAERIR 408

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A  +F    ++    +   D V++ V V++ + GS+     Y  + G G+     + NF 
Sbjct: 409 ALNFFENTQVNAREGSS-PDRVVVDVDVEEKATGSLSFGGTYSTNSGFGLAISFSETNFL 467

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLE--DGSLDINDESAA 526
           G+G    L+   G  + +NY+ +  +P FLG  ++  FDL  T  E  +   D       
Sbjct: 468 GRGQSLFLSLA-GADSNKNYSLAFVEPAFLGRDVAFSFDLGVTETESFNAPYDTEVGEFG 526

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
           + +  P+ E       + L   +  A +  +   SI    I  G   S SI     +++ 
Sbjct: 527 LGLEFPLAERSRLGLTFSLESSEMKASTSGDAAGSIIQNEIGQGDVISSSIGYKYTFDSR 586

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCVIP 645
           +N   P +G L     DYAG GGD Q+    +RA +   +L+++  +  SLR   G +  
Sbjct: 587 ENGFDPTRGFLFEFGQDYAGLGGDVQFIETKARAVAQARILNEEVTVRASLR--GGMLNY 644

Query: 646 SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKK--------YAIGGKIYSSASAAVSFP 697
           +  + +  D+ ++  + YLRGF   G+GPR             A+ G ++   S    FP
Sbjct: 645 TKGSSRTIDRVNLLGD-YLRGFEPSGVGPRQRGTNSSGAAFDNALAGNMFVVGSVEAEFP 703

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
           + L PE  G+ G  F D + ++    + G   +  N+  +R   G+ + W++P+G +   
Sbjct: 704 LGL-PEEYGITGGAFYDISNIWDVGASAGQPGVLYNNGSYRHVVGLSVFWDTPIGPLRFN 762

Query: 758 YGIPLRHREGDKIQQFGFRI 777
           +   L+  + D+ Q F   I
Sbjct: 763 FAKALKKEQFDQEQFFNVTI 782


>gi|315499837|ref|YP_004088640.1| outer membrane protein assembly complex, yaet protein
           [Asticcacaulis excentricus CB 48]
 gi|315417849|gb|ADU14489.1| outer membrane protein assembly complex, YaeT protein
           [Asticcacaulis excentricus CB 48]
          Length = 800

 Score =  290 bits (741), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 208/750 (27%), Positives = 371/750 (49%), Gaps = 36/750 (4%)

Query: 50  RIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIID 109
           RI++ G   +    I+S +PV VGQ+++D  +D +VK +Y    FS+V+I +  + ++I 
Sbjct: 57  RIKVEGNERIDAATIISYLPVQVGQTVNDLLIDQSVKTLYRTELFSDVQIVMNGNEMVIS 116

Query: 110 LIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVM 169
           ++E  IIN + F GN+ L  D+L+  V  R    + +  V ADV  I + Y   G ++  
Sbjct: 117 VVEAPIINQVVFEGNSALSKDKLRDEVTIRPRGVFTKAKVQADVQRIIELYRRSGRISAT 176

Query: 170 VKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-FGK 228
           V  +   +    +++ + I+EGVK  + ++ FVGNK +S   L  V+  + S ++  F  
Sbjct: 177 VTPKIVELPQKRVDLIFEIDEGVKTGVENVNFVGNKAFSDNELAGVVVTKKSLWWKFFSS 236

Query: 229 TDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGN 287
            D Y  +RM +D E ++ FY +RGY   +V S V      +  +V+ + +DEGE Y  G 
Sbjct: 237 NDNYDPDRMDYDREQLKKFYTNRGYYDFRVVSAVAELTPDRKDFVITYTLDEGEKYNFGR 296

Query: 288 ISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRD 347
           + +++  +++  + L  ++ I+ G LY    I++S + ++         FV V+ R   +
Sbjct: 297 VVVKTENEKLNGENLQRMLPIQPGQLYESDLIEKSVDALTYAAGQAGFAFVDVRPRDEGN 356

Query: 348 FAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRI 407
              + VD+ + + +G+ +Y+ +I+I GN ++ D V+RRE+ +SEGD  N ++IER+K  +
Sbjct: 357 PETKTVDVTFNVREGARVYIDKIDIVGNARTLDRVVRREMLVSEGDAYNKALIERSKMFV 416

Query: 408 MATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNF 467
            A G+F +V I + P +   D   ++V V +   G +     +   +   ++  I + NF
Sbjct: 417 NALGFFKDVEIKETPGS-APDRTNIQVQVTEQPTGELSFGAGFSSYEKFILDVGITERNF 475

Query: 468 FGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDES--A 525
            G+G   R     G    +N   S  +P F+G  +SAG DL  +      +  + ++  A
Sbjct: 476 RGRGQNVRARVSLG-SIQKNVDLSFTEPRFMGRDVSAGIDLFSSSYNYSGVSYSSKTNGA 534

Query: 526 AVRMIVPITESISTSFKYDLRF--LQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIY 583
            +R+   +        +Y+LR   L Y   SE + +   Y+     G   + S+  ++ +
Sbjct: 535 GLRLGYSLNGYSILRLRYNLRSDELTYSGSSECDALQ--YSC----GNGVTSSVGYTLSF 588

Query: 584 NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCV 643
           +  ++ ++  +G       D+AG GGD++Y R      +++      D+V  L+   G +
Sbjct: 589 DRRNDYVLATRGWQAILRQDFAGLGGDTRYVRSELEGHWYHGFR--KDMVLHLQGIAGNI 646

Query: 644 IPSNKN-LQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSASAAVSFPMPLV 701
            P   + +++ D+F      + RGF   GIGPR  +  YA+GG+ Y+  +  +  P  L 
Sbjct: 647 TPVGGDAVRINDRFFKGGTTF-RGFENAGIGPRDTNSTYALGGETYAIGTVELGIPNGL- 704

Query: 702 PERAGLRGAFFVDSATL----------YANHVALG----ADKLE--GNDSFWRVSTGVEI 745
           PE+ GL+ A FVD  TL           A    LG      +L+   +D   R S GV I
Sbjct: 705 PEQYGLKTALFVDFGTLGGIDDRLKYCSATQATLGNCTAGTRLDYIKDDMSLRASAGVTI 764

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
            W SP+G +       L   + DK + F F
Sbjct: 765 RWKSPMGPIQFDISQILSREDYDKTETFRF 794


>gi|238650354|ref|YP_002916206.1| outer membrane protein assembly factor [Rickettsia peacockii str.
           Rustic]
 gi|238624452|gb|ACR47158.1| outer membrane protein assembly factor [Rickettsia peacockii str.
           Rustic]
          Length = 768

 Score =  289 bits (740), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 207/756 (27%), Positives = 369/756 (48%), Gaps = 33/756 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++R+I I G   V +  I   + + VG++ +++  D  +K +YA   F N+ + I  D 
Sbjct: 26  SVIRKITIEGNHRVERSTIERYLKLKVGETYNNSKEDEVIKRLYATSLFRNINMHITNDG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  NLIVNVTETPFISSVVFSGNSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
           +    V  +  ++    + + + I EG K  IN I F GN+NYS + L+ ++  + S +F
Sbjct: 146 HFATTVTPKIENLENNRVKVIFDIAEGPKTGINYIYFSGNENYSDSELKSIVLTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +RM +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRMEYDKELLREFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GNI+I + L  I    L  ++ I+ G ++N +++ + +EKI +YF +   P V V  
Sbjct: 266 YSFGNITIDNKLTNIDITPLNKIVNIKQGKVFNMKKVDDIAEKIGEYFTANGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y+ +I I  N ++ D VIRRE ++ E D IN S IE+
Sbjct: 326 DIMKN-ANHTADIKFIIEKADKVYINKINIINNLKTEDPVIRREFKIEESDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 385 GERNLRNLDYFEKVAISLAPTKAKDKYDV-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          ++    Y   +  P+FL   +S G ++ + +   G+  L+ 
Sbjct: 444 LERNLVGTGKLLNAGVQVSKNTTSYYG-GITAPHFLDHDLSLGVNIFRNYTGRGASVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGK 571
            D+S  +  I      + TS  Y+++          ++   +S      SI+    + G+
Sbjct: 503 TDQSYKLHSI-----GVKTSLGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKE-QMGR 556

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y +      Y+     +  
Sbjct: 557 FITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKL 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
            +     G        K +++ D+F++  +Y LRGFA  G+GPR       +GG+ Y + 
Sbjct: 617 TLKLSASGGDIAGLGGKIIRISDRFNL-GDYSLRGFASGGVGPREKITNEGLGGERYYTF 675

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEI 745
           S  ++FP P +PE   L G  F+D  +++   V L   + +      ND   R S G   
Sbjct: 676 STELNFPTP-IPEEFNLTGTVFMDLGSVWG--VGLNKKQYQTPNGFYNDKSLRASIGFGF 732

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 733 IWVTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 768


>gi|254459776|ref|ZP_05073192.1| outer membrane protein assembly complex, YaeT protein
           [Rhodobacterales bacterium HTCC2083]
 gi|206676365|gb|EDZ40852.1| outer membrane protein assembly complex, YaeT protein
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 782

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 212/781 (27%), Positives = 374/781 (47%), Gaps = 29/781 (3%)

Query: 9   RRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRI 68
           R +K  L K    S  +GF + + A   L+++  +       + I G   +    IL   
Sbjct: 15  RALKANLLKSSVASIALGFSVAYVA---LASIAEAQQYRFSSVAIEGNQRIEPSTILEYA 71

Query: 69  PVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLK 128
            +  G ++S +DL+ A + +   G F +V ++   + L+I + E   IN + F GN  LK
Sbjct: 72  GISRGTAVSGSDLNGAFQRLQGSGLFESVDLEPRGNRLVIKVTEYPTINQINFEGNRRLK 131

Query: 129 DDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVI 188
           D+ L  IV+S+S   ++  T   D   I +AY+  G L   V  +    S   +++ + I
Sbjct: 132 DENLSTIVQSQSRRVFNPSTAERDASEIAKAYSQQGRLTATVSPRIIRRSDNRVDLVFEI 191

Query: 189 EEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAF 247
            EG   +I  + FVGN+ YS +RL RV+  + +G   +F K D ++++R+ FD++ +  F
Sbjct: 192 FEGGLTEIERLGFVGNQVYSDSRLRRVLETKQAGLLRAFVKRDTFAEDRIEFDKQILSDF 251

Query: 248 YHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLI 306
           Y  RGY   + +S      +++ GY + F + EG+ +  G I+  S + +  +    + +
Sbjct: 252 YASRGYVDFRTTSVNAELARERDGYFVTFNVQEGQQFKFGAITTTSEISDADEAEFQAAL 311

Query: 307 RIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLY 366
           +IRSG +Y+P  ++ S  ++ +        FVRV+ RI R+     +D+E+ + +G  ++
Sbjct: 312 KIRSGIVYSPSLVENSIARLERLAIKLGLDFVRVEPRITRNDRDLTLDVEFALVRGPRVF 371

Query: 367 VKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDV 426
           V+RI+IEGN  + D V+R++ ++ EGDP N   I  +  R+ A GYFS  ++ Q      
Sbjct: 372 VERIDIEGNATTLDRVVRQQFKIVEGDPFNPREIRESAERVRALGYFSGADV-QAREGSS 430

Query: 427 SDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ 486
            D VI+ V V++ S GS+     Y    G G      ++NF G+G R  L    G    +
Sbjct: 431 PDQVIVDVDVEETSTGSLTFGGTYSTTTGPGAIIKYSESNFLGRGQRLDLGVTTGVDN-R 489

Query: 487 NYTFSVEDPYFLGSPISAGF--DLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYD 544
            Y+ S  +P FLG  +S GF     +T  ++   D N          P++++     +Y 
Sbjct: 490 EYSLSFYEPAFLGRDLSFGFVASYVETDNQNAVYDTNLGRFRPSFEFPVSDNGRMQVRYT 549

Query: 545 LRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
           L   +   +       ++ ++ I  G   S+S+  +  ++T    + P  G+L+    D+
Sbjct: 550 LDMSEM--VGGGTTAGALISSEIARGVEFSNSVGYTYSFDTRRTGLNPNAGVLLEFGQDF 607

Query: 605 AGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
            G G D+QY R  ++A +   +LS++  +  +L  G    +  +   +  D+F +  +  
Sbjct: 608 GGIGSDNQYVRTTAKAIAQTKVLSEEVTLRATLEGGALNYVTGSG--RATDRFFMGPS-V 664

Query: 664 LRGFAYKGIGPRV---DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           +RGF   GIGPR    +    +GG +++ A     FP+ L PE  G+ G  F D  +L++
Sbjct: 665 MRGFEPSGIGPREVNGNTNDTLGGNMFAVARFEAEFPLGL-PEEYGINGGVFYDIGSLWS 723

Query: 721 NHVALGADKLEGN----DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFR 776
                  D+   N    D   R   G  I W +P+G +   +   L    GD+ Q F   
Sbjct: 724 ------LDQSNANVINEDFAARSVIGASIFWKTPIGPLRFNFTKALSKETGDREQTFDLS 777

Query: 777 I 777
           I
Sbjct: 778 I 778


>gi|241760579|ref|ZP_04758671.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           flavescens SK114]
 gi|241318760|gb|EER55286.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           flavescens SK114]
          Length = 798

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 199/775 (25%), Positives = 357/775 (46%), Gaps = 48/775 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +DA  +  +K +YA G+F +V+++ +D+ ++
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDNFNDARSEEIIKKLYATGFFDDVRVETMDNQVL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I+ L  +G   L++D +K  + +   A    +++ T+N  V  +K+ Y S G
Sbjct: 85  LTVIERPTISSLNITGAKMLQNDAIKKNLEAFGLAQSQYFNQATLNQAVAGLKEEYLSRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
             +V +      ++   ++I   IEEG   KI  I F GN+ YS  RL + +S+   G +
Sbjct: 145 KQSVQITPTVTKLARNRVSIDIAIEEGKSTKITDISFEGNEVYSDRRLMKQMSLSEGGMW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  K++ +++++ + D E I  FY + GY   ++  + +  ++ K+   +   + EG+ 
Sbjct: 205 TWITKSNQFNEQKFAQDMEKITNFYQNNGYFNFRILDTDIQTNEDKTKQTIKVTVSEGDR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  GN+ I+    E+ K+ L  L+ ++ G  Y   ++  S E I          F  +  
Sbjct: 265 FRWGNVRIEGDTLEVPKEDLEKLLTMKPGKWYERAQMSNSLEAIQNRMGQAGYAFSEINV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +     VD    +  G  +YV  I I GN+++ D VIRREL   E  P + + ++R
Sbjct: 325 QPIPNAETHTVDFVLTVQPGRKIYVNEINITGNNKTRDEVIRRELRQMESAPYDSAKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P  +  D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPVANTPDQVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G    L A   +  V N + S  DPYF    +S G+DL       +K     
Sbjct: 445 AQDNLFGTGKSVALRASRSKTTV-NGSLSFTDPYFTPDGVSLGYDLYGKSYDPRKASSST 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                      +R+ +P+TE    +F      L    ++  +  P  Y   I        
Sbjct: 504 KQYKTTTFGGGLRIGIPVTEYDRVNFGLAAERL---TVNTYKGAPKRYADFINQYGKGDG 560

Query: 570 ---GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFY 624
              G F       +I +  N  DN + P +G L   + + A  G D QY+ +    ++F+
Sbjct: 561 SGVGNFKGWLYKGTIGWGRNKTDNALWPTRGYLTGVNGEIALPGSDLQYYTLTHNQTWFF 620

Query: 625 LLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKY 680
            LS D  ++     GYG      K +  F+ F       +RGF    +GP+V     +K 
Sbjct: 621 PLSKDFTLMLGGEVGYGNGYGKTKTMPFFENFYGGGLGSVRGFESGTLGPKVYDEYGEKI 680

Query: 681 AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY-----------------ANHV 723
           + GG   ++ SA + FPMP + +   +R + F D+ +++                  N  
Sbjct: 681 SYGGNKKANVSAELLFPMPGIKDSRTVRLSLFADAGSVWDGKTYNDGSSSNSNGVSQNVY 740

Query: 724 ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            +G        +  R S G  + W SPLG M   Y  P++ +EGD+IQ+F F++G
Sbjct: 741 GVGTTHKSTFKNELRYSAGAAVTWLSPLGPMKFSYAYPIKKKEGDEIQRFQFQLG 795


>gi|15892125|ref|NP_359839.1| outer membrane protein omp1 [Rickettsia conorii str. Malish 7]
 gi|15619252|gb|AAL02740.1| outer membrane protein omp1 [Rickettsia conorii str. Malish 7]
          Length = 768

 Score =  287 bits (735), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 208/756 (27%), Positives = 368/756 (48%), Gaps = 33/756 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++R+I I G   V +  I S + + VG++ +++  D  +K +YA   F N+ + I  D 
Sbjct: 26  SVIRKITIEGNHRVERSTIESYLKLKVGETYNNSKEDEVIKRLYATSLFRNINMHITNDG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  NLIVNVTETPFISSVVFSGNSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +  ++    + + + I EG K  IN I F GN+NYS + L+ ++  + S +F
Sbjct: 146 RFATTVTPKIENLENNRVKVIFDIAEGPKTGINYIYFSGNENYSDSELKSIVLTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +RM +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRMEYDKELLRDFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GNI+I + L  I    L  ++ I+ G ++N +++ + +EKI +YF +   P V V  
Sbjct: 266 YSFGNITIDNKLTNIDITPLNKIVNIKQGKVFNMKKVDDIAEKIGEYFTANGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y+ +I I  N ++ D VIRRE ++ EGD IN S IE+
Sbjct: 326 NIMKN-ANHTADIKFIIEKADKVYINKINIINNLKTEDPVIRREFKIEEGDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 385 GERNLRNLDYFEKVAISLAPTKAKDKYDV-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          ++    Y   +  P+FL   +S G +  + +   G+  L+ 
Sbjct: 444 LERNLVGTGKLLNAGVQVSKNTTSYYG-GITAPHFLDRDLSLGVNTFRNYTGRGASVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGK 571
            D+S  +  I      + TS  Y+++          ++   +S      SI+    + G+
Sbjct: 503 TDQSYKLHSI-----GVKTSLGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKE-QMGR 556

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F + +I  +I Y+  DN IVP+ G L+S + ++AG GG+++Y +      Y+     +  
Sbjct: 557 FITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGNNKYIKHEVDGKYYKSFIHNKL 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
            +     G        K +++ D+F++  +Y LRGFA  G+GPR       +GG+ Y   
Sbjct: 617 TLKLSASGGNITGLGGKIIRISDRFNL-GDYSLRGFANGGVGPREKVTNEGLGGERYYKF 675

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEI 745
           S  ++FP P +PE   L G  F+D  ++    V L   + +      ND+  R S G   
Sbjct: 676 STELNFPTP-IPEEFNLTGTVFMDLGSV--GGVGLNKKQYQTPNGFYNDTSLRASIGFGF 732

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 733 IWVTRFAPIRMDWGFPIKKKKYDDTQHFHLRFSTHL 768


>gi|114569938|ref|YP_756618.1| surface antigen (D15) [Maricaulis maris MCS10]
 gi|114340400|gb|ABI65680.1| surface antigen (D15) [Maricaulis maris MCS10]
          Length = 795

 Score =  287 bits (735), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 210/761 (27%), Positives = 380/761 (49%), Gaps = 49/761 (6%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +VR+I + G   V  + +LS + +  GQ      ++ +++ + A G FS+V+ +    ++
Sbjct: 46  LVRQILVEGNQRVEADTVLSYLLLQPGQPFDSRLVNLSIQTLMATGLFSDVQFEDRGQIV 105

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYL 166
           ++ + E  IIN +   GN+ + D+++   ++++  A +    V +DV  I + Y   G  
Sbjct: 106 LVRVQENPIINRVILEGNSAIDDEKITDEIQAQPRAIFTRSRVQSDVQRIIEVYRRSGRF 165

Query: 167 NVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF 226
              V  +        +++ + I EG    +  I  +GN++YS  RL R +  R S ++ F
Sbjct: 166 AATVTPKIVEQPQNRVDLIFEISEGPVTGVRRINIIGNESYSDRRLRRELVTRESRWWRF 225

Query: 227 -GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQV--LFDKQKSGYVLIFQIDEGEIY 283
               D Y  +R+ +D E +R FY ++GYA  +V S V  L   Q+  Y+ I  IDEGEIY
Sbjct: 226 FSSNDNYDPDRLEYDRELLRQFYSNQGYANFRVLSAVAELTPDQRDFYITI-TIDEGEIY 284

Query: 284 TVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTR 343
             G +++ + + ++    L +++ ++ G+L+  Q I++S + ++    +    FV ++  
Sbjct: 285 NFGEVTVSTEIPDLNPDFLQAILPVQEGDLFQGQLIEDSIDALTFSAGAAGYAFVNIRPL 344

Query: 344 INRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERA 403
             R+   R VD+E++ID+G  +Y++RI+I GN ++ D VIRREL++ EGD  N  +I+R+
Sbjct: 345 TTRNREDRTVDVEFVIDEGPRVYIERIDISGNTRTLDRVIRRELDIVEGDAFNQVLIDRS 404

Query: 404 KRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHID 463
           +  I   G+F EV + + P +   D   + V+V +   G +     +       ++  I 
Sbjct: 405 RNNIRRLGFFEEVEVEETPGS-APDRARVNVAVSEQPTGELAFGAGFSSTDSFLIDLSIS 463

Query: 464 DNNFFGQG--YRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTH---LEDGSL 518
           + N  G+G   R R++A   R ++        +P FL   ++AGFDL + +   L + S 
Sbjct: 464 ERNLRGRGQFLRFRISASSNRESLD---IRFTEPRFLDRNLAAGFDLFRVNSDFLSEASF 520

Query: 519 DINDESAAVRMIVPITESISTSFKYDLR---FLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
                 A++R+  P+T S +    Y  R    L Y + S           L + G  ++ 
Sbjct: 521 QTESTGASLRLGFPVTASTNLQLGYTYRTDNVLVYSSASS--------ALLNQAGSRATS 572

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRI---GSRASYFY--LLSDDS 630
            ++ ++ ++ L++PI P  G  +  +  +AG GGD +Y R    G+    F+  LL D  
Sbjct: 573 VLTYTLNWSRLNDPIEPSNGYRLQFTQGFAGIGGDVRYVRSEFNGAIYRPFFPGLLGD-- 630

Query: 631 DIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKK---------- 679
           D+V S     G V+P    ++++ D+F    N + RGF   GIGPR   +          
Sbjct: 631 DVVASFTMNGGFVLPWGGDSVRINDRFFKGGNSF-RGFEVAGIGPRAVSRDPDTGELIRG 689

Query: 680 YAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL----YANHVALGADKL-EGND 734
            A+GG++Y+  +  VSFP+ L PE+ G+RG+ F +  TL     A+ V  G + +   +D
Sbjct: 690 DALGGRLYAVGALEVSFPLGL-PEQYGVRGSLFTEFGTLGMLDSADQVDEGTNAVFTVDD 748

Query: 735 SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
              R S G+ I W+SP G +   +       + D+ + F F
Sbjct: 749 LALRASAGLSIFWDSPFGPVRFDFAQAFIREDYDRAEFFRF 789


>gi|157964227|ref|YP_001499051.1| Outer membrane protein omp1 [Rickettsia massiliae MTU5]
 gi|157844003|gb|ABV84504.1| Outer membrane protein omp1 [Rickettsia massiliae MTU5]
          Length = 768

 Score =  287 bits (735), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 208/756 (27%), Positives = 368/756 (48%), Gaps = 33/756 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++R+I I G   V +  I S + + VG++ +++  D A+K +Y    F N+ + I  D 
Sbjct: 26  SVIRKITIEGNHRVERSTIESYLKLKVGETYNNSKEDEAIKRLYTTSLFRNINMHITNDG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + F+GN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  HLIVNVTETPFISSVVFNGNSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +  ++    + + + I EG K  I  I F GN+NYS A L+ ++  + S +F
Sbjct: 146 RFATTVTPKIENLENNRVKVIFDIAEGPKTGIKYIYFSGNENYSAAELKSIVLTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +R+ +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRVEYDKELLREFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GNI+I + L  I    L  ++ I+ G ++N +++ + +EKI +YF +   P V V  
Sbjct: 266 YSFGNITIDNKLTNIDITPLNKIVNIKQGKVFNMKKVDDIAEKIGEYFTANGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y+ +I I  N ++ D VIRRE ++ EGD IN S IE+
Sbjct: 326 DIMKN-ANHTADIKFIIEKADKVYINKINIINNLKTEDHVIRREFKIEEGDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 385 GERNLRNLDYFEKVAISLAPTKAKDKYDV-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          ++    Y   +  P+FL   +S G +  + +   G+  L+ 
Sbjct: 444 LERNLVGTGKLLNAGVQVSKNTTSYYG-GITAPHFLDRDLSLGVNAFRNYTGRGASVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGK 571
            D+S  +  I      + TS  Y+++          ++   +S      SI+    + G+
Sbjct: 503 TDQSYKLHSI-----GVKTSLGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKE-QMGR 556

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y +      Y+     +  
Sbjct: 557 FITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKL 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
            +     G        K +++ D+F++  +Y LRGF   G+GPR       +GG+ Y + 
Sbjct: 617 TLKLSASGGDIAGLGGKIIRISDRFNL-GDYSLRGFTSGGVGPREKVTNEGLGGERYYTF 675

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEI 745
           S  ++FP P VPE   L GA F+D  +++   V L   + +      ND   R S G   
Sbjct: 676 STELNFPTP-VPEEFNLTGAVFMDLGSVWG--VGLNKKQYQTPNGFYNDKSLRASVGFGF 732

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 733 IWVTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 768


>gi|157828078|ref|YP_001494320.1| outer membrane protein omp1 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932778|ref|YP_001649567.1| outer membrane protein assembly factor [Rickettsia rickettsii str.
           Iowa]
 gi|157800559|gb|ABV75812.1| outer membrane protein omp1 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907865|gb|ABY72161.1| outer membrane protein assembly factor [Rickettsia rickettsii str.
           Iowa]
          Length = 768

 Score =  287 bits (734), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 208/756 (27%), Positives = 369/756 (48%), Gaps = 33/756 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++R+I I G   V +  I S + + VG++ +++  D  +K +YA   F N+ + I  D 
Sbjct: 26  SVIRKITIEGNHRVERSTIESYLKLKVGETYNNSKEDEVIKRLYATSLFRNINMHITNDG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  NLIVNVTETPFISSIVFSGNSKIKTNILAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +  ++    + + + I EG K  IN I F GN+NYS + L+ ++  + S +F
Sbjct: 146 RFATTVTPKIENLENNRVKVIFDIAEGPKTGINYIYFSGNENYSDSELKSIVLTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +R+ +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRIEYDKELLREFYQSVGFADFRVISALAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GNI+I + L  I    L  ++ I+ G ++N +++ + +EKI +YF +   P V V  
Sbjct: 266 YSFGNITIDNKLTNIDITPLNKIVNIKQGKVFNMKKVNDIAEKIGEYFTANGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y+ +I I  N ++ D VIRRE ++ EGD IN S IE+
Sbjct: 326 DIMKN-ANHTADIKFIIEKADKVYINKINIINNLKTEDPVIRREFKIEEGDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R I    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 385 GERNIRNLDYFEKVAISLAPTKAKDKYDV-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          ++    Y   +  P+FL   +S G ++ + +   G+  L+ 
Sbjct: 444 LERNLVGTGKLLNAGVQVSKNTTSYYG-GITAPHFLDRELSLGVNMFRNYTGRGASVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGK 571
            D+S  +  I      + TS  Y+++          ++   +S      SI+    + G+
Sbjct: 503 TDQSYKLHSI-----GVKTSLGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKE-QMGR 556

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y +      Y+     +  
Sbjct: 557 FITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKL 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
            +     G        K +++ D+F++  +Y LRGFA  G+GPR       +GG+ Y + 
Sbjct: 617 TLKLSASGGNIAGLGGKIIRISDRFNL-GDYSLRGFASGGVGPREKVTNEGLGGERYYTF 675

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEI 745
           S  ++FP P +PE   L    F+D  +++   V L   + +      ND   R S G   
Sbjct: 676 STELNFPTP-IPEEFNLISTVFMDLGSVWG--VGLNKKQYQTPNGFYNDKSLRASIGFGF 732

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 733 IWVTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 768


>gi|229586402|ref|YP_002844903.1| Outer membrane protein omp1 [Rickettsia africae ESF-5]
 gi|228021452|gb|ACP53160.1| Outer membrane protein omp1 [Rickettsia africae ESF-5]
          Length = 768

 Score =  287 bits (734), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 208/756 (27%), Positives = 368/756 (48%), Gaps = 33/756 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++R+I I G   V +  I S + + VG++ +++  D  +K +YA   F ++ + I  D 
Sbjct: 26  SVIRKITIEGNHRVERSTIESYLKLKVGETYNNSKEDEVIKRLYATSLFRSINMHITNDG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  NLIVNVTETPFISSVVFSGNSKIKTNMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +  ++    + + + I EG K  IN I F GN+NYS + L+ ++  + S +F
Sbjct: 146 RFATTVTPKIENLENNRVKVIFDIAEGPKTGINYIYFSGNENYSDSELKSIVLTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +RM +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRMEYDKELLREFYQSVGFADFRVISASAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GNI+I + L  I    L  ++ I+ G ++N +++ + +EKI +YF +   P V V  
Sbjct: 266 YSFGNITIDNKLTNIDITPLNKIVNIKQGKVFNMKKVDDIAEKIGEYFTANGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y+ +I I  N ++ D VIRRE ++ EGD IN S IE+
Sbjct: 326 DIMKN-ANHTADIKFIIEKADKVYINKINIINNLKTEDPVIRREFKIEEGDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 385 GERNLRNLDYFEKVAISLAPTKAKDKYDV-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          ++    Y   +  P+FL   +S G +    +   G+  L+ 
Sbjct: 444 LERNLVGTGKLLNAGVQISKNNTSYYG-GITAPHFLDRDLSLGVNTFSNYTGRGASVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGK 571
            D+S  +  I      + TS  Y+++          ++   +S      SI+    + G+
Sbjct: 503 TDQSYKLHSI-----GVKTSLGYEIKEDLGHEIDYLIKRDILSAPTPSSSIFLKE-QMGR 556

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y +      Y+     +  
Sbjct: 557 FITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKL 616

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA 690
            +     G        K +++ D+F++  +Y LRGFA  G+GPR       +GG+ Y + 
Sbjct: 617 TLKLSASGGDIAGLGGKIIRISDRFNL-GDYSLRGFASGGVGPREKVTNEGLGGERYYTF 675

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEI 745
           S  ++FP P +PE   L G  F+D  +++   V L   + +      ND   R S G   
Sbjct: 676 STELNFPTP-IPEEFNLTGTVFMDLGSVWK--VGLNKKQYQTPNGFYNDKSLRASIGFGF 732

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 733 IWVTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 768


>gi|225077045|ref|ZP_03720244.1| hypothetical protein NEIFLAOT_02097 [Neisseria flavescens
           NRL30031/H210]
 gi|224951602|gb|EEG32811.1| hypothetical protein NEIFLAOT_02097 [Neisseria flavescens
           NRL30031/H210]
          Length = 799

 Score =  287 bits (734), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 200/776 (25%), Positives = 361/776 (46%), Gaps = 49/776 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +DA  +  +K +YA G+F +V+++ +D+ ++
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDNFNDARSEEIIKKLYATGFFDDVRVETMDNQVL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I+ L  +G   L++D +K  + +   A    +++ T+N  V  +K+ Y S G
Sbjct: 85  LTVIERPTISSLNITGAKILQNDAIKKNLEAFGLAQSQYFNQATLNQVVAGLKEEYLSRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
             +V +      ++   ++I   IEEG   KI  I F GN+ YS  RL + +S+  SG +
Sbjct: 145 KQSVQITPTVTKLARNRVSIDIAIEEGKSTKITDISFEGNEVYSDRRLMKQMSLSKSGMW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  +Y + GY   ++  + +  ++ K+   +   + EG+ 
Sbjct: 205 TWITRSNQFNEQKFAQDMEKVTNYYQNNGYFNFRILDTDIQTNEDKTKQTIKVTVSEGDR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  GN+ I+    E+ K+ L  L+ ++ G  Y   ++  S E I          F  +  
Sbjct: 265 FRWGNVRIEGDTLEVPKEDLEKLLTMKPGKWYERAQMSNSLEAIQNRMGQAGYAFSEINV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +     VD    +  G  +YV  I I GN+++ D VIRREL   E  P + + ++R
Sbjct: 325 QPIPNAETHTVDFVLTVQPGRKIYVNEINITGNNKTRDEVIRRELRQMESAPYDSAKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P  +  D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPVANTPDQVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G    L A   +  V N + S  DPYF    +S G+DL       +K     
Sbjct: 445 AQDNLFGTGKSVALRASRSKTTV-NGSLSFTDPYFTPDGVSLGYDLYGKTYDPRKASSSA 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                      +R+ +P+TE    +F      L    ++  +  P  Y   I+       
Sbjct: 504 KQYKTTTFGGGLRIGIPVTEYDRVNFGLAAERL---TVNTYKVAPKRYADFIKQYGKGTD 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       +I +  N  DN + P +G L   + + A  G D QY+ +    ++F+ 
Sbjct: 561 GVGSFKGWLYKGTIGWGRNKTDNALWPTRGYLTGVNGEIALPGSDLQYYTLTHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS D  ++     GYG      K +  F+ F       +RGF    +GP+V     +K +
Sbjct: 621 LSKDFTLMLGGEVGYGNGYGKTKTMPFFENFYGGGLGSVRGFESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL--------------YANHVA--- 724
            GG   ++ SA + FPMP + +   +R + F D+ ++              Y N+ A   
Sbjct: 681 YGGNKKANVSAELLFPMPGIKDSRTVRLSLFADAGSVWDDKTYNDRSSNSYYTNNAAQNP 740

Query: 725 --LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
             LG        +  R S G  + W SPLG M   Y  P++ +EGD+IQ+F F++G
Sbjct: 741 YGLGKTHKSTFKNELRYSAGAAVTWLSPLGPMKFSYAYPIKKKEGDEIQRFQFQLG 796


>gi|329114462|ref|ZP_08243224.1| Outer membrane protein assembly factor YaeT [Acetobacter pomorum
           DM001]
 gi|326696538|gb|EGE48217.1| Outer membrane protein assembly factor YaeT [Acetobacter pomorum
           DM001]
          Length = 834

 Score =  286 bits (733), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 210/756 (27%), Positives = 362/756 (47%), Gaps = 37/756 (4%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           +  I + G T +    +LS +   VG   S  DLD ++K +YA G F +V ++   ++L+
Sbjct: 84  IEDIRVSGNTRIETNTVLSYMVARVGDPFSQDDLDRSLKTLYATGLFKDVTLRRDGNILL 143

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + L E  I+N + F GN+  KD+ L+ ++  R  A +  +T   D   I + YA      
Sbjct: 144 VRLKENPIVNRIVFEGNHAAKDEDLRKVLALRPRAVFSAETTADDRQRILEVYAQKARFA 203

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
            +V  Q   ++   +++ + I EG +  I+ I FVGNK YS + L  V+S + + ++ F 
Sbjct: 204 AVVTPQIIKLAHNRVDVVFQINEGPQTLISKIAFVGNKAYSESSLAGVVSSKETAWYHFL 263

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYA--AVKVSSQVLFDKQKSGYVLIFQIDEGEIYT 284
             +D Y+ ER+ +D E +R FY   G+    +K     L   +KS YV  F +DEG  Y 
Sbjct: 264 SSSDEYNPERIKYDAELLRRFYLRNGFVDFQIKDVKGELSPDRKSFYV-TFTMDEGVRYR 322

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
           +G + I+S+L+ +  K+L   + +     Y+ + +++++  + +   +   PF +V+  I
Sbjct: 323 LGKVDIRSSLRHVPAKSLRKYVELFPHQWYDGKAVQDNATDMEEILQAEGHPFAQVRPTI 382

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAK 404
            R+  KRIV++ + + +G   YV+RI++ GN  + D+V+RR+L  +EGDP   S  + AK
Sbjct: 383 ARNPEKRIVNLLFDVSEGPRHYVERIDVNGNTITQDNVVRRQLPFAEGDPYTTSYKKYAK 442

Query: 405 RRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDD 464
             +   G+F  V++S    +   D   + V+V +   G   +   Y  D G+     +  
Sbjct: 443 EAVQDLGFFKSVDVSTAQGS-TPDRTNVAVNVVEKPTGEFSLGGGYSTDVGVIGNVGLKQ 501

Query: 465 NNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL---QKTHLEDGSLDIN 521
           +N  G G  A  +    +   Q    S+ +P F+G  + AG D+   +  +    +    
Sbjct: 502 HNLLGTGVDAGFSGTVSQWQKQA-DISITNPAFMGRNLVAGADIFFVENNYQTYQNYSEG 560

Query: 522 DESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSI 581
                +RM       +S S+ Y L     G   ++    S Y  L + GK     +S ++
Sbjct: 561 RYGITLRMGYSYNRYLSQSWNYSLIRRWVGDTWDQ----SSYYVLDQKGKSLLSQLSTTL 616

Query: 582 IYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD---IVGSLRF 638
           +Y+T DN + P  G  +S   D+AG GGD +Y R     +Y+  L D ++       +R 
Sbjct: 617 MYDTRDNRMAPHSGYYVSVGGDFAGIGGDEKYVRGKVNGAYYVPLDDITNSHSWTFMVRG 676

Query: 639 GYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV------DKKYAIGGKIYSSAS 691
           G G +    N    + D F +  N  LRGF   G GPR         +  +GG+   +AS
Sbjct: 677 GAGYMADWGNGRHDIIDNFYLGGN-NLRGFLDGGAGPRSVGILNHSSEDLLGGRFMYNAS 735

Query: 692 AAVSFPMPLVPERAGLRGAFFVDSAT--------LYANHVALGA--DKLEGNDSFWRVST 741
           A ++FP+P + +  G+ G  FVD+ +        LY +    G     + G+    RVS 
Sbjct: 736 AQLNFPIPFLSD-MGIGGRAFVDTGSVAGLRVKRLYTSKANDGIYYTPVSGDTLRPRVSA 794

Query: 742 GVEIMWNSPLGMMGVYYGIPLRHREGDKIQ--QFGF 775
           G    W SP G++ +  G+P+     D+ Q  +FGF
Sbjct: 795 GAGFSWKSPFGLLNIDLGVPVMRSHNDRTQLLRFGF 830


>gi|258541752|ref|YP_003187185.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256632830|dbj|BAH98805.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635887|dbj|BAI01856.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638942|dbj|BAI04904.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641996|dbj|BAI07951.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645051|dbj|BAI10999.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648106|dbj|BAI14047.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651159|dbj|BAI17093.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654150|dbj|BAI20077.1| outer membrane protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 834

 Score =  286 bits (732), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 210/756 (27%), Positives = 360/756 (47%), Gaps = 37/756 (4%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           +  I + G T +    +LS +   VG   S  DLD ++K +YA G F +V ++   ++L+
Sbjct: 84  IEDIRVSGNTRIETNTVLSYMVARVGDPFSQDDLDRSLKTLYATGLFKDVTLRRDGNILL 143

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + L E  I+N + F GN+  KD+ L+ ++  R  A +  +T   D   I + YA      
Sbjct: 144 VRLKENPIVNRIVFEGNHAAKDEDLRKVLALRPRAVFSAETTADDRQRILEVYAQKARFA 203

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
            +V  Q   ++   +++ + I EG +  I+ I FVGNK YS + L  V+S + + ++ F 
Sbjct: 204 AVVTPQIIKLAHNRVDVVFQINEGPQTLISKIAFVGNKAYSESSLAGVVSSKETAWYHFL 263

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYA--AVKVSSQVLFDKQKSGYVLIFQIDEGEIYT 284
             +D Y+ ER+ +D E +R FY   G+    +K     L   +KS YV  F +DEG  Y 
Sbjct: 264 SSSDEYNPERIKYDAELLRRFYLRNGFVDFQIKDVKGELSPDRKSFYV-TFTMDEGVRYR 322

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
           +G + I+S+L+ +  K+L   + +     Y+ + +++++  + +   +   PF +V+  I
Sbjct: 323 LGKVDIRSSLRHVPAKSLRKYVELFPHQWYDGKAVQDNATDMEEILQAEGHPFAQVRPTI 382

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAK 404
            R+  KRIV++ + + +G   YV+RI++ GN  + D+V+RR+L  +EGDP   S  + AK
Sbjct: 383 ARNPEKRIVNLLFDVSEGPRHYVERIDVNGNTITQDNVVRRQLPFAEGDPYTTSYKKYAK 442

Query: 405 RRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDD 464
             +   G+F  V++S        D   + V+V +   G   +   Y  D G+     +  
Sbjct: 443 EAVQDLGFFKSVDVST-SQGSAPDRTNVAVNVVEKPTGEFSLGGGYSTDVGVIGNVGLKQ 501

Query: 465 NNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL---QKTHLEDGSLDIN 521
           +N  G G  A  +    +   Q    S+ +P F+G  + AG D+   +  +    +    
Sbjct: 502 HNLLGTGVDAGFSGTVSQWQKQA-DISITNPAFMGRNLVAGADIFFVENNYQTYQNYSEG 560

Query: 522 DESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSI 581
                +RM       +S S+ Y L     G   ++    S Y  L + GK     I  ++
Sbjct: 561 RYGITLRMGYSYNRYLSQSWNYSLIRRWVGDTWDQ----SSYYVLDQKGKSLLSQIGTTL 616

Query: 582 IYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD---IVGSLRF 638
           +Y+T DN + P  G  +S   D+AG GGD +Y R     +Y+  L D ++       +R 
Sbjct: 617 MYDTRDNRMAPHSGYYVSVGGDFAGIGGDEKYVRGKVNGAYYVPLDDITNSHSWTFMVRG 676

Query: 639 GYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV------DKKYAIGGKIYSSAS 691
           G G +    N    + D F +  N  LRGF   G GPR         +  +GG+   +AS
Sbjct: 677 GAGYMADWGNGRHDIIDNFYLGGN-NLRGFLDGGAGPRSVGILNHSSEDLLGGRFMYNAS 735

Query: 692 AAVSFPMPLVPERAGLRGAFFVDSAT--------LYANHVALGA--DKLEGNDSFWRVST 741
           A ++FP+P + +  G+ G  FVD+ +        LY +    G     + G+    RVS 
Sbjct: 736 AQLNFPIPFLSD-MGIGGRAFVDTGSVAGLRVKRLYTSKANDGIYYTPISGDTLRPRVSA 794

Query: 742 GVEIMWNSPLGMMGVYYGIPLRHREGDKIQ--QFGF 775
           G    W SP G++ +  G+P+     D+ Q  +FGF
Sbjct: 795 GAGFSWKSPFGLLNIDLGVPVMRSHNDRTQLLRFGF 830


>gi|15604035|ref|NP_220550.1| outer membrane protein OMP1 (omp1) [Rickettsia prowazekii str.
           Madrid E]
 gi|3860726|emb|CAA14627.1| OUTER MEMBRANE PROTEIN OMP1 (omp1) [Rickettsia prowazekii]
 gi|292571754|gb|ADE29669.1| Outer membrane protein omp1 [Rickettsia prowazekii Rp22]
          Length = 768

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 210/758 (27%), Positives = 374/758 (49%), Gaps = 39/758 (5%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DSV 105
           ++R+I I G   V +  I S + + VG++ +++  D A+K +YA   F N+ + I  D  
Sbjct: 27  VIRKITIEGNHRVERSTIESYLKLNVGETYNNSKEDEAIKRLYATSLFRNINMYITNDGN 86

Query: 106 LIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGY 165
           LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G 
Sbjct: 87  LIVNVTETPFISSVVFSGNSKIKTNILAKEIYTMSGESLSQAKIELDVKKILEIYKRSGR 146

Query: 166 LNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS 225
            +  V  +  S+    + + + I EG K  I SI F GN++YS + L+ ++  + S +F 
Sbjct: 147 FSTKVTPKIKSLENNRVKVIFDIAEGPKTVIKSIYFSGNEHYSDSELKSIVLTKESRWFR 206

Query: 226 FGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIY 283
           F ++ D Y  +R+ +D+E +R FY   G+A  +V S+ V  +  K  + + + I+EGE Y
Sbjct: 207 FLESNDTYDPDRVEYDKELLREFYQSVGFADFRVISASVALNDTKEYFTITYSIEEGEKY 266

Query: 284 TVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTR 343
             GN++I + L  I  K L  ++ I+ G ++N + + + +EKI +YF +   P V V   
Sbjct: 267 RFGNVTIDNKLTNINIKQLNKIVNIKQGKIFNMKTVDDIAEKIGEYFTANGYPAVNVYPD 326

Query: 344 INRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERA 403
           I ++      DI+++I++   +Y+ +I I  N ++ D VIRR  ++ EGD +N S IE+ 
Sbjct: 327 IKKN-DNHTADIKFIIEKADKVYINKINIINNLKTEDHVIRRAFKIEEGDVMNRSYIEKG 385

Query: 404 KRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHID 463
           +R +    YF +V+IS L      D   + V V + S  S+G    Y    G+       
Sbjct: 386 ERNLRNLDYFEKVSIS-LAQTKAKDKYDVNVEVDEKSTSSIGFDLGYNTAGGLFGRFSFL 444

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDIN 521
           + N  G G          +++   Y   + DP+FL   +S   +  + +   G+  L+  
Sbjct: 445 ERNLVGTGKLLNAGVQVSKNSTSYYG-CITDPHFLDRDLSLSVNAFRNYTGRGASVLNTT 503

Query: 522 DESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGKF 572
           D+S  +  I      +  S  YD++          ++   +S      SI+    + GK 
Sbjct: 504 DQSYKLHSI-----GVKISLGYDMKEDLSHEIDYLIKRDILSAPSPSNSIFLNE-QMGKL 557

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY--HRIGSRASYFYLLSDDS 630
            + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y  H I  +   FY    ++
Sbjct: 558 ITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGVGGDNKYIKHEIECK---FYKSFINN 614

Query: 631 DIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYS 688
            +   L    G +     K +++ D+F++  +Y LRGFA  G+GPR  +    +GG+ Y 
Sbjct: 615 KVTLKLSAAGGDMAGLGGKMVRISDRFNL-GDYSLRGFASGGVGPREKNTNEGLGGERYY 673

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGV 743
           + S  ++FP P VPE     GA F+D  +++   V L   + +      ND   R S G 
Sbjct: 674 TFSTELNFPTP-VPEEFNFTGAVFIDLGSVWG--VGLNKKQYKTPNGFYNDQSLRASVGF 730

Query: 744 EIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             +W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 731 GFIWVTRFAPIRMDWGFPIKKKQYDDTQNFHLRFSTHL 768


>gi|269213699|ref|ZP_05982655.2| outer membrane protein assembly complex, YaeT protein [Neisseria
           cinerea ATCC 14685]
 gi|269145530|gb|EEZ71948.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           cinerea ATCC 14685]
          Length = 805

 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 200/771 (25%), Positives = 355/771 (46%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I I G        + + +PV +G + +D      +K++YA G+F +V+++  D  L+
Sbjct: 38  IQDIRIEGLQRTEPSTVFNYLPVKIGDAYNDGRGGEIIKSLYATGFFDDVRVESADGQLL 97

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  SG   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 98  LTVIERPTIGSLNISGAKILQNDVIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 157

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   +S   ++I   I+EG  AKI  I F GN+ YS  +L R +S+  +G +
Sbjct: 158 KLNIQITPKVTKLSRNRVSIDITIDEGQSAKITDIEFEGNQVYSDRKLMRQMSLTEAGIW 217

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ ++ ++ + D E I  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 218 TWLTRSNQFNSQKFTQDMEKITDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGER 277

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++ E    I     S    +  +  
Sbjct: 278 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTEVLSAIQNRMGSAGYAYSEISV 337

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 338 QPLPNAETKTVDFILHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 397

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P  +  D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 398 SKERVELLGYFDNVQFDTVPLANTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 457

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 458 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 516

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                      VRM +P+TE    +F      L    ++   K P  Y   I+       
Sbjct: 517 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIKKYGKTNG 573

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  DN + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 574 ADGSFKGWLYKGTVGWGRNKTDNALWPTRGYLAGVNAEIALPGSKLQYYSATHNQTWFFP 633

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY----A 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V  +Y    +
Sbjct: 634 LSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGDKIS 693

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++ +     A+   GN+       
Sbjct: 694 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDDKTYTAAE--SGNNKSVYLEN 751

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 752 AHKSTFSNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKTEDEIQRFQFQLG 802


>gi|209964512|ref|YP_002297427.1| outer membrane protein, putative [Rhodospirillum centenum SW]
 gi|209957978|gb|ACI98614.1| outer membrane protein, putative [Rhodospirillum centenum SW]
          Length = 776

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 199/751 (26%), Positives = 359/751 (47%), Gaps = 32/751 (4%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           VR I I G   +    + S + V  G   +   +D ++K+++A G F++V ++     L+
Sbjct: 38  VREIRIEGTQRIEAATVRSYLTVQTGDPFNAERIDESLKSLFATGLFADVTLRREGGTLV 97

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           ++++E  IIN + F GN  +K D L   V+ R    Y    V  DV  I + Y   G   
Sbjct: 98  VNVVENPIINRVAFEGNRRVKTDDLVAEVQLRPRVVYTRTRVQNDVQRILEIYRRSGRFA 157

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
             V+ +   +    +++ + I+EG    +  I F+ N  +  + L  ++  + S ++ F 
Sbjct: 158 ARVEPKIVQLEQNRVDLIFEIDEGPLTGVQRINFINNNIFDDSDLRDIMLTKESRWWRFL 217

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
              D Y  +R+++D E IR  Y   GYA  +V S V      +  + +   +DEG+ Y  
Sbjct: 218 SSNDTYDPDRLNYDREQIRRHYLRNGYADFRVLSMVAELTPDREDFFITMTVDEGKRYKF 277

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G I IQS ++++  + L   I  +SG+ Y+   ++ S   +S      +  FV V   + 
Sbjct: 278 GEIKIQSDIKDLDGELLRPFILAQSGDWYDADRVESSINLLSDALGDLQYAFVEVDPLLQ 337

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           R+  +  +D+ + I+Q   ++V+RI+I GN ++ D VIRRE+ L+EGDP + + + R+++
Sbjct: 338 RNEEEGTIDLLFEINQSPRVFVERIDINGNVRTLDRVIRREMLLAEGDPFSITRVRRSEQ 397

Query: 406 RIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDN 465
           RI   G+F EV + +       D  ++ V V +   G + +   Y    G  V+  I + 
Sbjct: 398 RIKDLGFFEEVKV-EPKEGSTPDQSVITVEVSEQPTGEIQLGAGYSTTDGALVDFSIRER 456

Query: 466 NFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDG---SLDIND 522
           N  G+G   R +      + Q +  S  +PYF+   ++ G DL +   +D    + D+  
Sbjct: 457 NLLGRGQDLRFSTMLSTRS-QEFDVSFTEPYFMERDLAVGVDLFRVVRDDRDTITYDLES 515

Query: 523 ESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI---EHGKFSSHSISQ 579
               +R   P+++ +   F+Y L      + +  E + SIY +     + G  ++ SI Q
Sbjct: 516 TGIVLRAGYPLSDRLRQRFQYTL------SQNSIENV-SIYASRFIRDQAGTTTTSSIEQ 568

Query: 580 SIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFG 639
            + Y+  ++ + P  G  IS S ++AG GG  +Y R    A+ ++ +   SD V SL   
Sbjct: 569 LLFYDARNSRLRPTDGYFISLSNEFAGLGGSVRYLRNRLSAANYWNVY--SDWVLSLTGE 626

Query: 640 YGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---VDKKYAIGGKIYSSASAAVSF 696
            G ++   K++++ D+F +  +  LRGF   G+GPR        A+GGK +  A  ++  
Sbjct: 627 VGYILELGKDIRINDRFFLGGD-TLRGFEPGGVGPRDLTNGNDDALGGKRF--ARTSLEM 683

Query: 697 PMPLVPERAGLRGAFFVDSATL-------YANHVALGADKLEGNDSFWRVSTGVEIMWNS 749
            +PL  +  G+    F D+ TL       Y +        +  ++   R S GV + W S
Sbjct: 684 TVPLGSDEMGVLAHAFADAGTLGDSGLKPYVDPTDPTKSDVFRDEDALRASIGVGLSWKS 743

Query: 750 PLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           P G + +   +PL  ++ D+ +QF F  G R
Sbjct: 744 PFGPIRIDLAMPLAKQDYDRTEQFRFSFGTR 774


>gi|56696552|ref|YP_166909.1| OMP85 family outer membrane protein [Ruegeria pomeroyi DSS-3]
 gi|56678289|gb|AAV94955.1| outer membrane protein, OMP85 family [Ruegeria pomeroyi DSS-3]
          Length = 787

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 197/742 (26%), Positives = 356/742 (47%), Gaps = 18/742 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           +++ G   +    I+SR+ +  G++IS   L+ A + +   G F  V++    + L++ +
Sbjct: 53  VQVDGNQRIETSTIISRMGIERGKTISAGALNDAYQRLLDSGVFETVELIPRGNTLVVKV 112

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   IN + F GN  +KD+ L+  + S+S   +  +    D   I + Y++ G +   V
Sbjct: 113 VEHPTINRINFEGNRRVKDETLEGAIGSQSRRVFTPEQAERDAATIAEIYSTQGRVAATV 172

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + I EG   +I  + FVGN+ +S  RL R++  + +G+  +F ++
Sbjct: 173 VPRIIRRSDNRVDLVFEISEGDTIEIERVSFVGNRVFSDRRLRRILETKQAGFLRTFIRS 232

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D +  +R+ FD++ +R FY  RG+   +V S+ V F +++  + L+  + EG+ ++ G I
Sbjct: 233 DTFIADRIEFDKQVLRDFYLSRGHVDFRVNSANVEFTRERDAFFLVMDVTEGQQFSFGKI 292

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           +  S +  ++      +++I+ G +Y+P  ++ S  ++ +        F+RV+ RI R+ 
Sbjct: 293 TTVSEIPGVEAPAYQDVLKIKPGVVYSPSLVENSIARMERLGLKNGVDFLRVEPRITRND 352

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +DIE+ + +G  ++V+RI+IEGN  + D VIRR+    EGDP N   I  +  RI 
Sbjct: 353 RDLTLDIEFALVKGPRIFVERIDIEGNTTTLDQVIRRQFRTVEGDPFNPREIRESAERIR 412

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+F + N+     +  +  VI+ V V++   GS+    +Y V  G GV   + ++N+ 
Sbjct: 413 ALGFFGDANVETREGSTPAQ-VIVDVDVEEKPTGSLSFGGSYSVSDGFGVAIGLTEDNWL 471

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKTHLEDGSLDINDESAA 526
           G+G R  L     + A Q Y  S  +P  LG  +    DL    T+    S D      A
Sbjct: 472 GRGQRLGLTLSTAQDAEQ-YVLSFTEPQLLGRDLRFDIDLGVANTNSSFASYDTERAFFA 530

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
             +   + E  +   +Y     +    +      ++  + I  GK SS ++  +  Y++ 
Sbjct: 531 PGITFRLGELSTLQLRYRWEASEMVQRTATTVSGAVIASEIAQGKKSSSALGLTYTYDSR 590

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCVIP 645
              + P  G+L     D AG GGD++Y +  ++A +   +  ++  +  SL  G      
Sbjct: 591 IGGLNPNAGVLFEVGVDAAGLGGDNEYFKTSAKAIAQTRVWHEEITLRASLDVGAFTWQG 650

Query: 646 SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-----VDKKYAIGGKIYSSASAAVSFPMPL 700
           S  + +  D+F +  N + RGF   G+GPR     VD   AIGG  Y+ A     FP+ L
Sbjct: 651 SGFS-RAIDRFVIGPNTF-RGFEPAGVGPRDQSNGVDD--AIGGNYYAVARFEAEFPLGL 706

Query: 701 VPERAGLRGAFFVDSATLY-ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            PE  GLRG  F D   ++  + V      + G D  +R   G  ++W +  G +   + 
Sbjct: 707 -PEELGLRGGLFYDVGNVWDVSDVNTAGGTIVGADGSFRHVIGFSLLWTTAFGPLRFNFS 765

Query: 760 IPLRHREGDKIQQFGFRIGNRM 781
             L+    DK Q F   I  R 
Sbjct: 766 KALKKETFDKEQSFDLTIQARF 787


>gi|298370299|ref|ZP_06981615.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298281759|gb|EFI23248.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 799

 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 201/794 (25%), Positives = 364/794 (45%), Gaps = 58/794 (7%)

Query: 34  IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGY 93
           + GLS +  ++  I++ I + G        + + +PV VG + SDA  +  +KN+YA G+
Sbjct: 12  VLGLSPLAMADF-IIQDIRVEGLQRTEPSTVFNYLPVKVGDNFSDARSEEIIKNLYATGF 70

Query: 94  FSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVN 150
           F +V+++ + + +++ ++ER  I  L  +G   L++D +K  + S   A    +++ T+N
Sbjct: 71  FDDVRVETMGNQVLLTVVERPTIATLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLN 130

Query: 151 ADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHA 210
             V  ++  Y   G  +V +      ++   ++I   I+EG   KI  I F GN  YS  
Sbjct: 131 QAVVALRDEYVGRGKQSVKITPTVKKLARNRVSIDIAIDEGKSTKIADIEFEGNHVYSDR 190

Query: 211 RLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQK 268
           +L + +S+   G +++  +++ +++++ S D E +  FY + GY   + V + V  ++ K
Sbjct: 191 KLMKQMSLSEGGMWTWLTQSNQFNEQKFSQDLERVSEFYQNNGYFGFRIVDTDVQTNEDK 250

Query: 269 SGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISK 328
           +   +   +DEGE Y  G ++I    +E+ K+ L  ++ ++ G  Y  Q++ +S E +  
Sbjct: 251 TKQTIKITVDEGERYRWGKVTIDGDTREVLKEELYKMLTMKEGKWYERQKMVKSLEAMQN 310

Query: 329 YFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELE 388
              S    F  +  +   +   + VD    ++ G  +YV +I I GN+++ D V+RREL 
Sbjct: 311 RMGSAGYAFSEINVQPVPNPQTKTVDFVLHVEPGRKVYVNQINITGNNKTRDEVVRRELR 370

Query: 389 LSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIAT 448
             E  P + S ++R+K R+   GYF  V     P     D V + +SV++ S GS+ ++ 
Sbjct: 371 QMEAAPYDTSKLQRSKERVELLGYFDNVQFDAKPVEGSPDQVDVNMSVQERSTGSLDLSA 430

Query: 449 NYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL 508
            +  D GM +   +  +N FG G  A       +  V N + S  DPYF    +S G+D+
Sbjct: 431 GWVQDTGMVLSAGVSQDNLFGTGKSASARVSRSKTTV-NGSLSFTDPYFTPDGVSLGYDV 489

Query: 509 -------QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPS 561
                  +K              A +RM +P+TE    +F      L    ++     P 
Sbjct: 490 YGKSYDPRKASSSAKQYKTTTAGAGIRMGIPVTEYDRVNFGLAAEHL---TVNTYTGAPK 546

Query: 562 IYTTLIEH--------GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDS 611
            Y   I          G F       +I +  N  DN + P +G     + + A  G D 
Sbjct: 547 RYRDFINRYGKGSDGVGSFKGWLYKGTIGWGRNKTDNALWPTRGYQTGINGEVALPGSDL 606

Query: 612 QYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKG 671
           +Y+ +    ++F+ L+    ++     GYG      K +  F+ F       +RGF    
Sbjct: 607 KYYTLTHNQTWFFPLNKSLTLMLGGEVGYGNGYGKTKEMPFFENFYGGGLGSVRGFESGT 666

Query: 672 IGPRV----DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
           +GP+V     +K + GG   ++ SA + FPMP + +   +R + F D+ +++        
Sbjct: 667 LGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDARTVRLSLFADAGSVWDGKTYTDK 726

Query: 728 DKLEGNDSFW-----------------------RVSTGVEIMWNSPLGMMGVYYGIPLRH 764
           D    ND ++                       R S G  + W SPLG M   Y  P + 
Sbjct: 727 D----NDEYYNGRAKQNVYGLGTSHKSTFKEELRASAGAAVTWLSPLGPMKFSYAYPFKK 782

Query: 765 REGDKIQQFGFRIG 778
           +EGD+IQ+F F++G
Sbjct: 783 KEGDEIQRFQFQLG 796


>gi|261364378|ref|ZP_05977261.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           mucosa ATCC 25996]
 gi|288567648|gb|EFC89208.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           mucosa ATCC 25996]
          Length = 799

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 206/794 (25%), Positives = 371/794 (46%), Gaps = 58/794 (7%)

Query: 34  IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGY 93
           + G+S +  ++ +I + I + G        + + +PV VG   SDA  +  +K++YA G+
Sbjct: 12  VLGMSPLAFADFTI-QDIRVEGLQRTEPSTVFNYLPVKVGDQFSDARSEEIIKSLYATGF 70

Query: 94  FSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVN 150
           F +V+++ + + +++ +IER  I+ L  +G   L++D +K  + S   A    ++  T++
Sbjct: 71  FDDVRVETMGNQVLLTVIERPTISTLNITGAKMLQNDVIKKNLESFGLAQSQYFNPATLS 130

Query: 151 ADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHA 210
             V ++K+ Y S G  +V +      ++   ++I   I+EG   KI  I F GNK YS  
Sbjct: 131 QSVASLKEEYKSRGKQSVQITPTVTKLARNRVSIDIAIDEGKTTKITDIEFEGNKVYSDR 190

Query: 211 RLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQK 268
           +L + +S+   G +++  K++ +++++ S D E +  FY + GY   ++  + +  ++ K
Sbjct: 191 KLMKQMSLSEGGMWTWLTKSNQFNEQKFSQDMERVSEFYQNNGYFNFRILDTDIQTNEDK 250

Query: 269 SGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISK 328
           +  ++   +DEGE +  G++ I+   +E+ K+ L  L+ ++ G  Y   ++ +S E I  
Sbjct: 251 TKQIIKITVDEGERFRWGDVRIEGDTREVPKEELQKLLTMKKGKWYERAQMVKSLEAIQN 310

Query: 329 YFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELE 388
              +    F  V  +   +   + VD    ++ G  +YV  I I GN+++ D V+RREL 
Sbjct: 311 RMGTAGYAFSEVNVQPIPNAETQTVDFVLNVEPGRKIYVNEINITGNNKTRDEVVRRELR 370

Query: 389 LSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIAT 448
             E  P + S ++R+K R+   GYF  V    +P  +  D V L +SV + S GS+ ++ 
Sbjct: 371 QMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPVANTPDQVDLNMSVNERSTGSLDMSA 430

Query: 449 NYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL 508
            +  D G+ +   +  +N FG G    L A   +  + N + S  DPYF    +S G+D+
Sbjct: 431 GWVQDTGLVMSVGVSQDNLFGTGKSVSLRASRSKTTL-NGSLSFTDPYFTPDGVSLGYDI 489

Query: 509 -------QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA----ISEKE 557
                  +K              A VRM +P+TE       YD   L   A    ++  +
Sbjct: 490 YGKSYDPRKASSSAKQYKTTTAGAGVRMGIPVTE-------YDRVNLGLAAEHLTVNTYK 542

Query: 558 KIPSIYTTLIEH--------GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGF 607
             P  Y   I          G F       +I +  N  D+ + P +G +   + + A  
Sbjct: 543 GAPKRYADFINQYGKGTDGVGSFKGWLYKGTIGWGRNKTDSALWPTRGYMTGINGEIALP 602

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           G D QY+ +    ++F+ L+ D  ++     G G      K +  F+ F       +RG+
Sbjct: 603 GSDLQYYTLTHNQTWFFPLTKDFTLMLGGEVGVGNGYGKTKTMPFFENFYGGGLGSVRGY 662

Query: 668 AYKGIGPRV----DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD--------- 714
               +GP+V     +K + GG   ++ SA + FPMP + +   +R + F D         
Sbjct: 663 ESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDSRSVRLSLFADAGSVWDGKT 722

Query: 715 -----SATLYANHVA-----LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
                S T Y N+ A     LG           R S G  + W SPLG M   Y  PL+ 
Sbjct: 723 YNDSSSNTYYTNNAAQNPYGLGKTHKSTFKEELRYSAGAAVTWLSPLGPMKFSYAYPLKK 782

Query: 765 REGDKIQQFGFRIG 778
           ++ D+IQ+F F++G
Sbjct: 783 KDSDEIQRFQFQLG 796


>gi|89068194|ref|ZP_01155604.1| putative outer membrane protein [Oceanicola granulosus HTCC2516]
 gi|89046111|gb|EAR52169.1| putative outer membrane protein [Oceanicola granulosus HTCC2516]
          Length = 772

 Score =  284 bits (727), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 197/739 (26%), Positives = 358/739 (48%), Gaps = 21/739 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + ++G   +    ILS   +  G+++  A L+ A + I A G+F +V++    S L+I +
Sbjct: 39  VSVQGNGLIEDATILSYAGISRGEAVDAARLNDAAQQIRASGFFESVEVVPQGSTLVIQV 98

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   +N + F GN  L D+QL+ +++S+    Y+  T   D   I +AYA  G +N  V
Sbjct: 99  REYPQVNLVSFEGNARLNDEQLRAVIQSQQGRVYNPATAERDTAAIAEAYARSGRVNATV 158

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-FGKT 229
                      +++ + + EG  ++I  I FVGN+++S  RL  V+  + +G F    + 
Sbjct: 159 LPSIIRRDNNRVDLVFEVFEGGLSEIERISFVGNRSFSDRRLRGVLESKQAGAFRVLIQR 218

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQV-LFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D YS ER+ FD++ +  FY+ RGY    V+       +++  Y++ F + EG+ + +GN+
Sbjct: 219 DTYSAERIQFDKQVLTDFYNSRGYVDFVVNDVDVALSRERDAYLVTFNVQEGQQFRIGNV 278

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
            + S + E         +R+  G++Y+P +I+    ++          FVRV  RI RD 
Sbjct: 279 GLTSEIPEADPAAFAGAVRLDPGSIYSPTDIENDIARLEAQASRMGLNFVRVDPRITRDD 338

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
              +++IEY++  G  ++V+RI+IEGN  + D VIR +    EGDP+N   +  +  RI 
Sbjct: 339 RGLLLNIEYVLVPGERIFVERIDIEGNTTTLDRVIRSQFRTVEGDPLNPREVRESAERIR 398

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A GYF++  ++    +   D V++ V V++   GS+    N+  D G+ +     + NF 
Sbjct: 399 ALGYFADATVNAREGSS-PDQVVIDVDVEEQPTGSLSFGANFNTDNGISLVASFAERNFL 457

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVR 528
           G+G     +   G    +N++F+  +P  LG  +  G D      ++ +   + E+  V 
Sbjct: 458 GRGQSLAFSVSTG-ETNRNFSFNFAEPNLLGRDLRFGLDAAYRTTDNANALYDTETLRVS 516

Query: 529 --MIVPITESISTSFKYDLRFLQYGAISEKEKIPS--IYTTLI----EHGKFSSHSISQS 580
             +  P  E    S  Y   +     ++     P+    + LI    E G  ++H++  S
Sbjct: 517 PGLSFPAGEQTRLSVFYAYEYTDITGVAGTRDAPADERASVLIFEEAEQGGVATHALGYS 576

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASY-FYLLSDDSDIVGSLRFG 639
             Y+   + + PR G+++    ++    GD+Q+ +  + AS    +L +D  +  ++   
Sbjct: 577 FSYDNRRSGLEPRVGVVLRFGQEFG--VGDAQFIKSTALASAETRVLGEDVTLRATVE-- 632

Query: 640 YGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSASAAVSFPM 698
            G +     + ++ D++ + S   LRGF   G+GPR  D   A+GG  ++ A     FP+
Sbjct: 633 GGALDYREGSSRVTDRYFLGSR-LLRGFEAGGVGPRDADTDDALGGNYFAVARVEAEFPL 691

Query: 699 PLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
            L PE  G+ G  F D  +++      GAD +  ND   R   G+ I W +P+G +   +
Sbjct: 692 GL-PEEYGITGGVFFDHGSVWDVGDTHGADVIY-NDFTPRSVAGLSIFWTTPIGPLRFNF 749

Query: 759 GIPLRHREGDKIQQFGFRI 777
             P+  +E DK + F   I
Sbjct: 750 SEPIDVQERDKTRDFDLTI 768


>gi|259416856|ref|ZP_05740776.1| outer membrane protein assembly complex, YaeT protein [Silicibacter
           sp. TrichCH4B]
 gi|259348295|gb|EEW60072.1| outer membrane protein assembly complex, YaeT protein [Silicibacter
           sp. TrichCH4B]
          Length = 778

 Score =  284 bits (727), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 203/749 (27%), Positives = 357/749 (47%), Gaps = 27/749 (3%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + + G   +    I++   +  G+ +S   L+ A + ++  G F +V++    + L+I +
Sbjct: 39  VRVEGNQRIQSSTIVAYTGLSSGERVSGGALNDAYRGVFDSGLFESVELVPRGNTLVIKV 98

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   I+ + F GN  LKDD L  +++S     +  D    D   I + Y + G L   V
Sbjct: 99  VEYPTISRINFEGNKRLKDDALAEVIQSSPRRVFSADQAERDAGAIAELYRAQGRLASRV 158

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    +   +++ + I EG   ++  + FVGN+ YS  RL RV+  + + +  +    
Sbjct: 159 TPRIIRRNDNRVDLVFEISEGDTVEVERVSFVGNRAYSDRRLRRVLETKQATFLRALINR 218

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D   ++R+ FD + +  FY  RGY   +V+S      K++    L+  + EG+ +  G+I
Sbjct: 219 DTLIEDRIQFDRQVLTDFYRSRGYVDFRVNSVNAEVTKERDAAFLVVDVTEGQKFEFGDI 278

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ S   +       S +R++ G  Y+P  I+ + + + +        F+RV+ R+ R+ 
Sbjct: 279 TVTSEFADADPDVYRSQLRVKRGVTYSPLVIENAIQTLEQLAVRQGIDFLRVEPRVTRND 338

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+E+ + +G  ++V+RI+IEGN  + D VIRR+  + EGDP+N   I  +  RI 
Sbjct: 339 RDLTLDVEFAMVRGPRIFVERIDIEGNTTTLDRVIRRQFNIVEGDPLNQREIRNSAERIK 398

Query: 409 ATGYF--SEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNN 466
           A G+F  SEV++ Q         VI+ V V++   GS  +  +Y VD G+GV   I +NN
Sbjct: 399 ALGFFSQSEVDVRQ---GSTPSEVIVDVDVEEQPTGSFTLGGSYSVDDGIGVAIGISENN 455

Query: 467 FFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAA 526
           F G+G +        +   + Y     +P  LG  +    DL  +  E    + + +S  
Sbjct: 456 FLGRGQQLSFNISTAQD-TEAYNMRFVEPKLLGRDLQFAIDLGLSETESSYSEYDTKSVI 514

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISE------KEKIPSIYTTLIEHGKFSSHSISQS 580
            R  +    S +TS +    F Q    S       + ++  +    I  GK ++ SI  +
Sbjct: 515 FRPSITFDASDTTSLQLRYGFEQNEMESRGLNSSGQPRVGPVLQREIAAGKRTTSSIGAT 574

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR-ASYFYLLSDDSDIVGSLRFG 639
             Y++    + P  G LI S  DYAG GGD++Y R  S+  +   + +++  +  ++  G
Sbjct: 575 FTYDSRRTGLNPTAGFLIQSGVDYAGLGGDNEYIRATSKIVAQKLVFNEEVTLRATVETG 634

Query: 640 YGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKY--AIGGKIYSSASAAVSF 696
           Y   +  N++ +  D+F ++S   LRGF   GIGPR +   Y  A+GG +Y+ A     F
Sbjct: 635 YLGWLGDNRS-RTVDRFLLTSE-TLRGFEPGGIGPRDMSGSYDDALGGNLYAVARFDAEF 692

Query: 697 PMPLVPERAGLRGAFFVDSATLY----ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLG 752
           P+ L PE  GLRG  F D   L+    +N   +G   + G D  +R   G  ++W + LG
Sbjct: 693 PLGL-PEELGLRGGVFYDVGNLWGLEDSNADLVG--NVVGRDGSFRHVVGFSLLWTTGLG 749

Query: 753 MMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +   +   L   + DK + F   I  R 
Sbjct: 750 PLRFNFSKALVKEDFDKERNFDLTIQARF 778


>gi|51473359|ref|YP_067116.1| outer membrane protein Omp1 [Rickettsia typhi str. Wilmington]
 gi|51459671|gb|AAU03634.1| outer membrane protein Omp1 [Rickettsia typhi str. Wilmington]
          Length = 768

 Score =  284 bits (727), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 205/755 (27%), Positives = 368/755 (48%), Gaps = 33/755 (4%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DSV 105
           ++R+I I+G   + +  I S +   VG++ +++  D A+K +YA   F N+ + I  D  
Sbjct: 27  VIRKITIKGNHRIERSTIESYLKFNVGETYNNSKEDEAIKRLYATSLFKNINMYITNDGN 86

Query: 106 LIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGY 165
           LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G 
Sbjct: 87  LIVNVTETPFISSVVFSGNSKIKTNILAKEIYTMSGESLSQAKIELDVKKILEIYKRSGR 146

Query: 166 LNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS 225
            +  V  +  ++    + + + I EG K  I SI F GN++YS + L+ ++  + S +F 
Sbjct: 147 FSTKVIPKIKNLENNRVKVIFDIAEGPKTGIKSIYFSGNEHYSDSELKSIVLTKESRWFR 206

Query: 226 F-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIY 283
           F    D Y  +R+ +D+E +R FY   G+A  +V S+ V  +  K  + L + I+EGE Y
Sbjct: 207 FLENNDTYDPDRVEYDKELLREFYQSVGFADFRVISASVELNDTKEYFTLTYSIEEGEKY 266

Query: 284 TVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTR 343
             GN++I + L  I  K L  ++ I+ G ++N +++ + +EKI +YF +     V V   
Sbjct: 267 RFGNVTIDNKLTNINMKYLNKIVNIKQGKIFNMKKVDDIAEKIGEYFTANGYSAVNVYPE 326

Query: 344 INRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERA 403
           I ++      DI+++I++G  +Y+ +I I  N ++ D VIRR  ++ EGD IN S IE+ 
Sbjct: 327 IKKN-DNHTADIKFIIEKGDKVYINKINIINNLKTEDHVIRRAFKIEEGDVINRSYIEKG 385

Query: 404 KRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHID 463
           +R +    YF +V+IS L      D   + V + + S  S+G    Y    G+       
Sbjct: 386 ERNLRNLDYFEKVSIS-LAKTKAKDKYDVNVEIDEKSTSSIGFDLGYNTAGGLFGRFSFL 444

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDIN 521
           + N  G G          +++   Y   + DP+FL   +S   +  + +   G+  L+  
Sbjct: 445 ERNLVGTGKLLNAGVQVSKNSTSYYG-CITDPHFLDRDLSLSVNAFRNYTGRGASVLNTT 503

Query: 522 DESAAVRMIVPITESISTSFKYDLR---------FLQYGAISEKEKIPSIYTTLIEHGKF 572
           D+S  +  I      +  S  YD++          ++   +S      SI+    + GK 
Sbjct: 504 DQSYKLHSI-----GVKISLGYDMKEDLSHEIDYLIKRDILSAPSPSNSIFLNE-QMGKL 557

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDI 632
            + +I  +I Y+  DN IVP+ G L+S + ++AG GGD++Y +      Y+     +   
Sbjct: 558 ITSAIGHTITYDQTDNKIVPKNGYLVSGTQEFAGIGGDNKYIKHEIECKYYKSFIHNKVT 617

Query: 633 VGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSAS 691
           +     G        K +++ D+F++  +Y LRGFA  G+GPR  +    +GG+ Y + S
Sbjct: 618 LKLSAAGGDMAGLGGKIVRISDRFNL-GDYSLRGFASGGVGPREKNTNEGLGGEKYYTFS 676

Query: 692 AAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEIM 746
             ++FP P  PE   L GA F+D  +++   V L   + +      ND   R S G   +
Sbjct: 677 TELNFPTP-TPEEFNLTGAVFIDLGSVWG--VGLNKKQYKTPNGFYNDKSLRASVGFGFI 733

Query: 747 WNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 734 WVTRFAPIRMDWGFPIKKKQYDDTQNFHLRFSTHL 768


>gi|114764265|ref|ZP_01443493.1| putative outer membrane protein [Pelagibaca bermudensis HTCC2601]
 gi|114543213|gb|EAU46230.1| putative outer membrane protein [Roseovarius sp. HTCC2601]
          Length = 756

 Score =  284 bits (726), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 198/744 (26%), Positives = 350/744 (47%), Gaps = 28/744 (3%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + I G   +    ILS   +  G  +S  +L+ A + I A G F  V+I    + L+I +
Sbjct: 20  VSIEGNQRIEAGTILSYAGIARGAQVSGGELNAAYQRIVASGLFETVEIVPQGNTLVIRV 79

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   IN + F GN  +KD+ L  IV ++    Y       D + I +AY   G +   V
Sbjct: 80  TEYPTINRIAFEGNRRIKDEDLAAIVATQPRRVYSPSAAEQDANAIAEAYTQQGRIAARV 139

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ Y I EG   ++  I FVGN  +S  RL RV+  + +G   +    
Sbjct: 140 TPKLIRRSDNRVDLVYEIFEGGVTEVERISFVGNTEFSDRRLRRVLETKQAGLLRAIITA 199

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D +  +R+ FD + ++ FY  RGY   +++        ++  Y + F I+EG+ + +G I
Sbjct: 200 DTFIADRIEFDRQLLQDFYASRGYVDFRITGVNTELASERDAYFVTFNIEEGQQFDIGEI 259

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           S+QS L E+        I+++SG  Y+P  I+    ++ +        FVRV  RI R+ 
Sbjct: 260 SVQSDLPEVDTLLFRDAIKMKSGQTYSPSTIENEIARLERLGVQEGLTFVRVNPRITRND 319

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
             + +D+ + + +G  ++V+RI+IEGN  + D V+RR+ +  EGDP N   I ++  RI 
Sbjct: 320 RTQTLDVAFEMTRGERIFVERIDIEGNTTTLDRVVRRQFDTVEGDPFNPRAIRQSAERIR 379

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+FSE +++          VI+ V+V++   GS+G   +Y    G+G+     + NF 
Sbjct: 380 ALGFFSEADVNAREGT-TPQQVIIDVNVEEQPTGSIGFGGSYSTSNGLGLSLSFSERNFL 438

Query: 469 GQGYRARLAAGFGRHAV-QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAV 527
           G+G   RL+AG    +   NY+F+  +P FLG  ++ G     +  E    + +      
Sbjct: 439 GRG--QRLSAGVSTASTNNNYSFNFVEPRFLGRDLTFGLGASYSATEQEYAEFDTGRGVF 496

Query: 528 RMIV--PITESISTSFKYDLRFLQYGAI--SEKEKIPSIYTTLIEHGKFSSHSISQSIIY 583
           R  +  P+++    S +Y    L+Y  I  ++      I     + G+    S+  +  +
Sbjct: 497 RPSIGFPVSDFGRLSLRYT---LEYSDILNTDDGDAGQIIRAEEDLGERWDSSLGYTFSW 553

Query: 584 NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCV 643
           +T  + + P  G+L+    D+ G GGD+ +     RA     + ++ ++     F  G +
Sbjct: 554 DTRRDGLDPNAGVLLEFGQDFGGLGGDTSFIETNLRAVAQQRVWNE-EVTLRATFEAGAL 612

Query: 644 IPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-----VDKKYAIGGKIYSSASAAVSFPM 698
             ++   ++ D+F ++ +  LRGF Y GIGPR      D   ++GG  ++       FP+
Sbjct: 613 NYTSGRSRVTDRFRLNDS-TLRGFEYGGIGPREFNDAEDVDDSLGGNYFAVMRLEAEFPI 671

Query: 699 PLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFW-----RVSTGVEIMWNSPLGM 753
            L P+  G+ G  F D  +++    A  +     ND  +     R   G  + W+S LG 
Sbjct: 672 GL-PDEYGITGGLFYDMGSVWGLDDATTSTTT--NDILYEDFSLRHVIGFSVFWDSALGP 728

Query: 754 MGVYYGIPLRHREGDKIQQFGFRI 777
           + + +  PL   + D+ Q F   +
Sbjct: 729 LRLNFSRPLVKEDEDREQNFSLTV 752


>gi|157803347|ref|YP_001491896.1| Outer membrane protein omp1 [Rickettsia canadensis str. McKiel]
 gi|157784610|gb|ABV73111.1| Outer membrane protein omp1 [Rickettsia canadensis str. McKiel]
          Length = 768

 Score =  284 bits (726), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 207/755 (27%), Positives = 369/755 (48%), Gaps = 31/755 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS- 104
           +++R+I I G   V +  I S + + VG++ +++  D A+K +YA   F  + + I +  
Sbjct: 26  TVIRKITITGDHRVERSTIESYLKLKVGETYNNSKEDEAIKRLYATSLFKKINMYITNKG 85

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E   I+ + FSGN+ +K + L   + + S  +  +  +  DV  I + Y   G
Sbjct: 86  HLIVNVTETPFISSVVFSGNSKIKTNMLAKEIYTMSGESLSQSKLELDVKKILEIYKRSG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +  ++    + + + I EG K  I  I F GN NYS + L+ ++  + S +F
Sbjct: 146 RFATTVTAKIENLENNRVKVIFDIAEGPKTVIKYIYFNGNDNYSDSELKSIVLTKESRWF 205

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +R+ +D+E +R FY   G+A  +V S+    +  K  + L + I+EGE 
Sbjct: 206 RFLESNDTYDPDRVEYDKELLREFYQSVGFADFRVISALAELNNTKEYFTLTYSIEEGEK 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GN++I + L  I    L  ++ I+ G ++N Q + + ++KI +YF +   P V V  
Sbjct: 266 YSFGNVTIDNKLTNIDITPLNKIVNIKQGQVFNMQIVNDIAKKIGEYFTASGYPAVNVYP 325

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++      DI+++I++   +Y+ +I I  N ++ D VIRRE ++ EGD IN S IE+
Sbjct: 326 DIMKN-VNHTTDIKFIIEKADKVYINKINIINNLKTEDHVIRREFKIEEGDIINRSYIEK 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 385 GERNLRNLDYFEKVTISLAPTKAKDKYDV-NVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 443

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS--LDI 520
            + N  G G          +++   Y   +E P+FL   +S   +  + +   G   L+ 
Sbjct: 444 LERNLVGTGKLLNTGVQVSKNSTSYYGTIIE-PHFLDRDLSLSVNAFRNYAGYGGSVLNT 502

Query: 521 NDESAAVRMIVPITESISTSFKYDLR-----FLQYGAISEKEKIPSIYTTLI---EHGKF 572
            D++  +  I      + TS  Y+++      + Y    +    P++ T++    + G+F
Sbjct: 503 TDQNYKLHSI-----GLKTSLGYEIKEGLGHEIDYLIKRDILSAPTLSTSMFLKEQMGRF 557

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDI 632
            + +I  +I YN  DN IVP+ G LIS + ++AG GGD++Y +      Y+     +   
Sbjct: 558 ITSAIGHTITYNQTDNNIVPKNGYLISGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKLT 617

Query: 633 VGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSAS 691
           +     G        K +++ D+F++  +Y LRGFA  G+GPR  +    +GG+ Y + S
Sbjct: 618 LKLSASGGDIAGLGGKIVRISDRFNL-GDYSLRGFASGGVGPREKNTNEGLGGERYYTLS 676

Query: 692 AAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEIM 746
             ++FP P VPE   L GA F+D  +++   V L   + E      ND   R S G   +
Sbjct: 677 TELNFPTP-VPEEFNLTGAVFIDLGSVWG--VGLNKKRYETLNGFYNDKSLRASVGFGFI 733

Query: 747 WNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           W +    + + +G P++ ++ D  Q F  R    +
Sbjct: 734 WVTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 768


>gi|91775875|ref|YP_545631.1| surface antigen (D15) [Methylobacillus flagellatus KT]
 gi|91709862|gb|ABE49790.1| surface antigen (D15) [Methylobacillus flagellatus KT]
          Length = 790

 Score =  283 bits (725), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 211/784 (26%), Positives = 370/784 (47%), Gaps = 38/784 (4%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           +L  A++  SA+      +V+ I + G        + + +PV VG ++++     A+K++
Sbjct: 12  LLILALYSTSAL-AQEPFVVKDIRVEGLQRTEAGTVFNYLPVRVGDTMTEEKATQAIKSL 70

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YD 145
           Y  G+F +V+I+  + V+++ + ER  I  L F+GN +   D++K  ++    A    +D
Sbjct: 71  YGTGFFKDVRIESENGVVVVMVQERSAIAQLIFNGNKSFPTDKMKEGLKQIGLAEGLIFD 130

Query: 146 EDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK 205
           +  ++     IK+ Y S G     VK     +    + + + IEEG  +KI +I  VGNK
Sbjct: 131 QSMLDRAEQEIKRQYLSQGKYGASVKTSVTPLERNRVAVRFDIEEGAVSKIRNINIVGNK 190

Query: 206 NYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVL 263
            Y+   L   +++ T  + ++  K D YS+++++ D EA+R+FY ++GY    + S+QV 
Sbjct: 191 EYTKEELLEKLTLTTPNWLTWWNKNDQYSRQKLTADLEALRSFYMNQGYLEFNIDSTQVS 250

Query: 264 FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESS 323
               K    +   I EGE YTV ++ +   +  I +    SLI +  G ++N Q + ESS
Sbjct: 251 ITPDKRDIYITINITEGEKYTVTDVKLAGEML-IPEAEARSLISVSPGEIFNRQRVTESS 309

Query: 324 EKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVI 383
           + I+    +    F  V      D  K  V   + ID G  +YV+RI + GN ++ D V+
Sbjct: 310 KAINDRLGNDGYAFSNVNAIPEVDKEKHTVAFTFYIDPGRRVYVRRINLTGNTRTRDEVL 369

Query: 384 RRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS 443
           RRE+   E        IER+K+R+    YFS+VN+        +D V L ++V + S GS
Sbjct: 370 RREMRQLESAWYGADKIERSKQRLNRLQYFSDVNVETPAVPGTNDQVDLNINVTERSTGS 429

Query: 444 VGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPIS 503
           V         +G+ +   I+ NNF G G R       GR     Y+ S  DPYF    IS
Sbjct: 430 VMFGAGLSSFEGVVLGVTINQNNFLGTGNRVAAQVNTGRINTV-YSLSYTDPYFTPDGIS 488

Query: 504 AGFD-----LQKTHLEDGSLDINDESAAVRMIVPITES--ISTSFKYDLRFLQYGAISEK 556
            GF+     +  T+L  G        A V   +P+ E   +S    +D   ++  + S  
Sbjct: 489 RGFNVYHRKVDTTYLRTGDYKTASYGAGVNFGMPLNERDFVSAGLTFDYTDVELSSNSPP 548

Query: 557 EKIPSIYTTLIEHGKFSSHS---ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           +     Y +  E     S+S   ++ +  ++T DN + P KG+L   S + A  G D QY
Sbjct: 549 QF--KRYCSSSEDANSCSNSSWFVNLAWTHDTRDNIMFPNKGVLQRISSEVALPGLDLQY 606

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +++  + +++  +S    ++ +   GYG     +K+   F  F       +RG+    IG
Sbjct: 607 YKLEYKHAWYKDISKSVTLMLNGEIGYGNTY-GDKDYPFFKNFYAGGVNSVRGYEQSSIG 665

Query: 674 PRV------DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
           PR+       + +A GG     A+A + FP+P + +   LR + F+D+ ++  + +    
Sbjct: 666 PRIYDTQGQYRDFAAGGTKRFLANAELYFPIPGMKDNNALRLSTFIDAGSIAGDGIDESG 725

Query: 728 DKLEGND-----------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFR 776
             ++              S  R STG+ + W SP G + +    PL  ++GD+ Q   F+
Sbjct: 726 ACIDSRGQVSGCPYSTSLSDIRYSTGIGVSWLSPFGPIKLVLAKPLNKQDGDRTQMLQFQ 785

Query: 777 IGNR 780
           +G +
Sbjct: 786 MGQQ 789


>gi|268590524|ref|ZP_06124745.1| outer membrane protein assembly complex, YaeT protein [Providencia
           rettgeri DSM 1131]
 gi|291314110|gb|EFE54563.1| outer membrane protein assembly complex, YaeT protein [Providencia
           rettgeri DSM 1131]
          Length = 804

 Score =  283 bits (725), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 216/807 (26%), Positives = 372/807 (46%), Gaps = 61/807 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG +  YGS+  +V+ I   G   V     L  +PV VG S+ + D+  +
Sbjct: 3   MKKLLIASLLFGSATAYGSDGFVVKDIRFEGLQRVAVGAALLNMPVRVGDSVDNDDISRS 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++++++ G F +V++    + LI+ + ER  I  + F+GN ++KDD LK  + +   R  
Sbjct: 63  IRSLFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFTGNKSVKDDMLKQNLEASNIRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+      ++  Y S+G  N  VK     +    +++ +V  EGV A+I  I  
Sbjct: 123 EALDRTTIANIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKFVFSEGVSAQIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNKNY+ A L   + +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKNYTTAELVNKLQLRDDVPWWNLAADQKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQST----LQEIQKKTLLSLIRIRSGNLYN 315
           +QV     K G  +   I EG+ Y +  + +       L EIQ+     LI I  G LYN
Sbjct: 243 TQVSLTPDKKGIYITINITEGDQYKISGVEVNGNTADHLTEIQE-----LITITPGELYN 297

Query: 316 PQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
             ++     KI   F      + RV T+   + A + V +   ID G+  YV+ I  +GN
Sbjct: 298 GAQVTSMENKIKDMFGRYGYAYPRVMTQPEINDADKTVKLHLNIDAGNRFYVREIRFQGN 357

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           D S D+V+RRE+   EG  +   ++E  K R+  TGYF  V++         D V +   
Sbjct: 358 DTSKDTVLRREMRQMEGAWLGNDLVELGKERLNRTGYFETVDVETQRVPGSPDQVDVIYK 417

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDP 495
           VK+ + GS+     +  + G+  +  +  +N+ G G    + A    ++  N  FS  DP
Sbjct: 418 VKERNTGSMNFGIGFGTESGVSFQVGVTQDNWLGTGNAVGINASKNDYST-NVEFSFTDP 476

Query: 496 YFLGSPISAGFDLQKTHLEDGSLDI---NDESAAVRMIVPITESISTSFKYDLRFLQYGA 552
           YF  + +S G  +          D+   N+++  +   +    + + SF+    ++ +  
Sbjct: 477 YFTVNGVSLGGRIFYNDFSAKDADLSGYNNKTYGLDSFLSFPFNENNSFRVGAGYV-HNR 535

Query: 553 ISEKEKIPSIYTTLIEHGK-------------FSSHSISQSI--IYNTLDNPIVPRKGML 597
           +S+     +++  L   GK             F +   + ++   YN+L+    P  G  
Sbjct: 536 LSDMRAQAAMWDYLDSMGKNPPVTENGRNKESFDADDFTLNLGWTYNSLNRGFFPTSGNK 595

Query: 598 ISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQ 655
            + S      G D++Y+++    + +Y L +D    ++G  + GYG  I S K +  ++ 
Sbjct: 596 TNVSGKVTIPGSDNEYYKLRFDTAQYYPLDEDETWVVLGRAQAGYGDGIGS-KQMPFYEN 654

Query: 656 FSVSSNYYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMP 699
           F    +  +RGF    IGP+                     A+GG    +AS  +  P P
Sbjct: 655 FYAGGSSTIRGFRSNNIGPKAVYLKKINGKDGPEPGSPSSDAVGGNAMYAASFELITPTP 714

Query: 700 LVPER--AGLRGAFFVDSATLY-ANHVALGADKLEGNDSFW-----RVSTGVEIMWNSPL 751
            + E+    +R + FVD+ T++  N  ++ A   EG   +      R S GV + W SPL
Sbjct: 715 FIDEKYSNSVRTSLFVDAGTVWDTNWNSIPAAWREGMPDYGKASNIRASAGVALQWMSPL 774

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P++  EGDK +QF F IG
Sbjct: 775 GPLVFSYAQPIKDYEGDKSEQFQFNIG 801


>gi|86138417|ref|ZP_01056991.1| outer membrane protein, OMP85 family protein [Roseobacter sp.
           MED193]
 gi|85824942|gb|EAQ45143.1| outer membrane protein, OMP85 family protein [Roseobacter sp.
           MED193]
          Length = 800

 Score =  283 bits (725), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 198/753 (26%), Positives = 357/753 (47%), Gaps = 27/753 (3%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           +++ G   +    I++   +  G+++S   L+ A +NI   G F +V++    + L+I +
Sbjct: 53  VQVEGNQRIQSSTIVAYTGIERGKTVSAGKLNDAYQNILDSGVFESVELVPKGNTLVIKV 112

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   IN + F GN  +KD+ L  I+ S     +D      D   I +AY   G L   V
Sbjct: 113 TEFPTINKINFEGNRRIKDENLSEIIESSPRRVFDPAVAEQDAAAIAEAYGVQGRLASRV 172

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + I EG   ++  + F+GN+ YS  RL RV+  + +G+  +F   
Sbjct: 173 TPRIIRRSDNRVDLVFEISEGDTTEVERVSFLGNQVYSDRRLRRVLETKQAGFLRAFINK 232

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D   ++R+ FD++ +R FY  RGY   +V S+     +++    L+  + EG+ ++ G+I
Sbjct: 233 DTLIEDRIDFDKQVLRDFYLSRGYVDFRVNSANAEVTRERDAVFLVVDVSEGQQFSFGDI 292

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ S + E       + ++ + G +Y+P  ++   E++          F+R++ R+ R+ 
Sbjct: 293 TVTSDVPEADADEFRAALKSKPGIIYSPTIVEREIERLENLALRLGIDFLRIEPRVTRND 352

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+EY + +G  ++V+RI+IEGN  + D VIR++    EGDP N   I R   RI 
Sbjct: 353 RDLTLDVEYTLTRGPRVFVERIDIEGNTTTLDRVIRQQFRTVEGDPFNPREIRRTAERIR 412

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+FSE ++  +      + V++ V V +   GS+ +  +Y V+ G+G+   + +NNF 
Sbjct: 413 ALGFFSESDV-DVREGSSPEQVVVDVDVAEQPTGSLSLGGSYSVNDGLGIAVGLTENNFL 471

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVR 528
           G+G R   +      +   Y     +P+ LG  +   FDL     +    + + + A   
Sbjct: 472 GRGQRLSFSIATATES-DEYILGFVEPHLLGRDLRFSFDLGLAESDSSFSEYDTKRAFFS 530

Query: 529 MIVPITESISTSFKYDLRFLQYGAISEKEKI------PSIYTTL---IEHGKFSSHSISQ 579
             +    S S+S +   R+     I+  +        P+   T+   I  G+ SS  +  
Sbjct: 531 PALSFKLSESSSLRMSYRWETSEMIARADGTFTGGTYPAAAPTVVNEIAQGERSSSIVGL 590

Query: 580 SIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR-ASYFYLLSDDSDIVGSLRF 638
              Y++    + P  G L     DYAG GGD++Y +  ++  +   +L+++  +  +L  
Sbjct: 591 KYTYDSRLTGLDPNAGFLFEVGADYAGLGGDNEYLKTSTKFVAQKMILNEEVTLRATLET 650

Query: 639 GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYA--------IGGKIYSSA 690
           G    + +N +  L D++ V S   +RGF   GIGPR     A        +GG +++ A
Sbjct: 651 GALHWMGNNSSRSL-DRY-VLSPAIMRGFEPGGIGPRDVSARADGGTYNDFLGGNVFAVA 708

Query: 691 SAAVSFPMPLVPERAGLRGAFFVDSATLYA-NHV-ALGADKLEGNDSFWRVSTGVEIMWN 748
                FP+ L PE  GLRGA F D   L+  N V   G+  + G D  +R   G  I+W 
Sbjct: 709 RFDAEFPLGL-PEELGLRGALFYDVGNLWGLNDVDTSGSTNIVGRDGSFRHVVGFSILWT 767

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           + LG +   +   L+  + D+ Q F   +  R 
Sbjct: 768 TGLGPLRFNFSKALKKEDFDQEQSFDLTLQARF 800


>gi|254437680|ref|ZP_05051174.1| outer membrane protein assembly complex, YaeT protein
           [Octadecabacter antarcticus 307]
 gi|198253126|gb|EDY77440.1| outer membrane protein assembly complex, YaeT protein
           [Octadecabacter antarcticus 307]
          Length = 779

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 198/738 (26%), Positives = 346/738 (46%), Gaps = 31/738 (4%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + + G   +    IL+ +    G++++   ++ A + I A G F  V +      LII +
Sbjct: 50  VSVEGNQRIETATILTYLGFGQGEAVTAGAVNDAAQRIRATGLFEAVDVVPQGRTLIIRV 109

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   +N + F GN+ ++D +L  +VRS+    Y      AD   I Q YA  G +N  V
Sbjct: 110 AEFPTVNQIAFEGNSRIRDAELGAVVRSQPRRVYSPSQAEADTAAISQVYADQGRINATV 169

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + + EG   ++  I FVGN+ +  +RL RV+  + +G   +    
Sbjct: 170 TPRIIQRSDNRVDLVFEVFEGGLTEVERISFVGNRAFGESRLRRVLETKQAGLLRALINR 229

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D +  +R++FD++ +  FY  RGY   +V +  V   +++  Y++ F + EG+ +  GN+
Sbjct: 230 DTFIADRVAFDQQVLTDFYQSRGYVDFQVQNVDVSLTRERDAYLITFNVQEGQKFEFGNL 289

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ S +           +R+R+G  Y+P+ I+    ++          FVR   R+ R+ 
Sbjct: 290 TVTSEVTGADPAIYEDALRLRTGATYSPELIERDITRLELLALRQGLNFVRADPRVTRND 349

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+E+ +  G  ++V+RI+IEGN+ + D VIR   ++ EGDP N   I  +  RI 
Sbjct: 350 RTLTLDVEFALVNGPRIFVERIDIEGNNTTLDRVIRSRFDVVEGDPFNPRQIRESAERIR 409

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+F   N+     +   D V++ V V +   GS+    N+  D G  +    +  NF 
Sbjct: 410 ALGFFGTANVDAREGSS-PDQVVIDVDVTEAPTGSLSFGGNFSTDNGFSLLARFNQRNFL 468

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKTHLEDGSLDINDESAA 526
           G+G     +   G    QN++FS  +P  LG  +S G D   + T  ++   D    S  
Sbjct: 469 GRGQSLSFSVQGGVDN-QNFSFSFTEPRLLGRDLSFGIDTSYRSTDSQNALYDTTRASLR 527

Query: 527 VRMIVPITES--ISTSFKYD----LRFLQYGAISEKEKIPSIYTTLIE-HGKFSSHSISQ 579
            R+  PI+E+  ++  F YD      +   GA       PS +    E  G   + ++  
Sbjct: 528 PRIGFPISENGRLTLYFAYDHTEVTNYTTTGA-------PSPFILADEAQGGIGTSALGY 580

Query: 580 SIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFG 639
              Y+T    + P  G+L     ++ GFG  S        A+   +LS+   +  ++   
Sbjct: 581 GYSYDTRRTGLNPNAGVLFRFGQEF-GFGDSSFIETTAELAAQTSVLSEVVTLRATIE-- 637

Query: 640 YGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDK----KYAIGGKIYSSASAAVS 695
            G +  ++ + ++ D++ +SS   +RGF   GIGPR D     K A+GG  ++       
Sbjct: 638 GGLLSYTSGDSRVTDRYFLSSG-TMRGFEPGGIGPRDDTFGSDKDALGGNAFAVVRLEAE 696

Query: 696 FPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           FP+ L PE  G+ G  F+D  +++   V   A  +  +D   R   GV I WN+P+G + 
Sbjct: 697 FPLGL-PEEYGISGGVFLDYGSVW--DVGSSAGPVLYDDFTPRTVAGVSIFWNTPIGPLR 753

Query: 756 VYYGIPLRHREGDKIQQF 773
             Y  PL  +  D+IQQF
Sbjct: 754 FNYTEPLDVQANDQIQQF 771


>gi|238784888|ref|ZP_04628888.1| Outer membrane protein assembly factor yaeT [Yersinia bercovieri
           ATCC 43970]
 gi|238714205|gb|EEQ06217.1| Outer membrane protein assembly factor yaeT [Yersinia bercovieri
           ATCC 43970]
          Length = 794

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 219/796 (27%), Positives = 372/796 (46%), Gaps = 49/796 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+   
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIGKT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVRIG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN +++   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLEILRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y + ++ +   L   Q      L++I  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSDAD-KLVKIEPGELYNGSKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S 
Sbjct: 302 TRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     Y  + G+  +  +  +N+ G G    +     ++  Q Y  F++ DPYF 
Sbjct: 422 NTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGING--TKNDYQTYAEFTLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDIN---DESAAV--RMIVPITESISTSFKYDLRFLQYGAI 553
              +S G  +     +  + D++   + S  V   +  PI E  + S +  L ++ +  +
Sbjct: 480 VDGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINE--NNSLRVGLGYV-HNDL 536

Query: 554 SEKEKIPSIY---------TTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGMLISSSY 602
           S+ E   +++           LI+   F++   + ++   YN LD    P KG+  S + 
Sbjct: 537 SDMEPQVAMWRYLDSVGQDPNLIDRAGFTADDFTLNLGWTYNNLDRGFFPTKGVKSSVNT 596

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++++++    S +  L +D    ++G  R GYG  I S K +  ++ F    
Sbjct: 597 KVTVPGSDNEFYKVTFDTSAYQPLDEDHSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGG 655

Query: 661 NYYLRGFAYKGIGPRV----------DKKYAIGGKIYSSASAAVSFPMPLVPER--AGLR 708
           +  +RGF    IGP+           D   A+GG   + AS  +  P P + E+    +R
Sbjct: 656 SSTVRGFRSNNIGPKAAYYNANGTVRDSTDAVGGNAMAVASLELITPTPFISEKYANSIR 715

Query: 709 GAFFVDSATLY-ANHVALGADKLEG-----NDSFWRVSTGVEIMWNSPLGMMGVYYGIPL 762
            +FF+DS T++  N     A +  G       S  RVS GV + W SPLG +   Y  P+
Sbjct: 716 TSFFIDSGTVWDTNWENTAATRAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYAKPV 775

Query: 763 RHREGDKIQQFGFRIG 778
           +  EGDK +QF F IG
Sbjct: 776 KDYEGDKSEQFQFNIG 791


>gi|255067005|ref|ZP_05318860.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           sicca ATCC 29256]
 gi|255048830|gb|EET44294.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           sicca ATCC 29256]
          Length = 799

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 205/794 (25%), Positives = 370/794 (46%), Gaps = 58/794 (7%)

Query: 34  IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGY 93
           + G+S +  ++ +I + I + G        + + +PV VG   SDA  +  +K++YA G+
Sbjct: 12  VLGMSPLAFADFTI-QDIRVEGLQRTEPSTVFNYLPVKVGDQFSDARSEEIIKSLYATGF 70

Query: 94  FSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVN 150
           F +V+++ + + +++ +IER  I+ L  +G   L++D +K  + S   A    ++  T++
Sbjct: 71  FDDVRVETMGNQVLLTVIERPTISTLNITGAKMLQNDVIKKNLESFGLAQSQYFNPATLS 130

Query: 151 ADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHA 210
             V ++K+ Y S G  +V +      ++   ++I   I+EG   KI  I F GNK YS  
Sbjct: 131 QSVASLKEEYKSRGKQSVQITPTVTKLARNRVSIDIAIDEGKTTKITDIEFEGNKVYSDR 190

Query: 211 RLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQK 268
           +L + +S+   G +++  K++ +++++ S D E +  FY + GY   ++  + +  ++ K
Sbjct: 191 KLMKQMSLSEGGMWTWLTKSNQFNEQKFSQDMERVSEFYQNNGYFNFRILDTDIQTNEDK 250

Query: 269 SGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISK 328
           +   +   +DEGE +  G++ I+   +E+ K+ L  L+ ++ G  Y   ++ +S E I  
Sbjct: 251 TKQTIKITVDEGERFRWGDVRIEGDTREVPKEELQKLLTMKKGKWYERAQMVKSLEAIQN 310

Query: 329 YFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELE 388
              +    F  V  +   +   + VD    ++ G  +YV  I I GN+++ D V+RREL 
Sbjct: 311 RMGTAGYAFSEVNVQPVPNAETQTVDFVLNVEPGRKIYVNEINITGNNKTRDEVVRRELR 370

Query: 389 LSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIAT 448
             E  P + S ++R+K R+   GYF  V    +P  +  D V L +SV + S GS+ ++ 
Sbjct: 371 QMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPVANTPDQVDLNMSVNERSTGSLDMSA 430

Query: 449 NYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL 508
            +  D G+ +   +  +N FG G    L A   +  + N + S  DPYF    +S G+D+
Sbjct: 431 GWVQDTGLVMSVGVSQDNLFGTGKSVSLRASRSKTTL-NGSLSFTDPYFTPDGVSLGYDI 489

Query: 509 -------QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA----ISEKE 557
                  +K              A VRM +P+TE       YD   L   A    ++  +
Sbjct: 490 YGKSYDPRKASSSAKQYKTTTAGAGVRMGIPVTE-------YDRVNLGLAAEHLTVNTYK 542

Query: 558 KIPSIYTTLIEH--------GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGF 607
             P  Y   I          G F       +I +  N  D+ + P +G +   + + A  
Sbjct: 543 GAPKRYADFINQYGKGTDGVGSFKGWLYKGTIGWGRNKTDSALWPTRGYMTGINGEIALP 602

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           G D QY+ +    ++F+ L+ D  ++     G G      K +  F+ F       +RG+
Sbjct: 603 GSDLQYYTLTHNQTWFFPLTKDFTLMLGGEVGVGNGYGKTKTMPFFENFYGGGLGSVRGY 662

Query: 668 AYKGIGPRV----DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD--------- 714
               +GP+V     +K + GG   ++ SA + FPMP + +   +R + F D         
Sbjct: 663 ESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDSRSVRLSLFADAGSVWDGKT 722

Query: 715 -----SATLYANHVA-----LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
                S T Y N+ A     LG           R S G  + W SPLG M   Y  P++ 
Sbjct: 723 YNDSSSNTYYTNNAAQNPYGLGKTHKSTFKEELRYSAGAAVTWLSPLGPMKFSYAYPIKK 782

Query: 765 REGDKIQQFGFRIG 778
           ++ D+IQ+F F++G
Sbjct: 783 KDSDEIQRFQFQLG 796


>gi|261344728|ref|ZP_05972372.1| outer membrane protein assembly complex, YaeT protein [Providencia
           rustigianii DSM 4541]
 gi|282567170|gb|EFB72705.1| outer membrane protein assembly complex, YaeT protein [Providencia
           rustigianii DSM 4541]
          Length = 804

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 209/803 (26%), Positives = 372/803 (46%), Gaps = 53/803 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   + G +  YGS+  +V+ I   G   V     L  +PV VG S+ + D+  +
Sbjct: 3   MKKLLIASLLLGSATAYGSDGFVVKDIRFEGLQRVAVGAALLNMPVRVGDSVDNDDISRS 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++++++ G F +V++    + LI+ + ER  I  + F+GN ++KDD LK  + +   R  
Sbjct: 63  IRSLFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFTGNKSVKDDMLKQNLEASNVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D   +      ++  Y S+G  N  VK     +    +++ +V  EGV AKI  I  
Sbjct: 123 EALDRTKIANIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKFVFSEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNKNY  A L   + +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKNYPTAELVNKLQLRDDVPWWNLAADQKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K    +   I EG+ Y +  + +     E     +  LI I  G LYN  ++
Sbjct: 243 TQVSLTPDKKDIYITINITEGDQYKISGVEVNGNTAE-HLADIKELITITPGELYNGAQV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +   KI   F      + RV T+   + A + V +   +D G+  YV++I  +GND S 
Sbjct: 302 TQMENKIKDLFGRYGYAYPRVMTQPEINDADKTVKLHVNVDAGNRFYVRQIRFQGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +   ++E  K R+  TG+F  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNDLVELGKERLNRTGFFETVDVETQRIPGSADQVDVIYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           + GS+     +  + G+  +  +  +N+ G G    + A    ++  N  FS+ DPYF  
Sbjct: 422 NTGSMNFGVGFGTESGVSFQVGVTQDNWLGTGNAVGINASRNDYST-NVEFSMTDPYFTV 480

Query: 500 SPISAGFDLQKTHLEDGSLDI---NDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
           + +S G  +          D+   N+++  +   +    + + SF+    ++ +  +S+ 
Sbjct: 481 NGVSLGGRIFYNDFSAKDADLSGYNNKTYGLDSFLSFPFNENNSFRVGAGYV-HNDLSDM 539

Query: 557 EKIPSIYTTLIEHG---------------KFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
               +++  L   G               +    +++    YN+L+    P  G   S S
Sbjct: 540 RAQAAMWDYLDSMGQNPPVTADGRNKESFRADDFTLNVGWTYNSLNRGFFPTSGNKTSVS 599

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
                 G D++Y+++    +++Y ++DD    ++G  + GYG  I S K +  ++ F   
Sbjct: 600 GKVTVPGSDNEYYKLRFDTAHYYPINDDETWVVLGRAQAGYGDGIGS-KQMPFYENFYAG 658

Query: 660 SNYYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
            +  +RGF    IGP+                     A+GG    +AS  +  P P + E
Sbjct: 659 GSSSIRGFRSNNIGPKAVYLKSVNGVAVPEPGSPSSDAVGGNAMYTASFELITPTPFIDE 718

Query: 704 RAG--LRGAFFVDSATLY-ANHVALGADKLE-----GNDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R + FVD+ T++  N  ++  +  +     GN +  RVSTG+ + W SPLG + 
Sbjct: 719 KYANTIRTSLFVDAGTVWDTNWNSINPEWRKGMPDYGNATNVRVSTGLALQWISPLGPLV 778

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P++  EGDK +QF F IG
Sbjct: 779 FSYAQPIKDYEGDKSEQFQFNIG 801


>gi|218682883|ref|ZP_03530484.1| putative outer membrane protein [Rhizobium etli CIAT 894]
          Length = 383

 Score =  281 bits (718), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 139/344 (40%), Positives = 220/344 (63%), Gaps = 2/344 (0%)

Query: 42  GSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKI 101
            +  ++++RI++RGA+ VG E + S + +  G+S S+ D+D +VK +Y  GYFS+VKI +
Sbjct: 8   AAEAAVIQRIDVRGASRVGAEAVRSNLTIAPGKSFSNTDIDASVKQLYGTGYFSDVKISV 67

Query: 102 VDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYA 161
             S L++++ E +++N + F+GN  +KDD+L  IV++ +A  Y +  + AD+ +IK+AYA
Sbjct: 68  SGSTLVVNVQEAQLVNQVVFNGNRKIKDDKLATIVQTHAAGPYSDTQIQADIQSIKEAYA 127

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTS 221
           + G   V V  Q   +    +N+ +VI EG + KI+SI FVGN  YS  RL  VI  + S
Sbjct: 128 ATGRSEVEVTTQVVPLGEGRVNLAFVINEGDRTKIDSINFVGNNAYSAGRLAAVIQTKRS 187

Query: 222 GYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDE 279
            + SF  + DVY+++++  DEEA+R FY++RGYA ++ VSS   FD   + Y L F I+E
Sbjct: 188 NFLSFLTRKDVYNEDKLHADEEALRQFYYNRGYADMRIVSSDATFDDATNKYTLTFNIEE 247

Query: 280 GEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVR 339
           G+ Y  G +++QST++ +  + L  L+R + G+LY+ +E+++S E IS    S   PF R
Sbjct: 248 GQRYDFGPVTVQSTVEGVGSEQLQPLVRTKEGHLYSAKEVQKSIEAISDQVASAGYPFAR 307

Query: 340 VKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVI 383
           V  R NRD     + +EYL+DQG   YV+RIEI GN ++ D VI
Sbjct: 308 VTPRGNRDLNNNTIGVEYLVDQGERAYVERIEIRGNSRTRDYVI 351


>gi|183597588|ref|ZP_02959081.1| hypothetical protein PROSTU_00871 [Providencia stuartii ATCC 25827]
 gi|188023085|gb|EDU61125.1| hypothetical protein PROSTU_00871 [Providencia stuartii ATCC 25827]
          Length = 804

 Score =  280 bits (717), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 215/807 (26%), Positives = 373/807 (46%), Gaps = 61/807 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG +  YGS+  +V+ I   G   V     L  +PV VG SI + D+  +
Sbjct: 3   MKKLLIASLLFGSATAYGSDGFVVKDIRFEGLQRVAVGAALLNMPVRVGDSIDNEDISRS 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++++++ G F +V++    + LI+ + ER  I  + F+GN ++KDD LK  + +   R  
Sbjct: 63  IRSLFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFTGNKSVKDDMLKQNLEASNIRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D   +      ++  Y S+G  N  VK     +    +++ +V  EGV AKI  I  
Sbjct: 123 EALDRTKIANIEKGLEDFYYSVGKYNATVKAVATPLPRNRVDLKFVFSEGVSAKIQQINV 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNKNY+ A L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKNYTTAELVNKFQLRDDVPWWNLAADQKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQST----LQEIQKKTLLSLIRIRSGNLYN 315
           +QV     K    +   + EG+ Y +  + I       L EIQ+     LI I  G LYN
Sbjct: 243 TQVSLTPDKKDIYITINVTEGDQYKISGVEINGNTADHLTEIQE-----LITITPGELYN 297

Query: 316 PQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
             ++     KI          + RV T+   +   + V +   ID G+  YV++I  +GN
Sbjct: 298 GTQVTSMENKIKDLLGRYGYAYPRVMTQPEINDEDKTVKLHVNIDAGNRFYVRQIRFQGN 357

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           D S DSV+RRE+   EG  +   ++E  K R+  TG+F  V++         D V +   
Sbjct: 358 DTSKDSVLRREMRQMEGAWLGNDLVELGKERLNRTGFFETVDVETQRVPGSPDQVDVVYK 417

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDP 495
           VK+ + GS+     +  + G+  +  +  +N+ G G    + A    ++  N   S  DP
Sbjct: 418 VKERNTGSMNFGVGFGTESGVSFQVGVSQDNWLGTGNAVGINASKNDYST-NVEMSFTDP 476

Query: 496 YFLGSPISAGFDLQKTHLEDGSLDIN---DESAAVRMIVPITESISTSFKYDLRFLQYGA 552
           YF  + +S G  +          D++   +++  +   +    + + SF+    ++ + +
Sbjct: 477 YFTVNGVSLGGRVFYNDFRAKDADLSGYTNKTYGLDTFLSFPFNENNSFRVGAGYV-HNS 535

Query: 553 ISEKEKIPSIYTTLIEHG-------------KFSSH--SISQSIIYNTLDNPIVPRKGML 597
           +S+     +++  L   G             KF++   +++    YN+L+    P  G  
Sbjct: 536 LSDMRPQAAMWDYLYSMGDKPPINDDGRNKEKFNADDFTVNLGWTYNSLNRGFFPTSGNK 595

Query: 598 ISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQ 655
            S S      G D++Y+++    + +Y +++D    I+G  + GYG  + S K +  ++ 
Sbjct: 596 TSVSGKITVPGSDNEYYKLRFDTAQYYPINEDETWVILGRAQAGYGDGLGS-KQMPFYEN 654

Query: 656 FSVSSNYYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMP 699
           F    +  LRGF    IGP+                     A+GG    +AS  +  P P
Sbjct: 655 FYAGGSSTLRGFRSNNIGPKAVYLKNVNGKGEPEPGSPSSDAVGGNAMYAASFELITPTP 714

Query: 700 LVPER--AGLRGAFFVDSATLY-ANHVALGADKLEGNDSFW-----RVSTGVEIMWNSPL 751
            + E+    +R + FVD+ T++  N  ++ AD  +G   +      RVSTGV + W SPL
Sbjct: 715 FIDEKYSNTVRTSLFVDAGTVWDTNWNSINADWRKGMPDYGKATNVRVSTGVALQWMSPL 774

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P++  EGDK +QF F IG
Sbjct: 775 GPLVFSYAQPIKDYEGDKSEQFQFNIG 801


>gi|238796617|ref|ZP_04640124.1| Outer membrane protein assembly factor yaeT [Yersinia mollaretii
           ATCC 43969]
 gi|238719595|gb|EEQ11404.1| Outer membrane protein assembly factor yaeT [Yersinia mollaretii
           ATCC 43969]
          Length = 794

 Score =  280 bits (717), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 217/796 (27%), Positives = 371/796 (46%), Gaps = 49/796 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+   
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIGKT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVRIG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN +++   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLEILRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y + ++ +   L   Q      L++I SG LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSDAD-KLVKIESGELYNGSKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S 
Sbjct: 302 TRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     Y  + G+  +  +  +N+ G G    +     ++  Q Y  F++ DPYF 
Sbjct: 422 NTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGING--TKNDYQTYAEFTLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDIN---DESAAVRMIV--PITESISTSFKYDLRFLQYGAI 553
              +S G  +     +  + D++   + S  V   +  PI E  + S +  L ++ +  +
Sbjct: 480 VDGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINE--NNSLRVGLGYV-HNDL 536

Query: 554 SEKEKIPSIY---------TTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGMLISSSY 602
           S+ E   +++           L +   F++   + ++   YN LD    P KG+  S + 
Sbjct: 537 SDMEPQVAMWRYLDSVGQDPNLTDRAGFTADDFTLNLGWTYNNLDRGFFPTKGVKSSVNT 596

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++++++    S +  L +D    ++G  R GYG  I S K +  ++ F    
Sbjct: 597 KVTVPGSDNEFYKVTFDTSAYQPLDEDHSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGG 655

Query: 661 NYYLRGFAYKGIGPRV----------DKKYAIGGKIYSSASAAVSFPMPLVPER--AGLR 708
           +  +RGF    IGP+           D   A+GG   + AS  +  P P + E+    +R
Sbjct: 656 SSTVRGFRSNNIGPKAAYYNANGTIRDSTDAVGGNAMAVASLELITPTPFISEKYANSIR 715

Query: 709 GAFFVDSATLYANHVALGADKLEG------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPL 762
            +FF+DS T++  +    A+            S  RVS GV + W SPLG +   Y  P+
Sbjct: 716 TSFFIDSGTVWDTNWENTAETRAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYAKPV 775

Query: 763 RHREGDKIQQFGFRIG 778
           +  EGDK +QF F IG
Sbjct: 776 KDYEGDKSEQFQFNIG 791


>gi|83953535|ref|ZP_00962256.1| outer membrane protein, OMP85 family protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83841480|gb|EAP80649.1| outer membrane protein, OMP85 family protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 756

 Score =  280 bits (716), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 193/735 (26%), Positives = 360/735 (48%), Gaps = 21/735 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           ++I G   +G   ILSR  +  G++IS  +L+ A +N+ A G F +V ++     L+I +
Sbjct: 23  VQIDGNERIGDSAILSRAGIARGRAISAGELNDAYQNLQASGLFESVALEPRGGTLVITV 82

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   IN + F GN  + D+ L  +V S     ++      D + I QAY++ G +   V
Sbjct: 83  VEFPTINRISFEGNARIDDEALASVVDSDERRVFNPTQAEKDANAIAQAYSNDGRIAARV 142

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-FGKT 229
           + +        +++ + + EG   +I  + FVGN+ YS  RL RV+  + +G F    K 
Sbjct: 143 QPKVIRRDQNRVDLVFEVFEGDNVEIERLSFVGNRQYSDRRLRRVLGTKQAGLFRRLIKR 202

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D +  ER+  D++ +R FY  RGY  +++S+      +++ GY + F + EG+ +  G +
Sbjct: 203 DTFVPERIEADQQMLRDFYLSRGYVDMRISAANAQLTEERDGYFVQFNVQEGQQFKFGEL 262

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ ST+  +  +    +I+ +SG +Y+P  ++    ++ +        F+RV+  + R+ 
Sbjct: 263 TVTSTINGVNAEDYRGVIKTKSGAVYSPSLVETDIARMERKAIRDGVDFLRVEPVVTRND 322

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +++EY I +G  ++V+RI+IEGN  + D V+RR+ +  EGDP N   I  +  RI 
Sbjct: 323 RDLTLNVEYRISRGPRVFVERIDIEGNTTTLDRVVRRQFDSVEGDPFNPREIRESAERIR 382

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A GYF    ++    +     V+    V+Q   GS+    ++    G+GV     ++NF 
Sbjct: 383 ALGYFESAEVNAREGSSPEQVVVDVNVVEQ-PTGSLNFGGSFSSSDGIGVAVSFAEDNFL 441

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQ--KTHLEDGSLDINDESAA 526
           G+G + +L      +A Q Y F+  +P  LG  ++ G +L   +T     S D       
Sbjct: 442 GRGQKLKLTVSTAEYA-QRYGFNFIEPSLLGRDVAFGLNLDYAETSSSYNSFDTKRIVFQ 500

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPS--IYTTLIEHGKFSSHSISQSIIYN 584
             +  P++E+   S  Y    L+   +SE++   +  +    I  G+  + SI  +  Y+
Sbjct: 501 PTLSFPVSENGRLSLNYTYDDLE---MSERDDTTTGFVVANDIAAGRQVTSSIGYNYSYD 557

Query: 585 TLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCV 643
           T    + P  G+L+    D+AG GGD+++ +  ++A     + +++  +  +L+   G +
Sbjct: 558 TRRAGLDPTSGVLLQFGQDFAGLGGDTKFVKTTAKAIGEKRIFNEEVTLRATLQ--GGAL 615

Query: 644 IPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY---AIGGKIYSSASAAVSFPMPL 700
             S  N ++ D+F +  +  +RGF   GIGPR        ++GG ++   S    FP+ L
Sbjct: 616 AWSEGNNRVSDRFLIGPS-IMRGFETGGIGPRDQSNSSDDSLGGNLFVVGSLEAEFPLGL 674

Query: 701 VPERAGLRGAFFVDSATLYA--NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
            PE  G+ G  F D   ++   + V      + G    +R   GV + W++P+G +    
Sbjct: 675 -PEEYGISGGVFYDVGNVWNLDDVVIPAGSSIVGESGSFRHVIGVSLFWDTPVGPLQFNV 733

Query: 759 GIPLRHREGDKIQQF 773
              L+  + D+ Q+F
Sbjct: 734 SKALKKEDYDQEQKF 748


>gi|85703182|ref|ZP_01034286.1| outer membrane protein, OMP85 family protein [Roseovarius sp. 217]
 gi|85672110|gb|EAQ26967.1| outer membrane protein, OMP85 family protein [Roseovarius sp. 217]
          Length = 778

 Score =  280 bits (716), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 185/731 (25%), Positives = 353/731 (48%), Gaps = 19/731 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + I G   +    ILS   +   +++S   L+ A + +   G F  V++    + L+I +
Sbjct: 51  VSIEGNQRIEAGTILSYAGIARNETVSAGQLNDAYQKVLTSGLFEEVELVPQGNNLLIRV 110

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   IN + F GN+ +KD+ L   ++S+S   +       D   I +AY+  G +   V
Sbjct: 111 TEFPTINRIAFEGNDKIKDEDLAGFIQSKSRQVFSPTQAERDAGIISEAYSQNGRIAARV 170

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + I EG K ++  I FVGN+ +S  RL RV+  + +G   +  + 
Sbjct: 171 TPKVIRRSDNRVDLVFEIFEGRKIEVQRIGFVGNRAFSDTRLRRVVESKQTGLLRALIER 230

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVS-SQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D + ++R++FD + +  FY+ RGY   +V+ +     +++  Y + F + EG+ +  G I
Sbjct: 231 DTFVEDRVNFDRQVLTDFYNSRGYVDFRVTGTNAELARERDAYFVTFNVQEGQQFKFGQI 290

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           +  S +  ++ +T    ++I+ G +Y+P  ++ S  ++ +        F+RV+ RI R+ 
Sbjct: 291 TTVSEMNGVEAETYHDTLKIKPGVVYSPTLVENSIARMERLAIKNGVDFLRVEPRITRND 350

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +++E+ + +G  ++V+RI+IEGN  + D VIRR+ + +EGDP N   I++A  RI 
Sbjct: 351 RDLTLNVEFALQRGPRIFVERIDIEGNTTTLDRVIRRQFDQAEGDPFNPRSIQQAATRIR 410

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A GYF EV+++    +   D V++   V++ + G+V +  ++  + G+G+     + NF 
Sbjct: 411 ALGYFKEVDVNAREGSR-PDQVVIETDVEEQTTGTVSVGASFSTNSGLGISLGFSERNFI 469

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD--LQKTHLEDGSLDINDESAA 526
           G+G R   A         NY     +P FLG  ++ G D   Q+T  ++   D    +  
Sbjct: 470 GRGQRL-TAQILATADSINYNLGFVEPAFLGRDVALGLDFSFQETESDNSLFDTAIGTFR 528

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
             +  P  E+      Y+     Y  +S+ +    I    I  G   + S+  +  Y+T 
Sbjct: 529 PSLTFPTGENTRLGVYYN---ASYEDMSDYQGTSGILLDEINQGALWTSSVGYNFNYDTR 585

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPS 646
           ++ + P  G+L+S   ++AG GGD+ Y +  +R      + ++   + ++  G       
Sbjct: 586 ESGLNPNAGVLLSFGQEFAGLGGDNDYIKTTARLVGQTTVMNEDVTLRAILEGGAIEFSG 645

Query: 647 NKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAG 706
            ++ +  ++F    +  +RGF   G+GP ++    +GG  +++      FP+ L P+  G
Sbjct: 646 GQSSRFLNRF---GSQVIRGFEPNGMGP-IEDDELLGGDYFAALKFEAEFPLGL-PDEYG 700

Query: 707 LRGAFFVDSATLYA----NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPL 762
           + G  F D  +++       VA G + L       R   G  I W+SP G + + +   L
Sbjct: 701 ITGGAFYDIGSIWGIGNRGSVAPG-NTLSSTGFKARHVVGFSIFWSSPFGPIRMNFSNAL 759

Query: 763 RHREGDKIQQF 773
           +   GD  QQF
Sbjct: 760 KKEPGDIEQQF 770


>gi|260433801|ref|ZP_05787772.1| outer membrane protein assembly complex, YaeT protein [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417629|gb|EEX10888.1| outer membrane protein assembly complex, YaeT protein [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 766

 Score =  280 bits (715), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 197/740 (26%), Positives = 355/740 (47%), Gaps = 17/740 (2%)

Query: 52  EIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLI 111
           ++ G   +    I++R  +  GQ ++   L+ A + +   G F  V++    S L+I + 
Sbjct: 34  DVDGNRRIETSTIIARTGITPGQPVTAGQLNDAYQRLLDSGVFETVELTPRGSTLVIKVE 93

Query: 112 ERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVK 171
           E   IN +   GN  +KDD L   + S+    +       D   I + Y++ G ++  V 
Sbjct: 94  EYPTINKISIEGNRRVKDDVLLGAISSQPRRVFTPQVAEKDADMIAEIYSAQGRVSATVI 153

Query: 172 VQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTD 230
            +    S   +++ + + EG   ++  + FVGN+ YS  RL RV+  + +    +F + D
Sbjct: 154 PRIIRRSDNRVDLVFEVAEGTVIEVERVSFVGNRAYSDRRLRRVLESKQANILRTFLRDD 213

Query: 231 VYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNIS 289
            +  +R+ FD++ +R FY  RGY   +V S+ V F +++  + L+  I EG+ ++ G IS
Sbjct: 214 TFIADRIEFDKQVLRDFYLSRGYVDFRVNSANVEFTRERDAFYLVMNITEGQKFSFGKIS 273

Query: 290 IQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFA 349
             S +  +      + +R++ G  Y+P  I+ S  ++ +        F+RV+ R+ R+  
Sbjct: 274 TVSEIPGVDAAEYQAALRVKPGVTYSPTLIENSIARLERLGLKNGVDFLRVEPRVTRNDR 333

Query: 350 KRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMA 409
              +D+++++ +G  ++V+RI+IEGN  + D VIRR+ +  EGDP N   I ++  RI A
Sbjct: 334 DLTLDVQFVLTKGPRIFVERIDIEGNTTTLDRVIRRQFDTVEGDPFNPREIRQSAERIRA 393

Query: 410 TGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFG 469
            G+F+  ++     +  S  VI+ V V++   GS+ +  +Y V  G G+   +++ NF G
Sbjct: 394 LGFFAVADVETREGSSPSQ-VIVDVDVEEQPTGSLSLGGSYSVSDGFGIAIGLEERNFLG 452

Query: 470 QGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPI--SAGFDLQKTHLEDGSLDINDESAAV 527
           +G    +     + A Q Y  +  +PY LG  +    G  L   +    S D        
Sbjct: 453 RGQELGVTLSTAQDAEQ-YILNFSEPYLLGRRLRFDLGLGLSSANSSFASYDTKTVFFNP 511

Query: 528 RMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLD 587
           ++   I E      +Y+    +     + E   ++ ++ I  GK S+ S+  + +Y++  
Sbjct: 512 QLSYSIGELSLLRLRYNWNDSEM-TQQDDEVNGAVISSEIAQGKRSTSSLGLTYVYDSRI 570

Query: 588 NPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCVIPS 646
             + P  G+L     D AG GGD++Y +  +RA +   +L+++  +  +L  G       
Sbjct: 571 GGLNPNAGVLFEVGVDAAGLGGDNKYFKTSARAIAQTKVLNEEMTLRATLETG-ALHWQG 629

Query: 647 NKNLQLFDQFSVSSNYYLRGFAYKGIGPR---VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
           +   +  D++ +  N + RGF   G+GPR     +  AIGG  Y  A     FP+ L PE
Sbjct: 630 DDFSRTLDRYVLGPNIF-RGFEPAGLGPRDLSNGQDDAIGGNYYWVARFESDFPLGL-PE 687

Query: 704 RAGLRGAFFVDSATLY--ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
             GLRG  F D   L+   N    GA+ + G D   R   GV ++W++P G +   +   
Sbjct: 688 ELGLRGGVFYDVGNLWDIGNVDTTGAN-IVGADGSIRHVIGVSLLWDTPFGPLRFNFSQA 746

Query: 762 LRHREGDKIQQFGFRIGNRM 781
           ++  E DK Q F F I  R 
Sbjct: 747 VKKEEFDKEQNFDFTIQARF 766


>gi|227114695|ref|ZP_03828351.1| outer membrane protein assembly factor YaeT [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 809

 Score =  280 bits (715), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 212/808 (26%), Positives = 369/808 (45%), Gaps = 64/808 (7%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ + ++ 
Sbjct: 6   LLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIGNTIRA 65

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAY 144
           ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  + +   R   A 
Sbjct: 66  LFATGNFEDVRVLRDGETLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVRVGEAL 125

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D   + +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  VGN
Sbjct: 126 DRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINIVGN 185

Query: 205 KNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
           K +S   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S+QV
Sbjct: 186 KAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNIDSTQV 245

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
                K G  +   + EGE Y +  ++++  L       +  L +I  G LYN  ++   
Sbjct: 246 SLTPDKKGIYITINMTEGEQYKLSGVAVKGNLAG-HSAEIEGLTKIEPGELYNGTKVTRM 304

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
            E I K        + RV T+   + A + V +   +D G+  YV+ I  +GND S DSV
Sbjct: 305 EEDIKKLLGRYGYAYPRVVTQPEINDADKTVKLNINVDAGNRFYVRHIRFDGNDTSKDSV 364

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           +RRE+   EG  +   ++E+ K R+   GYF  V++       V+D V +   VK+ + G
Sbjct: 365 LRREMRQMEGAWLGNDLVEQGKERLNRLGYFESVDVETQRVPGVADQVDVTYKVKERNTG 424

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSP 501
           +      +  + G+  +  +  +N+ G G    ++    ++  Q Y   S+ DPYF    
Sbjct: 425 TFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISG--TKNDYQTYVELSLTDPYFTVDG 482

Query: 502 ISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G  +     E    D++D +         +  PI E  + S +  L ++       +
Sbjct: 483 VSLGGRIFYNKFEASDADLSDYTNVSYGVGSTLGFPINE--NNSLRVGLDYVHNDLSDMR 540

Query: 557 EKIP--------SIYTTLIEHGKFSSHS-------ISQSIIYNTLDNPIVPRKGMLISSS 601
            ++          +  ++++ G  SS         ++    YN LD    P KG   S++
Sbjct: 541 PQVAMWRYLDSVGVNPSVVQEGNKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASAN 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
              A  G D++Y+++   ++ +Y LSD  +  ++G  R G+   I   K +  +D F   
Sbjct: 601 AKIAVPGSDNEYYKLTFDSASYYPLSDSGNWVVMGRTRAGFADGI-GGKEVPFYDNFYAG 659

Query: 660 SNYYLRGFAYKGIGPR--------------------VDKKYAIGGKIYSSASAAVSFPMP 699
            +  +RGF    IGP+                     +   A+GG   +  SA +  P P
Sbjct: 660 GSSTVRGFQSNTIGPKAAYYKCAAGATSYSNCPIDSTNLDDAVGGNAMAVLSAELIVPTP 719

Query: 700 LVPER--AGLRGAFFVDSATLYANH-------VALGADKLEGNDSFWRVSTGVEIMWNSP 750
            + ++  + +R +FFVD  T++  +       +A G        +F RVS+G+ + W SP
Sbjct: 720 FISDKYASSVRTSFFVDGGTVWDTNWKNTPATIAAGVPDYSKASNF-RVSSGIALQWMSP 778

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P++  +GDK +QF F IG
Sbjct: 779 LGPLVFSYAQPVKKYDGDKSEQFQFNIG 806


>gi|261379556|ref|ZP_05984129.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           subflava NJ9703]
 gi|284798030|gb|EFC53377.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           subflava NJ9703]
          Length = 800

 Score =  280 bits (715), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 196/777 (25%), Positives = 357/777 (45%), Gaps = 50/777 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +DA  +  +K +YA G+F +V+++ +D+ ++
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDNFNDARSEEIIKKLYATGFFDDVRVETMDNQVL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I+ L  +G   L++D +K  + +   A    +++ T+N  V  +K+ Y S G
Sbjct: 85  LTVIERPTISSLNITGAKMLQNDAIKKNLEAFGLAQSQYFNQATLNQAVAGLKEEYLSRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
             +V +      ++   ++I   IEEG   KI  I F GN+ YS  RL + +S+   G +
Sbjct: 145 KQSVQITPTVTKLARNRVSIDIAIEEGKSTKITDISFEGNEVYSDRRLLKQMSLSEGGMW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  K++ +++++ + D E I  +Y + GY   ++  + +  ++ K+   +   + EG+ 
Sbjct: 205 TWVTKSNQFNEQKFAQDMEKITNYYQNNGYFNFRILDTDIQTNEDKTKQTIKVTVSEGDR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  GN+ I+    E+ K+ L  L+ ++ G  Y   ++  S E I          F  +  
Sbjct: 265 FRWGNVRIEGDTLEVPKEDLEKLLTMKPGKWYERAQMSNSLEAIQNRMGQAGYAFSEINV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +     VD    +  G  +YV  I I GN+++ D VIRREL   E  P + + ++R
Sbjct: 325 QPIPNAETHTVDFVLTVQPGRKIYVNEINITGNNKTRDEVIRRELRQMESAPYDSAKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P  +  D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPVANTPDQVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G    L A   +  V N + S  DPYF    +S G+D+       +K     
Sbjct: 445 AQDNLFGTGKSVALRASRSKTTV-NGSLSFTDPYFTPDGVSLGYDIYGKTYDPRKASSSA 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH---GKF 572
                      +R+ +P+TE    +F      L    ++  +  P  Y   I     G  
Sbjct: 504 KQYKTTTFGGGLRIGIPVTEYDRVNFGLAAERL---TVNTYKGAPKRYADFINQYGKGNG 560

Query: 573 SSHSISQSIIY--------NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFY 624
           +     +  +Y        N  DN + P +G L   + + A  G D QY+ +    ++F+
Sbjct: 561 NGVGNFKGWLYKGTIGWGRNKTDNALWPTRGYLTGVNGEIALPGSDLQYYTLTHNQTWFF 620

Query: 625 LLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKY 680
            LS D  ++     GYG      K +  F+ F       +RGF    +GP+V     +K 
Sbjct: 621 PLSKDFTLMLGGEVGYGNGYGKTKTMPFFENFYGGGLGSVRGFESGTLGPKVYDEYGEKI 680

Query: 681 AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY-------------------AN 721
           + GG   ++ SA + FPMP + +   +R + F D+ +++                    N
Sbjct: 681 SYGGNKKANVSAELLFPMPGIKDSRTVRLSLFADAGSVWDDKTYNDSSSNSYYTNGALQN 740

Query: 722 HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
              +G        +  R S G  + W SPLG M   Y  P++ +EGD+IQ+F F++G
Sbjct: 741 VYGVGTTHKSTFKNELRYSAGAAVTWLSPLGPMKFSYAYPIKKKEGDEIQRFQFQLG 797


>gi|319638841|ref|ZP_07993599.1| outer membrane protein omp85 [Neisseria mucosa C102]
 gi|317399745|gb|EFV80408.1| outer membrane protein omp85 [Neisseria mucosa C102]
          Length = 800

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 196/777 (25%), Positives = 357/777 (45%), Gaps = 50/777 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +DA  +  +K +YA G+F +V+++ +D+ ++
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDNFNDARSEEIIKKLYATGFFDDVRVETMDNQVL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I+ L  +G   L++D +K  + +   A    +++ T+N  V  +K+ Y S G
Sbjct: 85  LTVIERPTISSLNITGAKMLQNDAIKKNLEAFGLAQSQYFNQATLNQAVAGLKEEYLSRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
             +V +      ++   ++I   IEEG   KI  I F GN+ YS  RL + +S+   G +
Sbjct: 145 KQSVKITPTVTKLARNRVSIDIAIEEGKSTKITDISFEGNEVYSDRRLLKQMSLSEGGMW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  K++ +++++ + D E I  +Y + GY   ++  + +  ++ K+   +   + EG+ 
Sbjct: 205 TWVTKSNQFNEQKFAQDMEKITNYYQNNGYFNFRILDTDIQTNEDKTKQTIKVTVSEGDR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  GN+ I+    E+ K+ L  L+ ++ G  Y   ++  S E I          F  +  
Sbjct: 265 FRWGNVRIEGDTLEVPKEDLEKLLTMKPGKWYERAQMSNSLEAIQNRMGQAGYAFSEINV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +     VD    +  G  +YV  I I GN+++ D VIRREL   E  P + + ++R
Sbjct: 325 QPIPNAETHTVDFVLTVQPGRKIYVNEINITGNNKTRDEVIRRELRQMESAPYDSAKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P  +  D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPVANTPDQVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G    L A   +  V N + S  DPYF    +S G+D+       +K     
Sbjct: 445 AQDNLFGTGKSVALRASRSKTTV-NGSLSFTDPYFTPDGVSLGYDIYGKTYDPRKASSSA 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH---GKF 572
                      +R+ +P+TE    +F      L    ++  +  P  Y   I     G  
Sbjct: 504 KQYKTTTFGGGLRIGIPVTEYDRVNFGLAAERL---TVNTYKGAPKRYADFINQYGKGNG 560

Query: 573 SSHSISQSIIY--------NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFY 624
           +     +  +Y        N  DN + P +G L   + + A  G D QY+ +    ++F+
Sbjct: 561 NGVGNFKGWLYKGTIGWGRNKTDNALWPTRGYLTGVNGEIALPGSDLQYYTLTHNQTWFF 620

Query: 625 LLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKY 680
            LS D  ++     GYG      K +  F+ F       +RGF    +GP+V     +K 
Sbjct: 621 PLSKDFTLMLGGEVGYGNGYGKTKTMPFFENFYGGGLGSVRGFESGTLGPKVYDEYGEKI 680

Query: 681 AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY-------------------AN 721
           + GG   ++ SA + FPMP + +   +R + F D+ +++                    N
Sbjct: 681 SYGGNKKANVSAELLFPMPGIKDSRTVRLSLFADAGSVWDDKTYDNSSSNTYYTNGALQN 740

Query: 722 HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
              +G        +  R S G  + W SPLG M   Y  P++ +EGD+IQ+F F++G
Sbjct: 741 VYGVGKTHKSTFKNELRYSAGAAVTWLSPLGPMKFSYAYPIKKKEGDEIQRFQFQLG 797


>gi|149202645|ref|ZP_01879617.1| outer membrane protein, OMP85 family [Roseovarius sp. TM1035]
 gi|149143927|gb|EDM31961.1| outer membrane protein, OMP85 family [Roseovarius sp. TM1035]
          Length = 778

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 194/760 (25%), Positives = 367/760 (48%), Gaps = 25/760 (3%)

Query: 26  GFIILFYAIFGLSAVYGSNTSIVR--RIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           G   LF+ +F L     ++    R   + I G   +    ILS   +   +++S   L+ 
Sbjct: 24  GIFALFFVVFLLGTGQRADAQSYRFSSVAIEGNQRIETGTILSYAGIARNETVSAGQLND 83

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA 143
           A + I   G F +V++    S L+I ++E   IN + F GN+ +KD+ L   ++S+S   
Sbjct: 84  AYQKILGSGLFEDVELVPQGSNLLIRVVEFPTINQIAFEGNDKIKDEDLAGFIQSKSRQV 143

Query: 144 YDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVG 203
           +       D   I +AY+  G +   V  +    S   +++ + I EG K ++  I FVG
Sbjct: 144 FSPTQAERDAGVISEAYSQNGRIAARVTPKVIRRSDNRVDLVFEIFEGRKIEVQRIGFVG 203

Query: 204 NKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVS-SQ 261
           NK +S  RL RV+  + +G   +  + D + ++R++FD + +  FY+ RG+   +V+ + 
Sbjct: 204 NKAFSDTRLRRVVESKQTGLLRALIERDTFVEDRVNFDRQVLSDFYNSRGFVDFRVTGTN 263

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
               +++  Y + F I EG+ +  G I+  S +  ++ +     ++I+ G +Y+P  ++ 
Sbjct: 264 AELARERDAYFVTFNIQEGQQFRFGEITTVSEINGVEAEIYGDTLKIKPGVVYSPTLVES 323

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           S  ++ +        F+RV+ RI R+     +D+E++I +G  ++V+RI+IEGN  + D 
Sbjct: 324 SIARMERLALKNGVDFMRVEPRITRNDRDLTLDVEFVIQRGPRVFVERIDIEGNTTTLDR 383

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           VIRR+ + +EGDP N   I++A  RI A GYF +V+++    +   D V++   V++ + 
Sbjct: 384 VIRRQFDQAEGDPFNPRSIQQAADRIRALGYFEDVDVNAREGSR-PDQVVIETDVEETTT 442

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ-NYTFSVEDPYFLGS 500
           G+V +  ++  + G+GV     + NF G+G   +L A     A   NY     +P FLG 
Sbjct: 443 GTVSVGASFSTNSGLGVSLGFSERNFIGRG--QQLTAQILATADNINYNLGFVEPAFLGR 500

Query: 501 PISAGFD--LQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEK 558
            ++ G D   ++T  ++   D    +    +  P  E+   +  Y+     Y  +++ + 
Sbjct: 501 DVALGLDFSFRETESDNSLFDTAIGTFRPSLTFPTGENTRLNVYYN---TSYEDMTDYQG 557

Query: 559 IPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
              I    I  G   + S+  +  ++T    + P  G+L+S   ++AG GGD+ + +  +
Sbjct: 558 TSGILQNEIAQGGLWTSSVGYNFSFDTRAGGLNPNAGVLLSFGQEFAGLGGDNDFIKTTA 617

Query: 619 R-ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD 677
           R      +L++D  +   L  G       +++ +  ++F    +  +RGF   G+GP ++
Sbjct: 618 RLVGQTTVLNEDVTLRAILE-GGALNFSGSRDSRFLNRF---GSQVIRGFEPNGMGP-IE 672

Query: 678 KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA----NHVALGADKLEGN 733
               +GG  +++      FP+ L P+  G+ G  F D  +++       VA G + L   
Sbjct: 673 GNELLGGDFFAALKFEAEFPLGL-PDEYGITGGAFYDIGSIWGIGNRGSVAPG-NTLSST 730

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQF 773
               R   GV + W+SP G + + +   L    GD  Q F
Sbjct: 731 GFKARHVIGVSLFWSSPFGPIRMNFSKALEKEPGDIEQTF 770


>gi|85708131|ref|ZP_01039197.1| outer membrane protein [Erythrobacter sp. NAP1]
 gi|85689665|gb|EAQ29668.1| outer membrane protein [Erythrobacter sp. NAP1]
          Length = 916

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 214/855 (25%), Positives = 379/855 (44%), Gaps = 128/855 (14%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           SNT  +R I + GA  +    ILS I + VGQ  S A  D A+ ++YA   F+N  I+  
Sbjct: 74  SNT--IRSISVTGAERLEPSTILSYIRLRVGQDYSAAAADQALSDLYATELFANASIRNQ 131

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYAS 162
           D  ++I ++E  +IN +   GN+ L  D++   +R      +    V ADV  I + Y  
Sbjct: 132 DGNVVITVVENPVINRIVLEGNDRLDADKILPEIRLAPRQIFTRSKVRADVARIVELYKR 191

Query: 163 IGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG 222
            G     V+ Q   +    +++ + I EG K+K+  I  +GN+ +S   L   +  + + 
Sbjct: 192 QGRFAATVEPQMVQLPQNRVDVVFEITEGPKSKVRQINIIGNEEFSDGELRSEMVTKQAR 251

Query: 223 YFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEG 280
           +F F  ++  Y  +R++FD++ +R FY   GYA  +V S V      +  +++ + ++EG
Sbjct: 252 FFRFFSSNTSYDPDRLAFDQQKLRQFYLTEGYADFRVVSAVAELTPDQRDFIITYVVEEG 311

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
           E Y+ G++ ++S L++     L + + ++SG+ YN   ++++ E++++        F  V
Sbjct: 312 ERYSFGDVEVESQLRDFDSDALQAGLAMKSGDFYNAATVEDTVEQLTELAGRFGYAFADV 371

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
           + R NR+     +DI +++ Q   +Y++R+++ GN  + D V+RRE  LSEGD  N   +
Sbjct: 372 QPRFNRNPEDLTMDITFILRQAPRVYIERVDVNGNTLTQDKVVRREFRLSEGDAFNSLGV 431

Query: 401 ERAKRRIMATGYFSE-VNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVE 459
            R   RI + GYF E   ++Q+  +   D ++L  +V++   G +  +  +   +   + 
Sbjct: 432 ARTTARINSLGYFQENFEVNQVEGS-APDRIVLEANVEEQPTGELQFSAGFSSIERFILA 490

Query: 460 GHIDDNNFFGQGYRARLA---AGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDG 516
           G I   NF G+G    L+   + F R A  ++T    +PY     ISAG D+ +      
Sbjct: 491 GSIRQRNFRGRGQTIGLSLNYSQFSRSAQVSFT----EPYLFDRNISAGADIYRRDFNSF 546

Query: 517 SLDINDES---------AAVRMIVPITESISTSFKYDLRFLQYGAISEKEKI-------- 559
           + + ND            ++R+ VP+TE +S    Y    L Y  +S  E +        
Sbjct: 547 NFNRNDRQTTFEQSTTGGSIRVGVPLTEFMSLIGSYT---LNYDEVSLDENLFFSDIDGD 603

Query: 560 PSIYTTLIEHGKFSSHSISQ--------SIIYNTLDNPIVPRKGMLISSSYDYAGFGGDS 611
             I    +  G+F   ++          S+ YN+L++ + P +G  ++ S ++AG GGD 
Sbjct: 604 GDIECDPLRAGRFLCDALGNRLSSIAGLSLQYNSLNSLLRPTRGRRVTLSTEFAGLGGDV 663

Query: 612 QYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSN-------KNLQLFDQFSVSSNYYL 664
           QY R+  R   F+ +  +S  + SL    G +IP          ++ L D+F +    + 
Sbjct: 664 QYLRLRGRGQQFWNVF-NSGFIFSLSLEGGTIIPLEDRGGGGVDDILLTDRFFLGEPQF- 721

Query: 665 RGFAYKGIGPRV-DKKY----------------------------AIGGKIYSSASAAVS 695
           RGF  +G+GPR+  + Y                            +IGG+ Y    A + 
Sbjct: 722 RGFDIRGVGPRILTQPYVLDAFNNNQLDDDGNPILITERNRIRDDSIGGRNYYLGRAEIE 781

Query: 696 FPMPLVPERAGLRGAFFVDSATLYA--------NHVALGADKLEGNDSFW---------- 737
            P+       GLR + F+D   L+         N   L      GN  F           
Sbjct: 782 IPLGTGARELGLRPSIFLDVGALWGVEQPILQDNPTGLPQTDTNGNPLFISTETGELTTD 841

Query: 738 -------------------------------RVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
                                          R++ G+ + WNSP G   + +   +R  E
Sbjct: 842 PLASDGVTPNTRLIRTNSAIREVFLGDSPSPRITAGIGVNWNSPFGPFRIDFAQTIRKVE 901

Query: 767 GDKIQQFGFRIGNRM 781
           GD  + F F +G + 
Sbjct: 902 GDDDKTFTFNVGTQF 916


>gi|255020975|ref|ZP_05293030.1| Outer membrane protein assembly factor YaeT precursor
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969580|gb|EET27087.1| Outer membrane protein assembly factor YaeT precursor
           [Acidithiobacillus caldus ATCC 51756]
          Length = 781

 Score =  278 bits (711), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 211/760 (27%), Positives = 351/760 (46%), Gaps = 45/760 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V+ IEIRG  ++    + + +P+ + +++ D     A+K +Y+ G+F +V I      L+
Sbjct: 37  VKNIEIRGLEHIAPGTVYNYLPIHISETVDDQKAQQAIKELYSTGFFKDVTIARSGDDLL 96

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAYDEDTVNADVHNIKQAYASIG 164
           + + ER II  +   G      D+L+   +         ++   ++  V  ++Q Y  +G
Sbjct: 97  VVVQERPIIASIRTKGIKAFSKDELQGTFKGIGLEERHIFNRAVLDQVVQGLQQQYEGMG 156

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
           Y N  +      +    + I   + +G +A I  +  VGN  +S +RL  + SI     F
Sbjct: 157 YYNAKITTHVEKLPRNRVAIDIDVHQGEQATIKQVTIVGNHAFSESRLRGLFSIGAPDAF 216

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           SF  K D YS+E++    E +  FY DRGY    + SSQV     +    +   I EG +
Sbjct: 217 SFFTKNDRYSREKLEKSLEKLHDFYLDRGYLNFAIESSQVQVTPNRRYVYITVNIHEGPV 276

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISK------YFFSGERP 336
           Y +  + +   L  + +K L  L+ ++ G  ++ + I  +++ I++      Y F+   P
Sbjct: 277 YRISKVELTGNLV-LPRKDLEKLVEVKPGERFSRERINATNQAIAEKLGDYGYAFANTTP 335

Query: 337 FVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPIN 396
              V      D  K  V I++ +D G+ +Y++RIEI GND+S D VIRR+    EG   N
Sbjct: 336 VPEV------DEKKHEVAIDFQVDPGNRVYIRRIEISGNDKSRDYVIRRQFRQMEGALYN 389

Query: 397 YSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGM 456
             +I+R+K R+  TG+F +V+   +P     D + L V V +   GS  +   Y   +G 
Sbjct: 390 RELIDRSKLRLQQTGFFDKVDTKTVPVPGHPDELDLDVHVSERPTGSFSVGVGYSNAQGF 449

Query: 457 GVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDG 516
              G I  NNF G G     +A  G      Y  S  +PYF    IS GF+L +      
Sbjct: 450 LFNGSISQNNFMGTGNALSFSANVGGLGTA-YNLSFTNPYFTPDGISLGFNLYRNDTNLS 508

Query: 517 SLDIN-----DESAAVRMIVPITESI----STSFKYDLRFLQYGAISEKEKIPSIYTTLI 567
           +L I      D  A+V + +P+ E +    +  F +    LQ GA       P +Y   I
Sbjct: 509 TLAIAPYQEIDYGASVTLGIPVLEYVYDYMTLGFDHTNINLQNGA-----NYP-LYQNYI 562

Query: 568 EHGKFSSHSIS--QSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
           +    S++SI+    ++YN+ ++PI P KG+  S S   A   G  ++++   +A+Y++ 
Sbjct: 563 DLYGNSANSITLGNDLVYNSTNSPIFPTKGVYGSLSLKAAVPPGKLRFYKAEIKANYYHP 622

Query: 626 LSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGG 684
            +  S + G L   YG +   S K +  FD F +     L G+    +GP++D  Y +GG
Sbjct: 623 FT--SWLSGGLGARYGFINSYSGKPVPFFDNFYLGGPTTLPGYQTYALGPQID-GYPVGG 679

Query: 685 KIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSF-----WRV 739
                  A + FP+P + +    R   FV S  +Y        +    N+ F      R 
Sbjct: 680 TRELLLDANLYFPLPGLQDNKNFRMNLFVASGWVYGVSADSAGNFQYTNNYFPSLGNLRT 739

Query: 740 STGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
           + GV  +W SPLG + +   IPL  + GD  Q   F +GN
Sbjct: 740 TAGVGFLWISPLGPLRLSLAIPLDKKPGDLTQPLQFTVGN 779


>gi|238792747|ref|ZP_04636378.1| Outer membrane protein assembly factor yaeT [Yersinia intermedia
           ATCC 29909]
 gi|238727855|gb|EEQ19378.1| Outer membrane protein assembly factor yaeT [Yersinia intermedia
           ATCC 29909]
          Length = 794

 Score =  278 bits (710), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 218/796 (27%), Positives = 369/796 (46%), Gaps = 49/796 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+   
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIGKT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN +++   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLEILRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y + ++ +   L   Q      L+ I  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSDAD-KLVAIEPGELYNGSKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S 
Sbjct: 302 TRMEEGIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     Y  + G+  +  +  +N+ G G    +     ++  Q Y  F++ DPYF 
Sbjct: 422 NTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGING--TKNDYQTYAEFTLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDIN---DESAAV--RMIVPITESISTSFKYDLRFLQYGAI 553
              +S G  +     +  + D++   + S  V   +  PI E  + S +  L ++ +  +
Sbjct: 480 VDGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINE--NNSLRVGLGYV-HNDL 536

Query: 554 SEKEKIPSIY---------TTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGMLISSSY 602
           S+ E   +++           L +   F++   + ++   YN LD    P  G+  S + 
Sbjct: 537 SDMEPQVAMWRYLDSVGQDPNLTDRASFTADDFTLNLGWTYNNLDRGFFPTSGVKSSVNT 596

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D+++++I    S +  L +D    ++G  R GYG  I S K +  ++ F    
Sbjct: 597 KVTVPGSDNEFYKITFDTSAYQPLDEDHSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGG 655

Query: 661 NYYLRGFAYKGIGPRV----------DKKYAIGGKIYSSASAAVSFPMPLVPER--AGLR 708
           +  +RGF    IGP+           D   A+GG   + AS  +  P P + E+    +R
Sbjct: 656 SSTVRGFRSNNIGPKAAYYNANGTIRDSTDAVGGNAMAVASLELITPTPFISEKYSNSVR 715

Query: 709 GAFFVDSATLY-ANHVALGADKLEG-----NDSFWRVSTGVEIMWNSPLGMMGVYYGIPL 762
            +FF+DS T++  N     A +  G       S  RVS GV + W SPLG +   Y  P+
Sbjct: 716 TSFFIDSGTVWDTNWENTAATRAAGIPDYSTASNIRVSAGVSLQWMSPLGPLVFSYAKPV 775

Query: 763 RHREGDKIQQFGFRIG 778
           +  EGDK +QF F IG
Sbjct: 776 KDYEGDKSEQFQFNIG 791


>gi|227326544|ref|ZP_03830568.1| outer membrane protein assembly factor YaeT [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 810

 Score =  277 bits (709), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 215/808 (26%), Positives = 366/808 (45%), Gaps = 63/808 (7%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ + ++ 
Sbjct: 6   LLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIGNTIRA 65

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAY 144
           ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  + +   R   A 
Sbjct: 66  LFATGNFEDVRVLRDGETLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVRVGEAL 125

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D   + +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  VGN
Sbjct: 126 DRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINIVGN 185

Query: 205 KNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
           K +S   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S+QV
Sbjct: 186 KAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNIDSTQV 245

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
                K G  +   + EGE Y +  ++++  L       +  L +I  G LYN  ++   
Sbjct: 246 SLTPDKKGIYITINMTEGEQYKLSGVAVKGNLAG-HSAEIEGLTKIEPGELYNGTKVTRM 304

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
            E I K        + RV T+   + A + V +   +D G+  YV+ I  +GND S DSV
Sbjct: 305 EEDIKKLLGRYGYAYPRVVTQPEINDADKTVKLNINVDAGNRFYVRHIRFDGNDTSKDSV 364

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           +RRE+   EG  +   ++E+ K R+   GYF  V++       V+D V +   VK+ + G
Sbjct: 365 LRREMRQMEGAWLGNDLVEQGKERLNRLGYFESVDVETQRVPGVADQVDVTYKVKERNTG 424

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSP 501
           +      +  + G+  +  +  +N+ G G    ++    ++  Q Y   S+ DPYF    
Sbjct: 425 TFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISG--TKNDYQTYVELSLTDPYFTVDG 482

Query: 502 ISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYD------------ 544
           +S G  +     E    D++D +         +  PI E+ S     D            
Sbjct: 483 VSLGGRIFYNKFEASDADLSDYTNVSYGVGSTLGFPINENNSLRVGLDYVHNDLSDMRPQ 542

Query: 545 ---LRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
               R+L    ++  E +           K +   ++    YN LD    P KG   S++
Sbjct: 543 VAMWRYLDSVGVN-PEVVAGTNNKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASAN 601

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
              A  G D++Y+++   ++ +Y L+D     ++G  R G+   I S K +  +D F   
Sbjct: 602 AKIAVPGSDNEYYKLTFDSASYYPLTDSGKWVVMGRTRAGFADGIGS-KEVPFYDNFYAG 660

Query: 660 SNYYLRGFAYKGIGPR-----------------VDKKY---AIGGKIYSSASAAVSFPMP 699
            +  +RGF    IGP+                 +DK     A+GG   +  SA +  P P
Sbjct: 661 GSSTVRGFQSNTIGPKAAYYNCAVGATSYSGCPIDKTNLDDAVGGNAMAVLSAELIVPTP 720

Query: 700 LVPER--AGLRGAFFVDSATLYANH-------VALGADKLEGNDSFWRVSTGVEIMWNSP 750
            + ++  + +R +FFVD  T++  +       +A G        +F RVS+G+ + W SP
Sbjct: 721 FISDKYASSVRTSFFVDGGTVWDTNWKNTPATIAAGVPDYSKASNF-RVSSGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P++  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPVKKYDGDKSEQFQFNIG 807


>gi|94496934|ref|ZP_01303508.1| surface antigen (D15) [Sphingomonas sp. SKA58]
 gi|94423610|gb|EAT08637.1| surface antigen (D15) [Sphingomonas sp. SKA58]
          Length = 880

 Score =  276 bits (707), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 208/833 (24%), Positives = 378/833 (45%), Gaps = 105/833 (12%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           +R I + G   +  + +LS   + +GQ  S   LD  ++++Y    F++V+I+  +  L 
Sbjct: 52  IRSITVTGTQRLEPDTVLSYTKLRIGQPYSQESLDQGLRDLYETELFADVQIRNDNGALT 111

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           +++ E  +IN +   GN  LKDD+++  ++      Y    V ADV  I + Y   G   
Sbjct: 112 VEVKENPVINRIVLEGNKRLKDDKIRPEIKLAPRQIYTRSKVRADVARIVELYRRQGRFA 171

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-F 226
             ++ +   +    ++I + I EG K+K+  I  +GN  +S   L   +  + S +F  F
Sbjct: 172 ATIEPKMVQLDQNRVDIVFEISEGPKSKVRQINIIGNDKFSDGELRSEMVTKQSRWFRIF 231

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
                Y  +R+++D++ +R FY   GYA  +V S V      K  +++ + ++EG+ Y  
Sbjct: 232 SSGTSYDPDRLAYDQQKLRQFYLTEGYADFRVISAVAELTPDKQDFIITYVVEEGDRYKF 291

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G++ ++S ++++  ++L   + +++G+ YN ++++++ + +S+        F  V+   N
Sbjct: 292 GDVKVESDIRDLSGESLTKRLPMKTGDWYNAKQVEDTVDTLSETAGLFGYAFADVQPDFN 351

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           R+     + I + I     +YV+R++I GN  + D VIRRE  L+EGD  N  +++R+K 
Sbjct: 352 RNKEDLTMGINFRIANAPRVYVERVDINGNTLTQDKVIRREFRLAEGDAFNSFLVKRSKD 411

Query: 406 RIMATGYFSE-VNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDD 464
           RI + G+F E ++I Q P +   D ++L  +V++ S G + ++  +   +   V   I  
Sbjct: 412 RINSLGFFQEKLDIEQKPGS-APDRIVLETNVQEKSTGELSLSAGFSSLERFIVAASITQ 470

Query: 465 NNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL----------E 514
            NF G+G   R +  +  ++ ++      +PYF+   I+ G D+ +  L           
Sbjct: 471 RNFRGKGQELRTSVNYSAYS-KSIEVGFTEPYFMDKNIALGGDIYRRDLNSFRYLTNNDR 529

Query: 515 DGSLDINDESAAVRMIVPITESISTSFKYDLRF-------LQYGAISEKEKIPSIYTTLI 567
           D + +       +R  VPITE +S + +Y L F        Q+    + + + +      
Sbjct: 530 DTTYEQTTTGFQIRAGVPITEYMSLALRYSLNFDDVTLDRDQFYTDGQCDPLLAGRYLCD 589

Query: 568 EHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLS 627
             GK ++ S+  S+IY+T DN I P +G  +  S D+AG GGD +Y +    AS F+ L 
Sbjct: 590 AIGKRTTSSVGYSLIYDTRDNRIRPTRGNNVVLSQDFAGLGGDVKYIKTRLSASKFWPLG 649

Query: 628 DDSDIVGSLRFGYGCVIPS------NKNLQLFDQFSVSSNYYL-----RGFAYKGIGPRV 676
             +  + SL  G G  I S      + + Q  D+  +   ++L     RGF  +G+GPR+
Sbjct: 650 --AGFIFSLS-GEGGYIHSLEGERRDASGQEVDKIRLVDRFFLGEPQFRGFDIRGVGPRI 706

Query: 677 DKKY-------------------------AIGGKIYSSASAAVSFPMPLVPERAGLRGAF 711
            ++Y                         A+GGKIY  A A V  P+       GLR + 
Sbjct: 707 VRRYYSATVGDDGVATGEPITGRNNRTDDALGGKIYYLARAEVQIPLGSAAREMGLRPSI 766

Query: 712 FVDSATL--------------------------------YANHVA---LGAD-------- 728
           F+D+  +                                 AN V     G D        
Sbjct: 767 FMDAGAVAGLKEPGLINGNGQFAGFCNASGQTQVRAGGTAANPVCPASFGTDYTVSGGFE 826

Query: 729 -KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
            +  G+    R+S G  + WNSP G   +     L    GD  +   F +G +
Sbjct: 827 EQYLGDTLKPRLSVGFGVNWNSPFGPFRIDIAKALLKEPGDDNKLITFNVGTQ 879


>gi|254805774|ref|YP_003083995.1| probable surface antigen [Neisseria meningitidis alpha14]
 gi|254669316|emb|CBA08329.1| probable surface antigen [Neisseria meningitidis alpha14]
 gi|325197469|gb|ADY92925.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis G2136]
          Length = 797

 Score =  276 bits (707), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 198/774 (25%), Positives = 356/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKQYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|83942316|ref|ZP_00954777.1| outer membrane protein, OMP85 family protein [Sulfitobacter sp.
           EE-36]
 gi|83846409|gb|EAP84285.1| outer membrane protein, OMP85 family protein [Sulfitobacter sp.
           EE-36]
          Length = 786

 Score =  276 bits (707), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 194/736 (26%), Positives = 360/736 (48%), Gaps = 23/736 (3%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           ++I G   +G   ILSR  +  G++IS  +L+ A +N+ A G F +V ++     L+I +
Sbjct: 53  VQIDGNERIGDSAILSRAGIARGRAISAGELNDAYQNLQASGLFESVALEPRGGTLVITV 112

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   IN + F GN  + D+ L  +V S     ++      D + I QAY++ G +   V
Sbjct: 113 VEFPTINRISFEGNARIDDEALASVVDSDERRVFNPTQAEKDANAIAQAYSNDGRIAARV 172

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-FGKT 229
           + +        +++ + + EG   +I  + FVGN+ YS  RL RV+  + +G F    K 
Sbjct: 173 QPKVIRRDQNRVDLVFEVFEGDNVEIERLSFVGNRQYSDRRLRRVLGTKQAGLFRRLIKR 232

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D +  ER+  D++ +R FY  RGY  +++S+      +++ GY + F + EG+ +  G +
Sbjct: 233 DTFVPERIEADQQMLRDFYLSRGYVDMRISAANAQLTEERDGYFVQFNVQEGQQFKFGEL 292

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ ST+  +       +I+ +SG +Y+P  ++    ++ +        F+RV+  + R+ 
Sbjct: 293 TVTSTINGVNADDYRGVIKTKSGAVYSPSLVETDIARMERKAIRDGVDFLRVEPVVTRND 352

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +++EY I +G  ++V+RI+IEGN  + D V+RR+ +  EGDP N   I  +  RI 
Sbjct: 353 RDLTLNVEYRISRGPRVFVERIDIEGNTTTLDRVVRRQFDSVEGDPFNPREIRESAERIR 412

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A GYF    ++    +     V+    V+Q   GS+    ++    G+GV     ++NF 
Sbjct: 413 ALGYFESAEVNAREGSSPEQVVVDVNVVEQ-PTGSLNFGGSFSSSDGIGVAVSFAEDNFL 471

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQ--KTHLEDGSLDINDESAA 526
           G+G + +L       A Q Y F+  +P  LG  ++ G +L   +T     S D       
Sbjct: 472 GRGQKLKLTVSTAEDA-QRYGFNFIEPSLLGRDVAFGLNLDYAETSSSYNSFDTERIVFQ 530

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPS--IYTTLIEHGKFSSHSISQSIIYN 584
             +  P++E+   S  Y    L+   +SE++   +  +    I  G+  + SI  +  Y+
Sbjct: 531 PTLSFPVSENGRLSLNYTYDDLE---MSERDDTTTGFVVANDIAAGRQVTSSIGYNYSYD 587

Query: 585 TLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCV 643
           T    + P  G+L+    D+AG GGD+++ +  ++A     + +++  +  +L+   G +
Sbjct: 588 TRRAGLDPTSGVLLQFGQDFAGLGGDTKFVKTTAKAIGEKRIFNEEVTLRATLQ--GGAL 645

Query: 644 IPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKK---YAIGGKIYSSASAAVSFPMPL 700
             S  N ++ D+F +  +  +RGF   GIGPR        ++GG ++   S    FP+ L
Sbjct: 646 AWSEGNNRVSDRFLIGPS-IMRGFETGGIGPRDQSNGSDDSLGGNLFVVGSLEAEFPLGL 704

Query: 701 VPERAGLRGAFFVDSATLYA---NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
            PE  G+ G  F D   ++      +  G+  +  + SF  V  GV + W++P+G +   
Sbjct: 705 -PEEYGISGGVFYDVGNVWNLDDVEIPTGSSIVGESGSFRHV-IGVSLFWDTPVGPLQFN 762

Query: 758 YGIPLRHREGDKIQQF 773
               L+  + D+ Q+F
Sbjct: 763 VSKALKKEDYDEEQKF 778


>gi|240017504|ref|ZP_04724044.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae FA6140]
 gi|240081644|ref|ZP_04726187.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae FA19]
 gi|240118880|ref|ZP_04732942.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae PID1]
 gi|268597741|ref|ZP_06131908.1| outer membrane protein [Neisseria gonorrhoeae FA19]
 gi|268604589|ref|ZP_06138756.1| outer membrane protein OMP85 [Neisseria gonorrhoeae PID1]
 gi|268551529|gb|EEZ46548.1| outer membrane protein [Neisseria gonorrhoeae FA19]
 gi|268588720|gb|EEZ53396.1| outer membrane protein OMP85 [Neisseria gonorrhoeae PID1]
          Length = 792

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 196/771 (25%), Positives = 353/771 (45%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  ++D + +++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAGTKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI-EHGKFSS 574
                      VRM +P+TE    +F      L    ++   K P  Y   I ++GK   
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIKQYGKTDG 560

Query: 575 HSIS-QSIIY--------NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              S + ++Y        N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGLLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++       A+   GN+       
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGRTYTAAE--NGNNKSVYSEN 738

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 739 AHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 789


>gi|325143196|gb|EGC65536.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis 961-5945]
          Length = 797

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 198/774 (25%), Positives = 356/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|254465698|ref|ZP_05079109.1| outer membrane protein assembly complex, YaeT protein
           [Rhodobacterales bacterium Y4I]
 gi|206686606|gb|EDZ47088.1| outer membrane protein assembly complex, YaeT protein
           [Rhodobacterales bacterium Y4I]
          Length = 800

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 196/754 (25%), Positives = 349/754 (46%), Gaps = 29/754 (3%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           +++ G   +    +++   +  GQ++S  +L+ A + I   G F  V+I    S L+I +
Sbjct: 53  VQVEGNQRIQTSTVVAYTGIERGQTVSAGELNDAYQRILDSGVFETVEIVPRGSTLVIKV 112

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   IN + F GN  LKDD L  I+ S     +       D   I +AY+  G L   V
Sbjct: 113 TEFPTINQISFEGNRRLKDDALSDIIESAPRRVFSPSQAERDAALIAEAYSVQGRLASRV 172

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + I EG   ++  + F GN+ YS  RL RV+  + +G   +F ++
Sbjct: 173 TPRIIRRSNNRVDLVFEISEGDTVEVERVSFTGNRVYSDRRLRRVLETKQAGLLRTFIRS 232

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D   ++R+ FD++ +R FY  RGY   +V S+     +++    L+  + EG+ +  GNI
Sbjct: 233 DTLIEDRLEFDKQVLRDFYLSRGYVDFRVNSANAEVTQERDAVFLVVDVTEGQQFRFGNI 292

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           S+ S + E       S ++IR G +Y+P  ++ + +++       E  F+RV+ R+ R+ 
Sbjct: 293 SVTSEMPEADADLFSSTLKIRPGVVYSPTLVENAIDRMEGLAVRNEIDFLRVEPRVTRND 352

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +DIE+++ +G  ++V+RI+IEGN  + D VIR++    EGDP N   I  +  RI 
Sbjct: 353 RDLTLDIEFVLTRGPRVFVERIDIEGNTTTLDRVIRQQFRSVEGDPFNPRSIRNSAERIR 412

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A GYF+  ++     +  S+ VI+ V V++   GS+ +   Y V  G GV   + +NNF 
Sbjct: 413 ALGYFANADVETREGSS-SNQVIVDVDVEEQPTGSLNLGGAYSVTDGFGVSVGLSENNFL 471

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVR 528
           G+G R          +  +Y     +PY LG  +    DL     +    +   +    R
Sbjct: 472 GRGQRLSFNIATATES-DSYVLGFTEPYLLGRKLRFDLDLGLNETDSSFSEYKTKRVFFR 530

Query: 529 MIVPI----TESISTSFKYDLRFLQYGAISEKEKIPS-IYTTLIEHGKFSSHSISQSIIY 583
             +        S+   + +D   + +      + +   +  + I  G+ +S +   +  Y
Sbjct: 531 PALTFDTGEDSSVQVRYTWDSDEMLFDDDDTNQNLAGPVIRSEIAQGELNSSAFGVTYRY 590

Query: 584 NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR-ASYFYLLSDDSDIVGSLRFGYGC 642
           ++    + P  G L+    DYAG GGDS+Y +  ++  +   + +++  I  ++  G   
Sbjct: 591 DSRLTGLDPNAGFLVEVGADYAGLGGDSEYIKATTKLVAQRRIWNEEVTIRATVEAG-AF 649

Query: 643 VIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYA----------IGGKIYSSASA 692
                 N +  D+F ++ +  +RGF   GIGPR D+             +GG  Y+ A  
Sbjct: 650 QWQGGGNSRTIDRFVLTPS-VMRGFEPGGIGPR-DQTDGNPNGGNYNDFLGGNYYAVARF 707

Query: 693 AVSFPMPLVPERAGLRGAFFVDSATLYA----NHVALGA-DKLEGNDSFWRVSTGVEIMW 747
              FP+ L PE  GLRG  F D   L+     N   L + + + G D  +R   G  ++W
Sbjct: 708 DAEFPLGL-PEELGLRGGLFYDVGGLWGLQDVNTAGLNSGNGIVGRDRSFRHVVGFSLLW 766

Query: 748 NSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G +   +   L+  + D+ Q F   +  R 
Sbjct: 767 TTGFGPLRFNFSKALKKEDFDEEQAFDLTLQARF 800


>gi|194099959|ref|YP_002003098.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae NCCP11945]
 gi|239997967|ref|ZP_04717891.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae 35/02]
 gi|240113925|ref|ZP_04728415.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae MS11]
 gi|240124711|ref|ZP_04737597.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae SK-92-679]
 gi|260439583|ref|ZP_05793399.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae DGI2]
 gi|268593816|ref|ZP_06127983.1| outer membrane protein [Neisseria gonorrhoeae 35/02]
 gi|268599989|ref|ZP_06134156.1| outer membrane protein OMP85 [Neisseria gonorrhoeae MS11]
 gi|268683286|ref|ZP_06150148.1| outer membrane protein OMP85 [Neisseria gonorrhoeae SK-92-679]
 gi|291042819|ref|ZP_06568560.1| outer membrane protein Omp85 [Neisseria gonorrhoeae DGI2]
 gi|293398160|ref|ZP_06642365.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           gonorrhoeae F62]
 gi|193935249|gb|ACF31073.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae NCCP11945]
 gi|268547205|gb|EEZ42623.1| outer membrane protein [Neisseria gonorrhoeae 35/02]
 gi|268584120|gb|EEZ48796.1| outer membrane protein OMP85 [Neisseria gonorrhoeae MS11]
 gi|268623570|gb|EEZ55970.1| outer membrane protein OMP85 [Neisseria gonorrhoeae SK-92-679]
 gi|291013253|gb|EFE05219.1| outer membrane protein Omp85 [Neisseria gonorrhoeae DGI2]
 gi|291611423|gb|EFF40493.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           gonorrhoeae F62]
 gi|317165411|gb|ADV08952.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 792

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 196/771 (25%), Positives = 353/771 (45%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  ++D + +++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTRQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAGTKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI-EHGKFSS 574
                      VRM +P+TE    +F      L    ++   K P  Y   I ++GK   
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIKQYGKTDG 560

Query: 575 HSIS-QSIIY--------NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              S + ++Y        N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGLLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++       A+   GN+       
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGRTYTAAEN--GNNKSVYSEN 738

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 739 AHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 789


>gi|329850624|ref|ZP_08265469.1| outer membrane protein assembly complex, YaeT protein
           [Asticcacaulis biprosthecum C19]
 gi|328840939|gb|EGF90510.1| outer membrane protein assembly complex, YaeT protein
           [Asticcacaulis biprosthecum C19]
          Length = 791

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 204/754 (27%), Positives = 366/754 (48%), Gaps = 36/754 (4%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
           T+ V  I + G   +  + I+S +P   G ++    +D AVK +Y    FS+V+I++  S
Sbjct: 45  TAYVSAIRVEGNERIDNQTIVSYLPFQAGATVDAEMIDLAVKTLYRTDLFSDVQIQMQGS 104

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            +++ ++E  IIN + F GN  +  D+L+  V+ R    + +  V  DV  I + Y   G
Sbjct: 105 EMVVTVVESPIINQVVFEGNKAMTKDKLREEVQIRPRGVFTKAKVQEDVQRIVELYRKGG 164

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            +   V  +   +    +++ + I+EG K  ++ + FVGNK +S   L+ V+  + S ++
Sbjct: 165 RIAATVTPKIVELPQKRVDLIFEIDEGPKTGVSQVNFVGNKAFSDNDLKGVVVTQKSLWW 224

Query: 225 S-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEI 282
             F   D Y  +RM +D E +R FY +RGY   ++ S V      +  +V+ + +DEGE 
Sbjct: 225 KFFSSNDNYDPDRMDYDREQLRKFYTNRGYYDFRIISAVAELTPDRKDFVISYTLDEGEK 284

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y  G I+I++   +++ + L   + IR G LY    ++++ + ++    S    FV ++ 
Sbjct: 285 YNFGRITIKTDNDKLKAENLQRSVAIRPGQLYESDRVEKAVDDLTFAAGSSGFAFVDIRP 344

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   D   + VD+ + + +G+ +Y+ ++ I GN Q+ D VIRR++ +SEGD  N +++ER
Sbjct: 345 QEEADPNTKKVDLVFNVHEGARVYIDKVNIVGNTQTLDRVIRRQMLVSEGDAYNKALLER 404

Query: 403 AKRRIMATGYFSE----VNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGV 458
           ++  I   G+F E    V IS+ P+   +    + V+V +   G +     +   +   +
Sbjct: 405 SRIYIAGLGFFKEGEEGVKISEKPS-PAAGKTNIEVAVVEQPTGELSFGAGFSSIQKFIL 463

Query: 459 EGHIDDNNFFGQG--YRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDG 516
           +  I   NF G G   RAR+  G      ++  FS  +P F+G  +SAGFD+  +     
Sbjct: 464 DIGISQRNFRGTGQDVRARIQTG---SIQKDIDFSFTEPRFMGRNVSAGFDIFSSSYRYR 520

Query: 517 SLDINDES--AAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSS 574
            +D   ES  A +R+   +        +Y++R   Y + +       +Y+     G   +
Sbjct: 521 GVDFRTESSGAGLRLGYNLNGYSVLRLRYNIR-KDYISTTANNCDSLLYSC----GNGLT 575

Query: 575 HSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVG 634
            S+  S+ Y+  ++ I P +G       D AG GGD +Y      A +++      D++ 
Sbjct: 576 SSVGYSLSYDRRNDFIQPTRGWNAVLRQDIAGLGGDVKYVATEGEAHWYHGFR--KDMIL 633

Query: 635 SLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSASA 692
            +    G  +P    ++++ D+F    +  +RGF Y GIGPR +   YA+GG+ Y+  SA
Sbjct: 634 HVSGSAGTKVPWGGDSVRINDRFFKGGD-TMRGFEYAGIGPRDISSTYALGGQTYAIGSA 692

Query: 693 AVSFPMPLVPERAGLRGAFFVDSATL---------YANHVALGADKLEG--NDSFWRVST 741
            +  P  L P++ GL+ A F+D  TL         Y            G  +D   R+S 
Sbjct: 693 ELGVPNGL-PDQYGLKTALFLDIGTLGGIDKSLKVYGPGTTTPGQTNPGIRDDFTARISA 751

Query: 742 GVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
           G+ I W SP+G +       L   + DK++ F F
Sbjct: 752 GLTIRWKSPMGPIQFDLSQVLSKADYDKVETFRF 785


>gi|330993381|ref|ZP_08317316.1| Outer membrane protein assembly factor yaeT [Gluconacetobacter sp.
           SXCC-1]
 gi|329759411|gb|EGG75920.1| Outer membrane protein assembly factor yaeT [Gluconacetobacter sp.
           SXCC-1]
          Length = 805

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 218/774 (28%), Positives = 355/774 (45%), Gaps = 68/774 (8%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           +  ++I+G + +    ILS + V  G   +   LD ++K +YA G F +V +K V +VL 
Sbjct: 50  IEAVDIKGNSRIETSTILSYMVVQPGDRFNQDLLDRSLKTLYATGLFHDVTLKRVGNVLE 109

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + ++E  I+N + F GN++ KD+ L  ++  R  A Y    ++AD   I   YA      
Sbjct: 110 VHVVESPIVNRIVFEGNHSAKDEDLTKVISLRPRAVYSPQGISADRQKILGVYAEKARYA 169

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-F 226
             V  Q   ++   +++ + I E  K  I  + FVGN+ +S A L  V+S + + ++  F
Sbjct: 170 ATVTPQIIRLAHNRVDVIFHINEAQKTLIKKVSFVGNRAFSTAALAGVVSSKETAWYRFF 229

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYA--AVKVSSQVLFDKQKSGYVLIFQIDEGEIYT 284
             +D Y+ ERM +D E +  FY   G+    VK ++  L   +KS Y+  + +DEG  Y 
Sbjct: 230 ASSDQYNPERMKYDAELLHRFYLKNGFVDFQVKNATGELSPDRKSFYI-TYTVDEGPRYR 288

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
           +  + ++S+L+ +  +++   I +     Y+   I+ ++  + +       PF  V   I
Sbjct: 289 LNKMDVRSSLRHVSAESMRKYISLFHNQWYDGSAIQHNATDMQEMLQGKGYPFAMVHPEI 348

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAK 404
            R+  K  V++ + I +G  +YV+RI+I GN  + D VIRR+L ++EGDP  Y+ ++R  
Sbjct: 349 ARNPEKHTVNLLFDISEGPRMYVERIDINGNTITEDKVIRRQLPMAEGDP--YTPLDRKY 406

Query: 405 RRIMAT--GYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +++    G+F  V+I Q P +   D V +   V +   G   +   Y  D G+     +
Sbjct: 407 SKMILEDLGFFKTVSIDQTPGS-APDKVNISADVVEKPTGEFSLGGGYSTDAGVLGNLGL 465

Query: 463 DDNNFFGQGYRARLAAGFGRHAV---QNYTFSVEDPYFLGSPISAGFDL---QKTHLEDG 516
             +N  G G    + AGF   A         S+ DPYFL   + AG DL   Q  ++   
Sbjct: 466 KQHNLLGTG----IDAGFTGTAAYYEDQADISLTDPYFLNRNLVAGIDLFGIQNRYMTYQ 521

Query: 517 SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHS 576
           S         +RM       +S S+ Y L     G         S Y    ++G      
Sbjct: 522 SYSEARIGMTLRMGYSYNNHLSQSWSYTLTDRDIGDTWSD----SSYYIHDQNGWSLLSQ 577

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSD---DSDIV 633
           +S ++ Y+T D    P KG ++    D+AG GG+ +Y R    A+Y+  L     + D  
Sbjct: 578 LSTTLTYDTRDRRQQPHKGFVVRVGGDFAGIGGNERYLRGKVDAAYYIPLDSIMGNHDWT 637

Query: 634 GSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAI---------- 682
            S R G G ++        + D F +  N  LRGF   G+GPR    YAI          
Sbjct: 638 VSFRAGAGDIMNWGGGRSDIIDNFYLGGN-SLRGFMDGGVGPR---SYAIPARDGNVMHS 693

Query: 683 -----GGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL--------------YANHV 723
                GG+   +ASA V FP+P      G++G +FVD   L              +  + 
Sbjct: 694 QQDFLGGRFMYTASAQVDFPIPFA-SAMGIKGRYFVDMGGLDGLRVRRRYTSMKDWPKYT 752

Query: 724 ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQ--QFGF 775
            +  D L        VSTGV I W SP G++ +  G+PL     D+ Q  +FGF
Sbjct: 753 PVYDDTLTP-----VVSTGVGIAWKSPFGLVNIDLGVPLHKGTNDRTQLLRFGF 801


>gi|304388986|ref|ZP_07371033.1| outer membrane protein assembly complex [Neisseria meningitidis
           ATCC 13091]
 gi|304337120|gb|EFM03307.1| outer membrane protein assembly complex [Neisseria meningitidis
           ATCC 13091]
          Length = 797

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 197/774 (25%), Positives = 356/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV +G + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKIGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|89054944|ref|YP_510395.1| surface antigen (D15) [Jannaschia sp. CCS1]
 gi|88864493|gb|ABD55370.1| surface antigen (D15) [Jannaschia sp. CCS1]
          Length = 772

 Score =  275 bits (704), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 192/738 (26%), Positives = 347/738 (47%), Gaps = 17/738 (2%)

Query: 52  EIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLI 111
           +++G        +L    +  G ++S   ++ A++ +   G F +V++    + L+I ++
Sbjct: 44  DVQGNQRTNDASVLQVAGLAPGTTVSAGQVNDALQRLQNSGLFESVEVAPRGNTLVISVV 103

Query: 112 ERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVK 171
           E   IN +   GN  L DD+L  +++S     +   T   D   I +AY   G L     
Sbjct: 104 EYPTINRIAVEGNRRLDDDELLAVLQSTPRRVFSPITAERDAAAIAEAYRVTGRLTATAT 163

Query: 172 VQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTD 230
            Q        +++ +V+ EG   +   I FVGN++YS  RL +++    +G F +  ++D
Sbjct: 164 PQIIRRDDNRVDLVFVVTEGSVVETQRIAFVGNRDYSDRRLRQILESTQAGLFRALIRSD 223

Query: 231 VYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNIS 289
            + ++R++ D + +  FY DRGY    + S      + +  Y + F I EG+ Y VGN+S
Sbjct: 224 TFIEDRIALDRQLLTDFYQDRGYIDFAIQSVTPELSRDRGAYFVTFNIREGQSYRVGNLS 283

Query: 290 IQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFA 349
           + S             I IR G  Y+P+ I  +  ++          FVR++ R+ RD A
Sbjct: 284 VVSEFPGADPALFQGAINIRQGVRYSPRIIDNAITRMENLASDQGLRFVRIEPRLTRDNA 343

Query: 350 KRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMA 409
             IV++E++I +G  ++V+RI+IEGN  + D VIRR+ ++ EGDP++   I  A  RI A
Sbjct: 344 NLIVNVEFVITRGERVFVERIDIEGNQTTLDRVIRRQFDVVEGDPMDARQIRAAAERIRA 403

Query: 410 TGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFG 469
           TG+F++V +         + VI+ V V++   GS+G + +Y  D G G+  +  + NF G
Sbjct: 404 TGFFADVQVDGRRGT-TPEQVIVDVDVEEQPTGSLGFSASYSTDSGAGLAVNFSEENFLG 462

Query: 470 QGYRARLAAGFG-RHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAV- 527
           +G    +A GF      Q+  FS  +P  L   +  G        ED   D    S  V 
Sbjct: 463 RGQ--AVAVGFNTTEGSQSLNFSFTEPALLRRDLEFGVSAYYAIEEDNDSDAESTSYGVG 520

Query: 528 -RMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
             +  PI+E+      Y+     +  I  ++        L E  +  +  +  +  ++  
Sbjct: 521 TSLGFPISENSRLRLFYN---FDHDEIVGRDPALDSAILLNEASEADTSRVGFTYSFDNR 577

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPS 646
              + P  G+  + + +YAG GGD+++ R   RA     ++ +   + +   G G +   
Sbjct: 578 ATGLNPNAGVAFAFTGEYAGLGGDTEFIRARVRALAETRIAREEVTLRATLEG-GVINAL 636

Query: 647 NKNLQLFDQFSVSSNYYLRGFAYKGIGPR---VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
           +   +  ++FS+SS   +RGF   G+GPR      + A+GG  ++ A    +FP+ L PE
Sbjct: 637 DGGTRASNRFSLSSR-QMRGFESGGLGPRDTGATNENALGGNYFAVARFEAAFPIGL-PE 694

Query: 704 RAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
             G+ G  F D  +++      G+     ++   R   GV + W++ LG +   +  P+ 
Sbjct: 695 EYGISGGAFFDVGSVWGLDDTAGSMGTVDDEFRLRTVVGVSVFWDTALGPLRFNFSRPIE 754

Query: 764 HREGDKIQQFGFRIGNRM 781
             + D+ ++F F +  R 
Sbjct: 755 FEDYDRTREFDFTVEARF 772


>gi|270264812|ref|ZP_06193076.1| outer membrane protein assembly complex, YaeT protein [Serratia
           odorifera 4Rx13]
 gi|270041110|gb|EFA14210.1| outer membrane protein assembly complex, YaeT protein [Serratia
           odorifera 4Rx13]
          Length = 800

 Score =  275 bits (704), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 209/803 (26%), Positives = 368/803 (45%), Gaps = 57/803 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVTDDDISNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +++  L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHAFTNDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EGE Y +  + +   L       +  L ++  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITVNITEGEQYKLSGVMVNGNLAG-HSAEVAQLTKVEPGELYNGSKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  + +          + RV T+   + A + V +   ID G+  YV+RI+ EGND S 
Sbjct: 302 TKMEDNVKTMLGRYGYAYPRVSTQPEINDADKTVKLHVNIDAGNRFYVRRIKFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +  + +E+ K R+   GYF  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNAQVEQGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + G+      Y  + G+  +  +  +N+ G GY   ++    ++  Q YT  SV +PYF 
Sbjct: 422 NTGTFNFGVGYGTESGVSFQAGVQQDNWLGTGYSVGISG--TKNDYQTYTELSVTNPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAVRMI-----VPITESISTSFKYDLRFLQYGAI 553
              +S G  +     +    D++D +     I      PI E  + S +  L ++  G  
Sbjct: 480 VDGVSLGGRIFYNDFKADDADLSDYTNKSYGIDGTLGFPINE--NNSLRTGLGYVHNGLS 537

Query: 554 SEKEKIP--------SIYTTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGMLISSSYD 603
           + + +I          +     +   +S+   + ++   YN LD    P  G   + +  
Sbjct: 538 NMQPQIAMWRYLDSMGLNPNTNDRASYSADDFTLNLGWTYNNLDRGYFPTSGNRTTLNGK 597

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSSN 661
               G D++Y+++   +  +  + DD    ++G  R GY   +   K +  ++ F    +
Sbjct: 598 VTIPGSDNEYYKMTLDSVQYVPIDDDRTWVLLGRGRLGYADGL-GGKEMPFYENFYAGGS 656

Query: 662 YYLRGFAYKGIGPR-----------------VDKKYAIGGKIYSSASAAVSFPMPLVPER 704
             +RGF    IGP+                  +   A+GG   + AS  +  P P + E+
Sbjct: 657 STVRGFGSNTIGPKAVYYNSSSYSCSNSTKICNSDDAVGGNAMAVASMELITPTPFISEK 716

Query: 705 --AGLRGAFFVDSATLYANHVALGADKLEGND-------SFWRVSTGVEIMWNSPLGMMG 755
               +R + F+D+ T++  +      K +G D       S  RVS G+ + W SPLG + 
Sbjct: 717 YANSVRTSLFMDAGTVWDTN--WDNSKTQGFDIPDYSKASNIRVSAGIALQWMSPLGPLV 774

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  PL+  EGDK +QF F IG
Sbjct: 775 FSYANPLKKYEGDKSEQFQFNIG 797


>gi|161870881|ref|YP_001600055.1| outer membrane protein OMP85 [Neisseria meningitidis 053442]
 gi|161596434|gb|ABX74094.1| outer membrane protein OMP85 [Neisseria meningitidis 053442]
          Length = 797

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 198/774 (25%), Positives = 356/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I I G        + + +PV +G + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRIEGLQRTEPSTVFNYLPVKIGDAYNDGRGGEIIKSLYATGFFDDVRVESADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|126729712|ref|ZP_01745525.1| outer membrane protein, OMP85 family [Sagittula stellata E-37]
 gi|126709831|gb|EBA08884.1| outer membrane protein, OMP85 family [Sagittula stellata E-37]
          Length = 761

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 195/748 (26%), Positives = 363/748 (48%), Gaps = 30/748 (4%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           ++I+G   V    ILS   +  GQ +S   L+ A + I   G F +V +    + L+I +
Sbjct: 27  VDIQGNQRVEAGTILSYAGIARGQQVSAGQLNDAYQRILGSGLFESVDLIPQGNTLVIRV 86

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   +N + F GN  +KD+ L  I++S++   ++      D   I +AY   G +   V
Sbjct: 87  VEFPTVNRIAFEGNRRIKDEDLAPIIQSQARRVFNPRVAEQDAQAISEAYVVQGRIAARV 146

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    +   +++ + I EG  +++  I FVGN+ YS  RL RV+  + +G   +  + 
Sbjct: 147 SPKVIRRNENRVDLVFEIFEGGVSEVERIGFVGNQVYSDRRLRRVVETKQAGLLRALIRK 206

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVS-SQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D + ++R+ FD++ +R FY  RGY   +++ +     +++ G+ + F ++EG+ + VG +
Sbjct: 207 DTFIEDRVQFDQQLLRDFYMARGYVDFRITGTNAELARERDGFFVTFNVEEGQQFRVGAV 266

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ S L ++  +     +++RSG +Y+P  ++    ++ +        FVRV  +I+R+ 
Sbjct: 267 TVNSDLPDVDTELFQRAVKLRSGVVYSPMRVENEIARLERLAIREGLNFVRVDPQISRND 326

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+ + + +G  ++V+RI+IEGN  + D V+RR+ +  EGDP N   I  +  RI 
Sbjct: 327 RDLTLDVSFNLVRGDRIFVERIDIEGNTTTMDRVVRRQFDTVEGDPFNPRAIRESAERIR 386

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+FS V++     +     VI+ V V++   GS+    NY    G G      + NF 
Sbjct: 387 ALGFFSNVDVDAREGS-TPQQVIIDVDVEEQPTGSLSFGANYSSTNGFGAAISFSERNFL 445

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQ--KTHLEDGSLDINDESAA 526
           G+G            A ++Y F+  +P   G  ++ G +L   +T+   G  D       
Sbjct: 446 GRGQTLGFTINTA-SASKSYGFNFIEPAVFGQDLAFGLNLNYAQTNKLGGDYDTTSGIFQ 504

Query: 527 VRMIVPITESISTSFKYDLRFLQY---GAISEKEKIPSIYTTLIEHGKFSSHSISQSIIY 583
             +  P++++   S +Y  +       GAI+       +     + G+    S+  +  +
Sbjct: 505 PSLSFPVSDNGRLSLRYTAKLTDVSSSGAIA-----GGVIDAESQEGERIDSSLGYTYSW 559

Query: 584 NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGC 642
           +T    + P+   L   S D+ G GGD+ + + G +A +   +LS++  +  ++    G 
Sbjct: 560 DTRRAGLDPKNTYLFEFSQDFGGVGGDTTFIKTGVKAIAQTKVLSEEVTLRATIE--GGA 617

Query: 643 VIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKY---AIGGKIYSSASAAVSFPM 698
           +  S    ++ D+F +S N  +RGF Y GIGPR VD +    A+GG  Y+ A     FP+
Sbjct: 618 LHYSKGESRVTDRFLLSPN-LMRGFEYGGIGPREVDGRGNSDALGGNFYAVAKFEAEFPV 676

Query: 699 PLVPERAGLRGAFFVDSATLYA-----NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGM 753
            L PE  G+ G  F D  +++      ++VA G+  +   D   R   G  I W+S LG 
Sbjct: 677 GL-PEEYGISGGLFYDIGSVWGVNSETSNVAGGS--IVSADFDARHVVGFSIFWDSALGP 733

Query: 754 MGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           + + +  PL+  + D+ + F   I  + 
Sbjct: 734 LRLDFSEPLQKSKYDEEKNFNLTISTKF 761


>gi|240116658|ref|ZP_04730720.1| Outer membrane protein Omp85 [Neisseria gonorrhoeae PID18]
 gi|254494679|ref|ZP_05107850.1| outer membrane protein OMP85 [Neisseria gonorrhoeae 1291]
 gi|268602326|ref|ZP_06136493.1| outer membrane protein OMP85 [Neisseria gonorrhoeae PID18]
 gi|226513719|gb|EEH63064.1| outer membrane protein OMP85 [Neisseria gonorrhoeae 1291]
 gi|268586457|gb|EEZ51133.1| outer membrane protein OMP85 [Neisseria gonorrhoeae PID18]
          Length = 792

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 196/771 (25%), Positives = 353/771 (45%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  ++D + +++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKVELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAGTKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI-EHGKFSS 574
                      VRM +P+TE    +F      L    ++   K P  Y   I ++GK   
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIKQYGKTDG 560

Query: 575 HSIS-QSIIY--------NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              S + ++Y        N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGLLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++       A+   GN+       
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGRTYTAAE--NGNNKSVYSEN 738

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 739 AHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 789


>gi|240015055|ref|ZP_04721968.1| hypothetical protein NgonD_10528 [Neisseria gonorrhoeae DGI18]
 gi|240122124|ref|ZP_04735086.1| hypothetical protein NgonPI_10230 [Neisseria gonorrhoeae PID24-1]
          Length = 792

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 194/771 (25%), Positives = 349/771 (45%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  ++D + +++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAGTKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                      VRM +P+TE    +F      L    ++   K P  Y   I        
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIRKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++       A+   GN+       
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGRTYTAAE--NGNNKSVYSEN 738

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 739 AHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 789


>gi|157825343|ref|YP_001493063.1| Outer membrane protein omp1 [Rickettsia akari str. Hartford]
 gi|157799301|gb|ABV74555.1| Outer membrane protein omp1 [Rickettsia akari str. Hartford]
          Length = 764

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 204/754 (27%), Positives = 362/754 (48%), Gaps = 29/754 (3%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV-DS 104
           S++ +I I G   V +  I S + + VG++ +++  D A+K +YA   F N+ + I  + 
Sbjct: 22  SVIHKITIEGNHRVERSTIESYLKLKVGETYNNSKEDEAIKRLYATSLFRNINMHITNEG 81

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+ + E   I+ + FSGN+ +K   L   + + S  +  +  +  DV  I + Y   G
Sbjct: 82  NLIVGVTETPFISSVVFSGNSKIKTHMLAKEIYTMSGESLSQAKIELDVKKILEIYKRSG 141

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                V  +   +    + + + I EG K  I  I F GN+NYS + L+ VI  + S +F
Sbjct: 142 RFATTVTPKIEHLENNRVKVIFDIAEGPKTAIKYIYFSGNENYSDSELKSVILTKESRWF 201

Query: 225 SFGKT-DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
            F ++ D Y  +R+ +D+E +R FY   G+A  +V S+    +  K  + + + IDEGE 
Sbjct: 202 RFLESNDTYDPDRVEYDQELLREFYQSVGFADFRVISASAELNNTKEYFTITYSIDEGEK 261

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y+ GN++I + L  I   +L  ++ I+ G ++N + + + ++KI +YF +     V V  
Sbjct: 262 YSFGNVTIDNKLPNINITSLNKIVTIKQGKVFNMKTVDDMAKKIGEYFTANGYHAVNVYP 321

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
            I ++ A    DI+++I++   +Y+ +I I  N ++ D VIRRE +  EGD IN S IE+
Sbjct: 322 DIIKN-ANHTADIKFIIEKADKVYINKINIINNLKTEDYVIRREFKTEEGDIINRSYIEK 380

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
            +R +    YF +V IS  P      Y +  V V + S  S+G    Y    G+      
Sbjct: 381 GERNLRNLDYFEKVAISLAPTKAKDKYDV-DVEVDEKSTSSIGFDLGYNTAGGLFGRFSF 439

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTH---------L 513
            + N  G G          +++   Y   + +P FL   +S G +  + +          
Sbjct: 440 LERNLVGTGKLLNTGVQVSKNSTSYYG-GITEPNFLDRDLSLGVNAFRNYTGRGASVLNT 498

Query: 514 EDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFS 573
            D +  +N     + +   I E++     Y    ++   +S   +  SI+    + G+F 
Sbjct: 499 TDQNYKLNSTGVKISLGYEIKETLGHEIDY---LIKRDILSAPSQSSSIFLNE-QMGRFI 554

Query: 574 SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV 633
           + +I  +I Y+  D+ IVP+ G LIS + ++AG GGD++Y +      Y+     +   +
Sbjct: 555 TSAIGHTITYDQTDSKIVPKNGYLISGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKLTL 614

Query: 634 GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSASA 692
                G        K +++ D+F++  +Y LRGFA  G+GPR  +    +GG+ Y + S 
Sbjct: 615 KLSAAGGDIAGLGGKIVRISDRFNL-GDYSLRGFASGGVGPREKNTNEGLGGERYYTFST 673

Query: 693 AVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVSTGVEIMW 747
            ++FP P VPE   L GA F+D  +++   V L   + +      ND   R S G   +W
Sbjct: 674 ELNFPTP-VPEEFNLTGAVFMDLGSVWG--VGLNKKQYKTPNGFYNDKSLRTSIGFGFIW 730

Query: 748 NSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +    + + +G P++ ++ D  Q F  R    +
Sbjct: 731 VTRFAPIRMDWGFPVKKKKYDDTQHFHLRFSTHL 764


>gi|240124417|ref|ZP_04737373.1| hypothetical protein NgonP_10863 [Neisseria gonorrhoeae PID332]
 gi|268683046|ref|ZP_06149908.1| outer membrane protein OMP85 [Neisseria gonorrhoeae PID332]
 gi|268623330|gb|EEZ55730.1| outer membrane protein OMP85 [Neisseria gonorrhoeae PID332]
          Length = 792

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 194/771 (25%), Positives = 349/771 (45%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  ++D + +++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTRQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAGTKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                      VRM +P+TE    +F      L    ++   K P  Y   I        
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIRKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++       A+   GN+       
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGRTYTAAEN--GNNKSVYSEN 738

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 739 AHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 789


>gi|322835500|ref|YP_004215526.1| outer membrane protein assembly complex, YaeT protein [Rahnella sp.
           Y9602]
 gi|321170701|gb|ADW76399.1| outer membrane protein assembly complex, YaeT protein [Rahnella sp.
           Y9602]
          Length = 807

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 222/798 (27%), Positives = 362/798 (45%), Gaps = 70/798 (8%)

Query: 40  VYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKI 99
           V+ +   +V+ I + G   V     L  IPV VG ++SD D+   ++ ++A G F +VK+
Sbjct: 18  VFAAGGFVVKDIHVEGLQRVTVGAALLSIPVRVGDTVSDDDISQTIRALFATGNFDDVKV 77

Query: 100 KIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAYDEDTVNADVHNI 156
               + LI+ + ER  I  + FSGN  +KD+ L+  + +   R   A D  T+++    +
Sbjct: 78  LEDGNTLIVQVKERPTIASITFSGNKAIKDEMLQQNLEASGIRVGDALDRTTISSIEKGL 137

Query: 157 KQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVI 216
           +  Y S+G  +  VK     +    +++  V  EGV AKI  I  VGNK ++   L    
Sbjct: 138 EDFYYSVGKYSASVKAVVTPLPRNRVDVKLVFTEGVSAKIQQINIVGNKAFTSDDLIAHF 197

Query: 217 SIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLI 274
            +R    +++      Y K+++S D E +R+FY DRGYA   + S+QV     K G  + 
Sbjct: 198 QLRDEVPWWNVIGDKKYEKQKLSGDLETLRSFYLDRGYARFNIDSTQVSLTPDKKGIYIT 257

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYF--FS 332
             I EG  YTV  + +   +       + SL  I +G LYN  ++ +    I      + 
Sbjct: 258 VNIAEGAQYTVSGVVVTGDMAG-HSSEIESLATIPAGELYNGAKVTKVEGDIKNLLGRYG 316

Query: 333 GERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEG 392
              P V  ++ IN     + V +   +D G+   V+RI  EGND S D V+RRE+   EG
Sbjct: 317 YAYPHVTTQSDINE--TDKTVKLHISVDTGNRYSVRRIRFEGNDTSKDEVLRREMRQMEG 374

Query: 393 DPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV 452
             +   ++++ K R+  TGYF  V++   P    +D V +   VK+ + G+  +   Y  
Sbjct: 375 AWLGNDLVQKGKDRLNRTGYFESVDVDTQPVPGSADQVDVVYKVKERNTGTFNVGLGYGT 434

Query: 453 DKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSPISAGFDLQKT 511
           D G+  +  +  +N+ G G     +    R++ Q Y   S  +PY+    IS G  +   
Sbjct: 435 DSGISYQLGVTQDNWLGSGNTVSFSG--TRNSYQTYVEVSATNPYYTVDGISLGGKVFYN 492

Query: 512 H--LEDGSL---DINDESAAVRMIVPITESISTSFKYD---------------LRFLQYG 551
           H   ED  L   ++      V + +P++E+ + +   D                R+L   
Sbjct: 493 HYDAEDNDLAAYNLQSYGTGVNLGLPVSENNTLNLGLDYVHSTLSDMEPQVAVWRYLNAS 552

Query: 552 AISEKEKIPSIYTTLIE-HGKFSSHSISQSI--IYNTLDNPIVPRKGMLISSSYDYAGFG 608
            +      P + TT      + S++    S+   YN L+    P  G   S +      G
Sbjct: 553 GVH-----PGLVTTSTNSDAQLSTNDFFASVGWAYNDLNRGFFPSSGTRASLAAKVTTPG 607

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRG 666
            D  Y++I   A+++  LSD SD V  G  + GY   I SN+ +  +D F    +  +RG
Sbjct: 608 SDDSYYKITFDANHYIPLSDKSDWVLMGRAKAGYAAGIGSNE-VPFYDNFYAGGSSSVRG 666

Query: 667 FAYKGIGPR--------VDKKY----------AIGGKIYSSASAAVSFPMPLVPER--AG 706
           F+   IGP+         D  Y          A+GG   + ASA +  P P + E+  + 
Sbjct: 667 FSSNTIGPKAAYYKCSSADSSYSTCPVTKSTDAVGGNAMAIASAELYVPTPFISEKYASS 726

Query: 707 LRGAFFVDSATL----YANHVALGADKLE--GNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
           +R + FVDS T+    + N  A  A  +    + +  RVS+G+ + W SPLG +   Y  
Sbjct: 727 VRTSLFVDSGTVWDTRWKNTSATEAAGIPDYSDPTHIRVSSGIALQWQSPLGPLVFSYAQ 786

Query: 761 PLRHREGDKIQQFGFRIG 778
           PL   EGD  +QF F IG
Sbjct: 787 PLVKYEGDSAEQFQFNIG 804


>gi|163747138|ref|ZP_02154494.1| outer membrane protein, putative [Oceanibulbus indolifex HEL-45]
 gi|161379699|gb|EDQ04112.1| outer membrane protein, putative [Oceanibulbus indolifex HEL-45]
          Length = 777

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 198/733 (27%), Positives = 352/733 (48%), Gaps = 22/733 (3%)

Query: 53  IRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIE 112
           I G   +G   IL +  +  GQ++S   L+ A +N+   G F +V I+     L+I ++E
Sbjct: 47  IDGNERIGDSAILRQAGIGQGQAVSGGQLNDAYQNLQNSGLFESVSIEPQGGTLVITVVE 106

Query: 113 RKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKV 172
              +N + F GN  +KD+ L  ++ S     ++      D   I +AY++ G L+  V+ 
Sbjct: 107 LPTLNRVSFEGNRRIKDEMLAELIGSTERRVFNPSQAEQDAAAIAEAYSNEGRLSARVQP 166

Query: 173 QHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDV 231
           +        +++ + I EG   +I  + FVGN+ YS +RL RV+  + +G F    K D 
Sbjct: 167 RIIRRDQNRVDLVFEIFEGDNVEIERLSFVGNRVYSDSRLRRVLGTKQAGLFRRLVKRDT 226

Query: 232 YSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNISI 290
           Y + R+  D++ +R FY  RGY  ++  +      +++ G  + + I EG+ +  G +S+
Sbjct: 227 YVEGRVEADKQMLRDFYLSRGYVDMRTEAVNAELTEERDGVFVAYNITEGQQFRFGTVSL 286

Query: 291 QSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAK 350
           +S +  +       L++IR G +Y+P  I+    +I +        F+RV+  I+R+   
Sbjct: 287 ESEVPGLNAAAYRDLLKIRPGVIYSPTLIETDVARIERQAIRDGVDFLRVEPVIDRNDRD 346

Query: 351 RIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMAT 410
             +++ Y + +G  ++V+RI+IEGN  + D VIRRE +  EGDP N   I ++  RI A 
Sbjct: 347 LSLNVTYKLTRGERVFVERIDIEGNTTTLDRVIRREFDSVEGDPFNPREIRQSAERIRAL 406

Query: 411 GYF--SEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
            YF  +EVN  Q       + V++ V V +   GS+    ++  + G GV     ++NF 
Sbjct: 407 QYFETAEVNARQ---GSSPEQVVIDVDVVEKPTGSLNFGGSFSNNDGFGVAVSFQEDNFL 463

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG--FDLQKTHLEDGSLDINDESAA 526
           G+G R  L+      A + Y  +  +P FLG  ++ G   D  +T+    S D       
Sbjct: 464 GRGQRLSLSISTAEDATR-YGLTFVEPRFLGRDLAFGLKLDYAETNSSYTSYDTERLVFQ 522

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
             +  P++E+   S +Y L  ++     +++   +I    I  G   S S+  +  Y+T 
Sbjct: 523 PSLTFPVSENGRLSTRYTLEGIEMLKRDDEDNSATIANE-IGAGALFSSSVGYTYTYDTR 581

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPS 646
              + P +G+L     D+AG GGD+++ +  ++ +   L+ ++ D+        G +  +
Sbjct: 582 RTGLDPTQGVLFEFGQDFAGLGGDNEFIKTTAKVTGEKLIFNE-DVTLRATLEGGALAWN 640

Query: 647 NKNLQLFDQFSVSSNYYLRGFAYKGIGPR-----VDKKYAIGGKIYSSASAAVSFPMPLV 701
           +   +  D+F +  +  +RGF   GIGPR     VD   A+GG  ++ A     FP+ L 
Sbjct: 641 SGTNRAVDRFILGPS-IMRGFEPGGIGPRDQSNGVDD--ALGGNFFAVARFEAEFPLGL- 696

Query: 702 PERAGLRGAFFVDSATLY-ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
           PE  G+ G  F D   L+  + V      + G    +R   G+ + W++PLG +      
Sbjct: 697 PEEYGITGGVFYDVGNLWDLSDVNTSGGTIVGESGSFRHVVGLSLFWDTPLGPLQFNVSD 756

Query: 761 PLRHREGDKIQQF 773
            L+    DK Q F
Sbjct: 757 ALKKESFDKEQSF 769


>gi|238751443|ref|ZP_04612935.1| Outer membrane protein assembly factor yaeT [Yersinia rohdei ATCC
           43380]
 gi|238710310|gb|EEQ02536.1| Outer membrane protein assembly factor yaeT [Yersinia rohdei ATCC
           43380]
          Length = 795

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 219/799 (27%), Positives = 369/799 (46%), Gaps = 54/799 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+   
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIGKT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN +++   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG  Y + ++ +   L   Q +    L +I  G L+N  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGNQYKLNSVVVSGNLAGHQSEAE-KLTKIEPGELFNGSKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S 
Sbjct: 302 TRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVTLRINVDAGNRFYVRNVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFS--EVNISQLPANDVSDYVILRVSVK 437
           DSV+RRE+   EG  +    +E  K R+   GYF   EV   ++P  D  D V +   VK
Sbjct: 362 DSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVEVETQRVPGTD--DLVDVTYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPY 496
           + + GS+     Y  + G+  +  +  +N+ G G    +     ++  Q Y  F++ DPY
Sbjct: 420 ERNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGING--TKNDYQTYAEFTLTDPY 477

Query: 497 FLGSPISAGFDLQKTHLEDGSLDIN---DESAAVRMIV--PITESISTSFKYDLRFLQYG 551
           F    +S G  +     +  + D++   + S  V   +  PI E  + S +  L ++ + 
Sbjct: 478 FTVDGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINE--NNSLRVGLGYV-HN 534

Query: 552 AISEKEKIPSIY---------TTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGMLISS 600
            +S+ E   +++           L +   F++   + ++   YN LD    P  G+  S 
Sbjct: 535 DLSDMEPQVAMWRYLESVGQDPNLTDRASFTADDFTLNLGWTYNNLDRGFFPTSGVKSSV 594

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSV 658
           +      G D+++++I    S +  L +D    ++G  R GYG  I S K +  ++ F  
Sbjct: 595 NTKVTVPGSDNEFYKITFDTSAYQPLDEDRSWVLLGRGRLGYGDGIGS-KEMPFYENFYA 653

Query: 659 SSNYYLRGFAYKGIGPRV-----------DKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
             +  +RGF    IGP+            D   A+GG   + AS  +  P P + E+   
Sbjct: 654 GGSSTVRGFRSNNIGPKAAYYTNADGSVRDSTDAVGGNAMAVASLELITPTPFISEKYSN 713

Query: 706 GLRGAFFVDSATLY-ANHVALGADKLEG-----NDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            +R +FF+DS T++  N       +  G       S  RVS GV + W SPLG +   Y 
Sbjct: 714 SVRTSFFIDSGTVWDTNWENTAQTRAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYA 773

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P++  EGDK +QF F IG
Sbjct: 774 KPVKDYEGDKSEQFQFNIG 792


>gi|212710389|ref|ZP_03318517.1| hypothetical protein PROVALCAL_01449 [Providencia alcalifaciens DSM
           30120]
 gi|212686971|gb|EEB46499.1| hypothetical protein PROVALCAL_01449 [Providencia alcalifaciens DSM
           30120]
          Length = 804

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 208/803 (25%), Positives = 364/803 (45%), Gaps = 53/803 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   + G +  YGS+  +V+ I   G   V     L  +PV VG SI + D+  +
Sbjct: 3   MKKLLIASLLLGSATAYGSDGFVVKDIRFEGLQRVAVGAALLNMPVRVGDSIDNEDISRS 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++++++ G F +V++    + LI+ + ER  I  + F+GN ++KDD LK  + +   R  
Sbjct: 63  IRSLFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFTGNKSVKDDMLKQNLEASNIRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D   +      ++  Y S+G  N  VK     +    +++ +V  EGV AKI  I  
Sbjct: 123 EALDRTKIANIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKFVFSEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNKNYS A L   + +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKNYSTAELVNKLQLRDDVPWWNLAADQKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K    +   + EG+ Y +  + +     E     +  LI I  G LYN  ++
Sbjct: 243 TQVSLTPDKKDIYITINVTEGDQYKISGVDVNGNTAE-HLADIQELITITPGELYNGAQV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +   +I   F      + RV T+   + A + V +   +D G+  YV++I  +GND S 
Sbjct: 302 TQMENQIKDLFGRYGYAYPRVMTQPEINDADKTVKLHVNVDAGNRFYVRQIRFQGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +   ++E  K R+  TG+F  V++         D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNDLVELGKERLNRTGFFETVDVETQRIPGSPDQVDVIYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           + GS+     +  + G+  +  +  +N+ G G    + A    ++  N  FS+ DPYF  
Sbjct: 422 NTGSMNFGVGFGTESGVSFQVGVTQDNWLGTGNAVGINASRNDYST-NVEFSMTDPYFTV 480

Query: 500 SPISAGFDLQKTHLEDGSLDI---NDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
           + +S G  +          D+   N+++  +   +    + + SF+    ++ +  +S+ 
Sbjct: 481 NGVSLGGRIFYNDFSAKDADLSGYNNKTYGLDSTLSFPFNENNSFRIGAGYV-HNDLSDM 539

Query: 557 EKIPSIYTTLIEHG---------------KFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
               +++  L   G               +    +++    YN+L+    P  G   S S
Sbjct: 540 RAQAAMWDYLQSMGENPPVTKDGRNKESFRADDFTLNLGWTYNSLNRGFFPTSGNKTSVS 599

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
                 G D++Y+++    + +  L+DD    ++G  + GYG  I S K +  ++ F   
Sbjct: 600 GKVTIPGSDNEYYKLRFDTAQYLPLNDDETWVVLGRAQAGYGDGIGS-KQMPFYENFYAG 658

Query: 660 SNYYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
            +  +RGF    IGP+                     A+GG    + S  +  P P V E
Sbjct: 659 GSSTIRGFRSNNIGPKAVYLKNINGKDGPEPGSPSSDAVGGNAMYAGSFELITPTPFVDE 718

Query: 704 RAG--LRGAFFVDSATLYA------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R + FVD+ T++       N          G  +  RVSTG+ + W SPLG + 
Sbjct: 719 KYANTIRTSLFVDAGTVWDTNWNSINPAWRAGMPDYGTATNVRVSTGIALQWISPLGPLV 778

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P++  EGDK +QF F IG
Sbjct: 779 FSYAQPIKDYEGDKSEQFQFNIG 801


>gi|253687345|ref|YP_003016535.1| outer membrane protein assembly complex, YaeT protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259710200|sp|C6DAJ1|YAET_PECCP RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|251753923|gb|ACT11999.1| outer membrane protein assembly complex, YaeT protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 809

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 210/808 (25%), Positives = 368/808 (45%), Gaps = 64/808 (7%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ + ++ 
Sbjct: 6   LLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIGNTIRA 65

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAY 144
           ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  + +   R   A 
Sbjct: 66  LFATGNFEDVRVLRDGGTLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVRVGEAL 125

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D   + +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  VGN
Sbjct: 126 DRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINIVGN 185

Query: 205 KNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
           K +S   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S+QV
Sbjct: 186 KAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNIDSTQV 245

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
                K G  +   + EGE Y +  ++++  L       +  L +I  G LYN  ++   
Sbjct: 246 SLTPDKKGIYITINMTEGEQYKLSGVTVKGNLAG-HSAEIEGLTKIEPGELYNGTKVTRM 304

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
            E I K        + RV T+   + A + V +   +D G+  YV+ I  +GND S D+V
Sbjct: 305 EEDIKKLLGRYGYAYPRVVTQPEINDADKTVRLNINVDAGNRFYVRHIRFDGNDTSKDAV 364

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           +RRE+   EG  +   ++E+ K R+   G+F  V++       V+D V +   VK+ + G
Sbjct: 365 LRREMRQMEGAWLGNDLVEQGKERLNRLGFFESVDVETQRVPGVADQVDVTYKVKERNTG 424

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSP 501
           +      +  + G+  +  +  +N+ G G    ++    ++  Q Y   S+ DPYF    
Sbjct: 425 TFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISG--TKNDYQTYVELSLTDPYFTVDG 482

Query: 502 ISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G  +     E    D++D +         +  PI E  + S +  L ++       +
Sbjct: 483 VSLGGRIFYNKFEASDADLSDYTNVSYGVGSTLGFPINE--NNSLRVGLDYVHNDLSDMR 540

Query: 557 EKIP--------SIYTTLIEHGKFSSHS-------ISQSIIYNTLDNPIVPRKGMLISSS 601
            ++          +   +++ G  SS         ++    YN LD    P KG   S++
Sbjct: 541 PQVAMWRYLDSVGVNPAVVQEGNKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASAN 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
              A  G D++Y+++   ++ +Y L+D     ++G  R G+   +   K +  +D F   
Sbjct: 601 AKIAVPGSDNEYYKLTFDSASYYPLTDSGKWVVMGRTRAGFADGL-GGKEVPFYDNFYAG 659

Query: 660 SNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSA-------------------SAAVSFPMP 699
            +  +RGF    IGP+    K A+G   YS+                    SA +  P P
Sbjct: 660 GSSTVRGFQSNTIGPKAAYYKCAVGATSYSNCPIDSTNLDDAVGGNAMAVLSAELIVPTP 719

Query: 700 LVPER--AGLRGAFFVDSATLYANH-------VALGADKLEGNDSFWRVSTGVEIMWNSP 750
            + ++  + +R +FFVD  T++  +       +A G        +F RVS+G+ + W SP
Sbjct: 720 FISDKYASSVRTSFFVDGGTVWDTNWENTPATIAAGVPDYSKASNF-RVSSGIALQWMSP 778

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P++  +GDK +QF F IG
Sbjct: 779 LGPLVFSYAQPVKKYDGDKSEQFQFNIG 806


>gi|59802119|ref|YP_208831.1| hypothetical protein NGO1801 [Neisseria gonorrhoeae FA 1090]
 gi|59719014|gb|AAW90419.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
          Length = 792

 Score =  274 bits (700), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 196/771 (25%), Positives = 352/771 (45%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  ++D + +++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTRQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAGTKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI-EHGKFSS 574
                      VRM +P+TE    +F      L    ++   K P  Y   I ++GK   
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIRKYGKTDG 560

Query: 575 HSIS-QSIIY--------NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              S + ++Y        N  D+   P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGLLYKGTVGWGRNKTDSASWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++       A+   GN+       
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGRTYTAAEN--GNNKSVYSEN 738

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 739 AHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 789


>gi|261391718|emb|CAX49167.1| outer-membrane protein assembly factor Omp85 [Neisseria
           meningitidis 8013]
 gi|325131039|gb|EGC53764.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis OX99.30304]
 gi|325135109|gb|EGC57736.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M13399]
 gi|325145379|gb|EGC67656.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M01-240013]
          Length = 797

 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 197/774 (25%), Positives = 355/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKQYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|99081248|ref|YP_613402.1| surface antigen (D15) [Ruegeria sp. TM1040]
 gi|99037528|gb|ABF64140.1| surface antigen (D15) [Ruegeria sp. TM1040]
          Length = 796

 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 197/746 (26%), Positives = 353/746 (47%), Gaps = 21/746 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + + G   +    I++   +  G+ +S  +L+ A + ++  G F +V++    + L+I +
Sbjct: 57  VRVEGNQRIQSSTIVAYTGLSRGERVSGGELNDAYRGVFDSGLFESVELVPRGNTLVIKV 116

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   I+ + F GN  LKDD L  ++ S     +  D    D   I + Y + G L   V
Sbjct: 117 VEFPTISRISFEGNKRLKDDALGEVIESSPRRVFSADQAERDAGAIAELYRAQGRLASRV 176

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + I EG   ++  + FVGN+ +S  RL R++  + + +  +    
Sbjct: 177 TPRIIRRSDNRVDLIFEISEGDTVEVERVSFVGNRAFSDRRLRRILETKQATFLRALINR 236

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D   ++R+ FD + +  FY  RGY   +V+S      K++    L+  + EG+ +  G I
Sbjct: 237 DTLIEDRIQFDRQVLTDFYRSRGYVDFRVNSVNAEVTKERDAAFLVVDVTEGQQFEFGEI 296

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ S   +       S +R++ G  Y+P  I+ + E + +        F+RV+ R+ R+ 
Sbjct: 297 TVTSEFADADPDLYRSKLRLKPGVTYSPLLIENAIETLEQLAVRQGIDFLRVEPRVTRND 356

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+E+ + +G  ++V+RI+IEGN  + D VIRR+  + EGDP+N   I  +  RI 
Sbjct: 357 RDLTLDVEFAMVRGPRVFVERIDIEGNTTTLDRVIRRQFRIVEGDPLNQREIRNSAERIK 416

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+FSE  +     +  S+ ++    V+Q   GS  +  +Y VD G+GV   I + NF 
Sbjct: 417 ALGFFSESEVDVRQGSTPSEVIVDVDVVEQ-PTGSFNLGGSYSVDDGIGVAIGISEKNFL 475

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVR 528
           G+G +            + Y     +P  LG  +    DL  +  E    + + +    R
Sbjct: 476 GRGQQLSFNIS-TTEDTEAYNLRFGEPKLLGRDLQFAIDLGLSETESSYSEYDTKEVVFR 534

Query: 529 MIVPITESISTSFKYDLRFLQ-----YGAISEKEK-IPSIYTTLIEHGKFSSHSISQSII 582
             +    S +TS +    F Q      G  S  +  +  +    I  GK ++ SI  +  
Sbjct: 535 PSITFDASETTSLQLRYGFEQDEMESRGLDSNNQPLVGPVLQREIAEGKRTTSSIGATFT 594

Query: 583 YNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR-ASYFYLLSDDSDIVGSLRFGYG 641
           Y++    + P  G L+ S  DYAG GGD++Y R  S+  +   + +++  +  ++  GY 
Sbjct: 595 YDSRRTGLNPTAGFLVQSGIDYAGLGGDNEYIRATSKIVAQKLVFNEEVTLRATVEAGYL 654

Query: 642 CVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKY--AIGGKIYSSASAAVSFPM 698
             +  N++ +  D+F ++S+  LRGF   GIGPR +   Y  A+GG +Y+ A     FP+
Sbjct: 655 GWLGDNRS-RTIDRFLLTSD-TLRGFEPGGIGPRDMSGSYDDALGGNLYAVARFDAEFPL 712

Query: 699 PLVPERAGLRGAFFVDSATLYA---NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMG 755
            L PE  GLRG  F D   L+    ++   G++ + G D  +R   G  ++W + LG + 
Sbjct: 713 GL-PEELGLRGGLFYDVGNLWGLEDSNADFGSNVV-GRDGSFRHVVGFSLLWTTGLGPLR 770

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNRM 781
             +   L   + DK + F   I  R 
Sbjct: 771 FNFSKALVKEDFDKERNFDLTIQARF 796


>gi|240129094|ref|ZP_04741755.1| hypothetical protein NgonS_10822 [Neisseria gonorrhoeae SK-93-1035]
 gi|268687475|ref|ZP_06154337.1| outer membrane protein OMP85 [Neisseria gonorrhoeae SK-93-1035]
 gi|268627759|gb|EEZ60159.1| outer membrane protein OMP85 [Neisseria gonorrhoeae SK-93-1035]
          Length = 792

 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 194/771 (25%), Positives = 349/771 (45%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  ++D + +++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTRQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKVELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                      VRM +P+TE    +F      L    ++   K P  Y   I        
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIRKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++       A+   GN+       
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGRTYTAAEN--GNNKSVYSEN 738

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 739 AHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 789


>gi|157372017|ref|YP_001480006.1| outer membrane protein assembly factor YaeT [Serratia
           proteamaculans 568]
 gi|166919052|sp|A8GID8|YAET_SERP5 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|157323781|gb|ABV42878.1| surface antigen (D15) [Serratia proteamaculans 568]
          Length = 801

 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 208/802 (25%), Positives = 367/802 (45%), Gaps = 54/802 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVTDDDISNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +++  L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHAFTNDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EGE Y + ++ +   L       +  L +I  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGEQYKLTDVVVNGNLAG-HSAEVAQLTKIEPGELYNGSKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  + I          + RV T+   + A + V +   ID G+  YV+RI+ EGND S 
Sbjct: 302 TKMEDNIKTMLGRYGYAYPRVSTQPEINDADKTVKLHVNIDAGNRFYVRRIKFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +  + +E+ K R+   GYF  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNAQVEQGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + G+      Y  + G+  +  +  +N+ G GY   ++    ++  Q YT  SV +PYF 
Sbjct: 422 NTGTFNFGVGYGTESGVSFQAGVQQDNWLGTGYSVGISG--TKNDYQTYTELSVTNPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAVRMI-----VPITESISTSFKYDLRFLQYGAI 553
              +S G  +     +    D++D +     I      PI E  + S +  L ++  G  
Sbjct: 480 VDGVSLGGRIFYNDFKADDADLSDYTNKSYGIDGTLGFPINE--NNSLRTGLGYVHNGLS 537

Query: 554 SEKEKIP--------SIYTTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGMLISSSYD 603
           + + +I          +     +   +S+   + ++   YN LD    P  G   + +  
Sbjct: 538 NMQPQIAMWRYLDSMGLNPNTTDRASYSADDFTLNLGWTYNNLDRGYFPTSGNRTTLNGK 597

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSSN 661
               G D++Y+++   +  +  ++DD    ++G  R GY   +   K +  ++ F    +
Sbjct: 598 VTIPGSDNEYYKLTLDSVQYVPINDDRTWVLLGRGRLGYADGL-GGKEMPFYENFYAGGS 656

Query: 662 YYLRGFAYKGIGPR-----------------VDKKYAIGGKIYSSASAAVSFPMPLVPER 704
             +RGF    IGP+                  +   A+GG   + AS  +  P P + E+
Sbjct: 657 STVRGFGSNTIGPKAAYYNSNSYGCSNGTPICNSDDAVGGNAMAVASMELITPTPFISEK 716

Query: 705 --AGLRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEIMWNSPLGMMGV 756
               +R + F+D+ T++  +    A             S  RVS G+ + W SPLG +  
Sbjct: 717 YANSVRTSLFMDAGTVWDTNWQNTAQTSMYDIPDYSKASNIRVSAGIALQWMSPLGPLVF 776

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P++  EGDK +QF F IG
Sbjct: 777 SYANPIKKYEGDKSEQFQFNIG 798


>gi|294635128|ref|ZP_06713639.1| outer membrane protein assembly complex, YaeT protein [Edwardsiella
           tarda ATCC 23685]
 gi|291091505|gb|EFE24066.1| outer membrane protein assembly complex, YaeT protein [Edwardsiella
           tarda ATCC 23685]
          Length = 795

 Score =  273 bits (699), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 222/797 (27%), Positives = 371/797 (46%), Gaps = 50/797 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  ++L   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL + 
Sbjct: 3   MKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLSNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ +YA G F +V++    + LI+ + ER  I  + FSGN ++KD+ LK  + +   R  
Sbjct: 63  IRALYATGNFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  N  VK     +    +++  V  EG  A+I  I  
Sbjct: 123 EALDRTTLSSIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +S A L     +R    +++      Y K++++ D EA+R++Y DRGYA   + S
Sbjct: 183 VGNHAFSSADLLGHFQLRDDVPWWNLMADRKYQKQKLAGDLEALRSYYLDRGYARFAINS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + +   +     + +  L ++  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGDQYKLQGVDVTGNMAGYSAE-IGRLTKVEPGELYNGAKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  ++I +        + RV+T+   +   + V +   ID G+  YV++I   GND S 
Sbjct: 302 TKMEDEIKQLLGRYGYAYPRVQTQPEINDKDKTVILHMNIDAGNRYYVRQIRFVGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +    +E+ K R+  TGYF  V++         D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS      Y  + G+  +  +  +N+ G G    +A    ++  Q Y   S+ DPYF 
Sbjct: 422 NTGSFNFGIGYGTESGVSFQVGVQQDNWLGTG--NVVAINGTKNDYQTYAELSLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAV-----RMIVPITESISTSFKYDLRFLQYGAI 553
            + +S G  L     +    D++D + +       +  PI E  + S +  L ++ +  +
Sbjct: 480 VNGVSLGGRLFYNDFKANDADLSDYTNSSYGFDGTLGFPINE--NNSLRTGLGYV-HNDL 536

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQS-----------IIYNTLDNPIVPRKGMLISSSY 602
           S+ +   S++  L   G+  S S S S             YN LD    P  G   S + 
Sbjct: 537 SDMQPQVSMWRYLRSVGQNPSDSNSASYKANDYTWTAGWAYNNLDRGFFPTAGNKASLNG 596

Query: 603 DYAGFGGDSQYHRIG-SRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y+++     SYF +  D + +V G  R GYG      K +  ++ F    
Sbjct: 597 KITLPGSDNEYYKLTFDSQSYFPINQDRTWVVLGRTRLGYGNGF-GGKEMPFYENFYAGG 655

Query: 661 NYYLRGFAYKGIGPR---------VDKKY-----AIGGKIYSSASAAVSFPMPLVPER-- 704
           +  +RGF    IGP+         VD        A+GG   + AS  +  P P V E+  
Sbjct: 656 SGTVRGFQSNNIGPKAVYLNSNGSVDTSKTSDNDAVGGNAMAVASLELITPTPFVSEQYA 715

Query: 705 AGLRGAFFVDSATLY---ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
             LR + F+D+ T++    +H A  A       +  R+S GV + W SPLG +   Y  P
Sbjct: 716 NSLRTSVFMDAGTVWDTNWDHAAYPALPDYSKATNVRMSAGVALQWMSPLGPLVFSYAQP 775

Query: 762 LRHREGDKIQQFGFRIG 778
           ++  EGDK +QF F IG
Sbjct: 776 VKKYEGDKSEQFQFNIG 792


>gi|261822591|ref|YP_003260697.1| outer membrane protein assembly factor YaeT [Pectobacterium
           wasabiae WPP163]
 gi|261606604|gb|ACX89090.1| outer membrane protein assembly complex, YaeT protein
           [Pectobacterium wasabiae WPP163]
          Length = 815

 Score =  273 bits (699), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 212/814 (26%), Positives = 371/814 (45%), Gaps = 70/814 (8%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ + ++ 
Sbjct: 6   LLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIGNTIRA 65

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAY 144
           ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  + +   R   A 
Sbjct: 66  LFATGNFEDVRVLRDGETLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVRVGEAL 125

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D   + +    ++  Y S+G  +  VK     +    +++  V  EGV A+I  I  VGN
Sbjct: 126 DRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAQIQQINIVGN 185

Query: 205 KNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
           K +S   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S+QV
Sbjct: 186 KAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNIDSTQV 245

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
                + G  +   + EGE Y +  ++++  L       +  L +I SG LYN  ++   
Sbjct: 246 SLTPDRKGIYITINMTEGEQYKLSGVAVKGNLAG-HSAEIEGLTKIESGELYNGTKVTRM 304

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
            E I K        + RV T+ + + A + V +   +D G+  YV+ +  +GND S DSV
Sbjct: 305 EEDIKKLLGRYGYAYPRVVTQPDINDADKTVRLNINVDAGNRFYVRHVRFDGNDTSKDSV 364

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           +RRE+   EG  +   ++E+ K R+   GYF  V +       V+D V +   VK+ + G
Sbjct: 365 LRREMRQMEGAWLGNDLVEQGKERLNRLGYFESVEVETQRVPGVADQVDVTYKVKERNTG 424

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSP 501
           +      +  + G+  +  +  +N+ G G    ++    ++  Q Y   S+ DPYF    
Sbjct: 425 TFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISGT--KNDYQTYVELSLTDPYFTVDG 482

Query: 502 ISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G  +     E    D++D +         +  PI E+   S +  L ++       +
Sbjct: 483 VSLGGRIFYNKFEASDADLSDYTNVSYGVGSTLGFPINEN--NSLRVGLDYVHNDLSDMR 540

Query: 557 EKI------------PSIYTTLIEHG---KFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
            ++            PS+    ++     K +   ++    YN LD    P KG   S++
Sbjct: 541 PQVAMWRYLDSVGVNPSVVGENVKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASAN 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
              A  G D++Y+++   ++ +Y LSD  +  ++G  R G+   I S K +  +D F   
Sbjct: 601 AKIAVPGSDNEYYKLTFDSASYYPLSDSGNWVVMGRTRAGFADGIGS-KEVPFYDNFYAG 659

Query: 660 SNYYLRGFAYKGIGPR-----------------------VDKKY---AIGGKIYSSASAA 693
            +  +RGF    IGP+                       +DK     A+GG   +  SA 
Sbjct: 660 GSSTVRGFQSNTIGPKAAYYQCRPATQGGALPPSYSGCGIDKTNLDDAVGGNAMAVLSAE 719

Query: 694 VSFPMPLVPER--AGLRGAFFVDSATLYANH-------VALGADKLEGNDSFWRVSTGVE 744
           +  P P + ++  + +R +FFVD  T++  +       +  G        +F RVS+G+ 
Sbjct: 720 LIVPTPFISDKYASSVRTSFFVDGGTVWDTNWKNTQATIDAGVPDYSKASNF-RVSSGIA 778

Query: 745 IMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           + W SPLG +   Y  P++  +GDK +QF F IG
Sbjct: 779 LQWMSPLGPLVFSYAQPVKKYDGDKSEQFQFNIG 812


>gi|325129101|gb|EGC51950.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis N1568]
 gi|325203303|gb|ADY98756.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M01-240355]
 gi|325205275|gb|ADZ00728.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M04-240196]
          Length = 797

 Score =  273 bits (699), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 197/774 (25%), Positives = 355/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|294677169|ref|YP_003577784.1| outer membrane protein assembly factor YaeT [Rhodobacter capsulatus
           SB 1003]
 gi|294475989|gb|ADE85377.1| outer membrane protein assembly factor YaeT [Rhodobacter capsulatus
           SB 1003]
          Length = 800

 Score =  273 bits (699), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 211/761 (27%), Positives = 355/761 (46%), Gaps = 40/761 (5%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           ++I G   V    ILS   +  G  +S   L+ A + +   G F +V+I      L+I +
Sbjct: 48  VKIEGNDRVEPATILSYAGIAKGARVSAGALNDAFQRLQGSGLFESVEIVPQGGTLVIRV 107

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   +N + F GN  LKDD+L  +V+++    +   T+ AD   + + YA+ G L   +
Sbjct: 108 KEYPTVNVVDFEGNKILKDDKLAGLVKTQPRKVFSPATLEADAAALAEGYATTGRLAARI 167

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +        +++ + I+EG  +++N I F GN+++S  RL  V+  + +G      + 
Sbjct: 168 DPKVIKRDGNRVDVVFEIKEGAVSEVNRITFTGNRSFSDRRLRDVLGTKQAGILHRLIQR 227

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV---SSQVLFDKQKSGYVLIFQIDEGEIYTVG 286
           D +  +R+  D + +  FYH RGY  V+V   SS++  D++  G+ + F I EG+ Y  G
Sbjct: 228 DTFVPDRVQLDRQMLVDFYHSRGYPDVEVTGVSSEMTRDRE--GFFMTFNIREGQQYKFG 285

Query: 287 NISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINR 346
            I+  S ++E+  K    L +IRSG +Y+P EI  +  ++ +        FVRV  RI R
Sbjct: 286 QITTVSEVEELDAKEFEGLAKIRSGRIYSPTEIDYAVTRMEEVALRKGVNFVRVDPRITR 345

Query: 347 DFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRR 406
           D   + +++E+ + +G  ++V+RI+IEGN  + DSVIRRE    EGDP N   I+ A  R
Sbjct: 346 DPRTQTLNVEFALVRGERVFVERIDIEGNTTTLDSVIRREFNTVEGDPFNPREIKNAAER 405

Query: 407 IMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNN 466
           I A G+FS+ ++   P     D VI+ V V++   GS+    +Y    G G+   ++++N
Sbjct: 406 IRALGFFSKADVGTKPGTG-PDQVIVGVDVEEQPTGSLTFGASYGASAGFGLNASLEESN 464

Query: 467 FFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAA 526
           F G+G    ++ G      QN    VE P+ LG  +   F L     E  + D N +   
Sbjct: 465 FLGRGQYLGISVGTTSDNQQNSIDFVE-PHLLGRDLKGRFHLWYNTSESDNSDYNTKMMG 523

Query: 527 V--RMIVPITESISTSFKYD-LR-----FLQYGAISEKEKIPSIYTTLI-----EHGKFS 573
           +   +  P+  +     +Y  LR        Y   +       ++++ I     E G  +
Sbjct: 524 ISPSLEFPLARNARLEMRYSFLRNELSSVTSYADDTADGTDNGLWSSQILVAEEEQGARN 583

Query: 574 SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS--RASYFYLLSDDSD 631
           S     +  ++T    I PR G     S D  G GGD +  +  +  RA    + ++D  
Sbjct: 584 SMGPGYTYTFDTRRTGIDPRTGFTFRFSQDLYGLGGDVEALKTTALLRAER-KVWNEDVT 642

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR--------VDKKYAIG 683
           +   L  G       +  L + D+F  S N  +RGF   G GPR             A+G
Sbjct: 643 LRAELE-GGAIAARGDTTLTILDRF--SGNNKVRGFESNGYGPRDYVHDGAGAANGDALG 699

Query: 684 GKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALG---ADKLEGNDSF-WRV 739
           GK +++      FP+ L PE  G+ G  F D+ +++      G       E +DS   R 
Sbjct: 700 GKYFAALRLESEFPLGL-PEEYGIHGGLFWDTGSVWGLDNTTGGRSGAPSEVDDSLRLRS 758

Query: 740 STGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           + G  + W+S LG + + +   ++  + DK Q F   I  +
Sbjct: 759 AVGFSVFWDSALGPLRLNFMKAIKKEDYDKEQNFDLTIATK 799


>gi|325141196|gb|EGC63696.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis CU385]
          Length = 797

 Score =  273 bits (698), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 197/774 (25%), Positives = 355/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|325133096|gb|EGC55768.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M6190]
 gi|325139074|gb|EGC61620.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis ES14902]
          Length = 797

 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 197/774 (25%), Positives = 355/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDVRTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|50119979|ref|YP_049146.1| outer membrane protein assembly factor YaeT [Pectobacterium
           atrosepticum SCRI1043]
 gi|81645944|sp|Q6D8D5|YAET_ERWCT RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|49610505|emb|CAG73950.1| putative surface antigen [Pectobacterium atrosepticum SCRI1043]
          Length = 814

 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 210/813 (25%), Positives = 369/813 (45%), Gaps = 69/813 (8%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ + ++ 
Sbjct: 6   LLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIGNTIRA 65

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAY 144
           ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  + +   R   A 
Sbjct: 66  LFATGNFEDVRVLRDGETLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVRVGEAL 125

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D   + +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  VGN
Sbjct: 126 DRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINIVGN 185

Query: 205 KNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
           K +S   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S+QV
Sbjct: 186 KAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNIDSTQV 245

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
                K G  +   + EGE Y +  ++++  L       +  L ++  G LYN  ++   
Sbjct: 246 SLTPDKKGIYITINMTEGEQYKLSGVAVKGNLAG-HSAEIEGLTKVEPGELYNGTKVTRM 304

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
            E I K        + RV T+   + A + V +   +D G+  YV+ +  +GND S D+V
Sbjct: 305 EEDIKKLLGRYGYAYPRVVTQPEINDADKTVRLNINVDAGNRFYVRHVRFDGNDTSKDTV 364

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           +RRE+   EG  +   ++E+ K R+   GYF  V +       V+D V +   VK+ + G
Sbjct: 365 LRREMRQMEGAWLGNDLVEQGKERLNRLGYFESVEVETQRVPGVADQVDVTYKVKERNTG 424

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSP 501
           +      +  + G+  +  +  +N+ G G    ++    ++  Q Y   S+ DPYF    
Sbjct: 425 TFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISG--TKNDYQTYVELSLTDPYFTVDG 482

Query: 502 ISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G  +     E    D++D +         +  PI E  + S +  L ++ +  +S+ 
Sbjct: 483 VSLGGRVFYNKFEASDADLSDYTNVSYGVGSTLGFPINE--NNSLRVGLDYV-HNDLSDM 539

Query: 557 EKIPSIYTTLIEHG----------------KFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
               S++  L   G                K +   ++    YN LD    P KG   S+
Sbjct: 540 RPQVSMWRYLDSVGVNPSVVGENVKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASA 599

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSV 658
           +   A  G D++Y+++   ++ +Y L++     ++G  R G+   I S K +  +D F  
Sbjct: 600 NAKIAVPGSDNEYYKLTFDSASYYPLTESGKWVVMGRTRAGFADGIGS-KEVPFYDNFYA 658

Query: 659 SSNYYLRGFAYKGIGPR-------------------------VDKKYAIGGKIYSSASAA 693
             +  +RGF    IGP+                          +   A+GG   +  SA 
Sbjct: 659 GGSSTVRGFQSNTIGPKAAYYKCPANLVGSGFNSYSGCPIDSTNMDDAVGGNAMAVLSAE 718

Query: 694 VSFPMPLVPER--AGLRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEI 745
           +  P P + ++    +R +FFVD  T++  +    A+ L+      G  + +RVS+G+ +
Sbjct: 719 LIVPTPFISDKYANSVRTSFFVDGGTVWDTNWENTAETLKAGVPDYGKATNFRVSSGIAL 778

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            W SPLG +   Y  P++  +GDK +QF F IG
Sbjct: 779 QWMSPLGPLVFSYAQPVKKYDGDKSEQFQFNIG 811


>gi|87199398|ref|YP_496655.1| surface antigen (D15) [Novosphingobium aromaticivorans DSM 12444]
 gi|87135079|gb|ABD25821.1| surface antigen (D15) [Novosphingobium aromaticivorans DSM 12444]
          Length = 905

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 211/833 (25%), Positives = 382/833 (45%), Gaps = 104/833 (12%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           I++ + ++G+  +  + ILS I +  GQ+ S A  D A+K++YA   F++V I+     +
Sbjct: 79  IIKSVTVQGSQRLEPDTILSYIRLRPGQAYSQAAADQALKDLYATELFADVSIRNNSGDV 138

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYL 166
           ++ + E  +IN +   GN  LK+D++   ++  +   +    V ADV  I + Y   G  
Sbjct: 139 VVQVKENPVINRIILEGNKRLKEDKILPEIKLAARQIFTRSKVRADVARIIELYKRQGRF 198

Query: 167 NVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS- 225
              V+ +   +    ++I + I EG K+K+  I  +GN+ +S + L   +  + + +F  
Sbjct: 199 AATVEPKMVMLDQNRVDIVFEISEGPKSKVRQINIIGNEKFSDSELRGEMVTKQARFFRL 258

Query: 226 FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYT 284
           F     Y  +R++FD++ +R FY   GYA  +V S V      K  +++ + ++EGE Y 
Sbjct: 259 FSSGTSYDPDRLAFDQQKLRQFYLTEGYADFRVVSAVAELTPDKRDFIITYVVEEGERYK 318

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
            G++ + S +++   + L   + +++G+ YN + +++  + +++   +    F  V+   
Sbjct: 319 FGDVKVDSQIRDFDSEALAKRLPMKAGDWYNAKMVEDQVDALTETAGAFGYAFADVRPDF 378

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAK 404
           +R+     + + + I +   +YV+R+++ GN  + D V+RRE  L+EGD  N   I+R+ 
Sbjct: 379 SRNKDDLTMSVNFRIAEAPRVYVERVDVNGNTLTQDKVVRREFRLAEGDAFNTFQIKRST 438

Query: 405 RRIMATGYFSE-VNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHID 463
            RI + GYF E   I Q P +   D +IL  +V++   G + ++  +   +    +G I 
Sbjct: 439 NRIKSLGYFQEKFEIEQKPGS-APDRIILEANVEERPTGELQLSAGFSSLESFIFQGSIR 497

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDE 523
            NNF G+G    L+  + R+  ++   S  +PY     IS G D+ +  L   +   +D 
Sbjct: 498 QNNFRGRGQTIGLSVDYSRY-TRSVQVSFTEPYLFDKNISLGVDVYRRDLNSFNYFNSDR 556

Query: 524 SAA---------VRMIVPITESISTSFKYDLRF-------------LQYGAISEKEKIPS 561
           +           +R  VP+TE +S   +Y                 L    +   E + +
Sbjct: 557 NTTYKQATTGFQIRAGVPLTEYMSLIGRYTFNLDDVTLSKSQFYADLNGDGVQTCEPLLA 616

Query: 562 IYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRAS 621
                   GK +S  I  S++Y+TLDN + P +G       D AG GG  +Y R+ + A+
Sbjct: 617 GRYLCDAIGKRTSSIIGASVVYDTLDNRLRPSRGSQFVIGGDIAGLGGSVKYARLTANAA 676

Query: 622 YFYLLSDDSDIVGSLRFGYGCVI---------PSNKNLQLFDQFSVSSNYYLRGFAYKGI 672
            F+ L   S  + S+R G G +I         PS  +++L D+F +     +RGF  +G+
Sbjct: 677 RFFPLG--SGFIFSVR-GEGGIIKALGSRSDDPSIDDVRLTDRFFLGEP-QIRGFDIRGV 732

Query: 673 GPRVDKKY-----------------------AIGGKIYSSASAAVSFPMPLVPERAGLRG 709
           GPRV +KY                       A+GGK Y  + A +  P+       GLR 
Sbjct: 733 GPRVLRKYLVDTNGDGTVDTPSTDRNQWVDDALGGKYYYLSRAELEIPLGSGARELGLRP 792

Query: 710 AFFVDSA-----------------TLY--------------------ANHV--ALGA--D 728
           + ++D+                  TLY                    AN V  A+ A  +
Sbjct: 793 SIYLDAGAVWGVNRPQTQNVNSAVTLYRQTYQGTTTIVTSPTAPDNTANTVYTAIPAYVE 852

Query: 729 KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +  G+    RVS G+ + WNSP G   + +   L+   GD  + F F +G + 
Sbjct: 853 EYVGDTPSPRVSVGIGVNWNSPFGPFRLDFAKVLKKANGDDPKTFTFNVGTQF 905


>gi|294671228|ref|ZP_06736081.1| hypothetical protein NEIELOOT_02938 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307056|gb|EFE48299.1| hypothetical protein NEIELOOT_02938 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 800

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 190/779 (24%), Positives = 353/779 (45%), Gaps = 52/779 (6%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
            ++ I + G  +     + + +PV VG +  D   +  + N+YA G F +V+++ + + L
Sbjct: 24  TIQDIRVEGLQHTEPATVFTYLPVKVGDTFHDGQGEEIIGNLYATGLFDDVRVESMGNQL 83

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAYDEDTVNADVHNIKQAYASI 163
           ++ ++ER II+    SG   +++D +K  + +     +  +++  +N  V  +K+ Y   
Sbjct: 84  LLTVVERPIISSFEVSGGKLIQNDAIKKNLTAFGLGQSQPFNQGRLNEAVAGLKEEYQKQ 143

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G  +V +      ++   + +   I+EG    I+ I F GN++YS +RL + +S+   G 
Sbjct: 144 GKYSVQITPSVTRLARNRVAVELKIDEGKTTTISDIEFEGNQHYSDSRLRKQMSLSEGGA 203

Query: 224 FSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK-VSSQVLFDKQKSGYVLIFQIDEGE 281
           F++  K++ ++ ++ S D E IR FY + GY   + V ++V   + +    +   + EG+
Sbjct: 204 FTWLTKSNRFNPDKFSQDLERIRDFYQNNGYFDFQIVDTEVKMSEDQKHQTMKITVSEGQ 263

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            Y  G +SI+   +E+ K+ L S ++++ G  Y+  ++ ES EKI K   +       V 
Sbjct: 264 RYRWGKVSIEGDTKEVPKEELYSHLKMKEGKWYDRAQMLESLEKIQKSMGTAGYALSEVN 323

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
            +   +    +VD    I+    +YV +I I GN+++ D V+RREL   E  P + S ++
Sbjct: 324 VQPQPNTQTGVVDFVLHIEPNRKVYVNKINISGNNKTRDEVVRRELRQMEAAPYDMSKLQ 383

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
           R+K R+   GYF +V     P     D V + +SV + + GS+ ++  +  D G+ +   
Sbjct: 384 RSKERVELLGYFDDVKFEARPVAGTPDQVDIDMSVNERATGSLDLSAGWVQDTGLVMAFG 443

Query: 462 IDDNNFFGQGYRARLAAGFGR-HAVQNYTFSVEDPYFLGSPISAGFDL---------QKT 511
           +  +N FG G    ++A   R     N + S  DPYF    +S G+DL           +
Sbjct: 444 VAQDNLFGTG--KSISARVSRSKTTNNASLSFTDPYFTPEGVSLGYDLYGKVYDPRKSSS 501

Query: 512 HLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH-- 569
              +     +     +RM VP+TE    +F      +Q    +     P  Y   I    
Sbjct: 502 SASNAQYKTSTVGGGIRMGVPVTEYDRVNFGLGAEHMQVQTFT---GAPKRYRDFISQYG 558

Query: 570 ------GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRAS 621
                 GK+   ++  ++ +  N  D+ + P +G L   + +    GGD QY+ +     
Sbjct: 559 NSNTGIGKYKGWTLKGTVGWGRNKTDSALWPTRGYLTDVNLEAGLPGGDLQYYSLTHNQK 618

Query: 622 YFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----D 677
           +F+ LS +  ++     G       NK L  F  F       +RG+    +GP+V     
Sbjct: 619 WFFPLSKNFTLMLGGSVGAADGYGKNKELPFFQNFYGGGLGSVRGYESGTLGPKVYDNNG 678

Query: 678 KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------------------ 719
            K + GG    S +A + FP P + +   +R + F D+ +++                  
Sbjct: 679 DKISYGGNKMLSGTAELLFPFPGIKDSRSVRLSLFADAGSVWDGKTYTDDSSDLYNGSTI 738

Query: 720 ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            N   +G           R S G  + W SPLG M   Y  P++ +  D++Q+F F++G
Sbjct: 739 QNVYGVGNRHKSSFKEELRYSAGAAVTWMSPLGPMKFSYAYPMKKKASDEVQRFQFQLG 797


>gi|296313403|ref|ZP_06863344.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           polysaccharea ATCC 43768]
 gi|296840114|gb|EFH24052.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           polysaccharea ATCC 43768]
          Length = 808

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 195/792 (24%), Positives = 355/792 (44%), Gaps = 72/792 (9%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFALHIEPGRKIYVNEIYITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P  +  D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLANTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K+    
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKSSSGV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                      VRM +P+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIKQYGKTNG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYAGGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN-------------------- 721
            GG   ++ SA + FPMP   +   +R + F D+ +++                      
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGTGTGAAG 740

Query: 722 ---------------HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
                          H +  A++L       R S G  + W SPLG M   Y  PL+ + 
Sbjct: 741 TTGGRVQNVYGPGNIHKSTFANEL-------RYSAGGAVTWLSPLGPMKFSYAYPLKKKT 793

Query: 767 GDKIQQFGFRIG 778
            D+IQ+F F++G
Sbjct: 794 EDEIQRFQFQLG 805


>gi|254420176|ref|ZP_05033900.1| outer membrane protein assembly complex, YaeT protein
           [Brevundimonas sp. BAL3]
 gi|196186353|gb|EDX81329.1| outer membrane protein assembly complex, YaeT protein
           [Brevundimonas sp. BAL3]
          Length = 804

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 201/752 (26%), Positives = 358/752 (47%), Gaps = 39/752 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V RI ++GA  + +  +LS +P+  G ++  A LD AV+ +   G F++V++ + +  LI
Sbjct: 62  VNRILVQGAQRIDQTTVLSYLPIRPGDTVDAAVLDVAVRTLSRTGLFADVQLGVQNGDLI 121

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + ++E  IIN + F GN+ L  D+L   V  +    Y    V  DV  I + Y   G ++
Sbjct: 122 VQIVENPIINQVVFEGNSALSQDKLTKEVTLQPRGIYTRAKVQEDVGAIVELYRLQGRIS 181

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF- 226
             V  +   +    +++ + I EG +  I++I  +GN  +S   +  V+    S ++ F 
Sbjct: 182 ATVTPKLVQLEQNRVDVIFEINEGPQTGISAINILGNHAFSDNDVRGVMVTERSQWWKFF 241

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
              D Y   R+ +D+E +R FY +RGY   ++ S V         + L   ++EG+ Y  
Sbjct: 242 SSNDNYDPNRLDYDQEQLRKFYTNRGYYDFRIVSSVAELQPDDQAFQLTLTLNEGDKYNF 301

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G + + +    +  + L +L+ IR G LY   +I+++ + ++    S    FV +     
Sbjct: 302 GKVDVITQNDRLNAEFLKALVPIREGQLYESDKIEQAVDALTFAAGSAGYAFVEINPTYR 361

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
            +     VD+ + + +G  +Y+ RI + GN ++ D VIRREL L+EGD  N +++ER++ 
Sbjct: 362 ANPDTDTVDVTFNVSEGQRVYIDRINVVGNTRTIDPVIRRELMLTEGDAFNRALMERSRN 421

Query: 406 RIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDN 465
            + A G+F +V I +   +   D  ++ V+V++   G + +   +       V   I + 
Sbjct: 422 NLRALGFFKDVTIEETRGS-APDRSVINVNVQEQPTGELSVGAGFSSVDSFTVNLGISER 480

Query: 466 NFFGQGYR--ARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLED---GSLDI 520
           NF G+G    ARL  G  R  V    F   +P FLG  + AG+DL  +  +     S D 
Sbjct: 481 NFRGRGQNVVARLEWGSLRQQVD---FRFTEPKFLGRDLRAGWDLFHSRYDLSKYSSYDY 537

Query: 521 NDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIY--------TTLIEH-GK 571
                 +R+  P+  ++  S +Y L+       S++  +P+ Y        + L +  G 
Sbjct: 538 RSTGGGLRLSYPLNGNMLLSTRYFLK-------SDEIIVPTGYCNATGSGSSALCDQVGS 590

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           + + S+  ++  N  ++P+ P +G   S   D AG GGD  Y +  + A+++Y  S    
Sbjct: 591 YINSSVGYTLQMNYTNDPVRPTRGWSGSLRQDLAGLGGDVNYVKTEADAAWYYGFS--PR 648

Query: 632 IVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSS 689
            V S++   G V   N + +++ D+F    N + RGF   G+GPR +    A+GG  Y+ 
Sbjct: 649 WVVSVQGSTGYVSGWNGDPIRINDRFFKGGNSF-RGFETAGMGPRDLRTTDALGGNFYAI 707

Query: 690 ASAAVSFPMPLVPERAGLRGAFFVDSATL------YANHVALGADKLEGNDSFWRVSTGV 743
            +  ++ P  L PE+ G++ + F D  TL      Y        +    ++   R S GV
Sbjct: 708 GTVELTLPNYL-PEQYGIKTSLFADVGTLGVLDDRYKLTTTGTVNTNIADELSLRASAGV 766

Query: 744 EIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
            I W SP+G +       L   + DK + F F
Sbjct: 767 SIHWKSPMGPIRFDISKVLSKEDYDKTESFRF 798


>gi|319411332|emb|CBY91743.1| Outer-membrane protein assembly factor Omp85 [Neisseria
           meningitidis WUE 2594]
          Length = 811

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 197/774 (25%), Positives = 354/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 39  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 98

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 99  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 158

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 159 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 218

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 219 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 278

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++ E    I     S    +  +  
Sbjct: 279 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTEVLGAIQNRMGSAGYAYSEISV 338

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 339 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 398

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 399 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 458

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 459 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 517

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 518 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 574

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 575 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 634

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 635 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 694

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 695 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 754

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 755 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 808


>gi|302383600|ref|YP_003819423.1| outer membrane protein assembly complex, YaeT protein
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302194228|gb|ADL01800.1| outer membrane protein assembly complex, YaeT protein
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 823

 Score =  271 bits (694), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 203/770 (26%), Positives = 363/770 (47%), Gaps = 53/770 (6%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           + T +V RI ++G   + +  +LS +P+  G +I    LD A++ +     F++V+I + 
Sbjct: 64  TETGVVNRILVQGNQRIDQTTVLSYLPIQPGDTIDPVILDVAIRTLTRTQLFADVQIGLQ 123

Query: 103 DSV-LIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYA 161
           ++  L++ ++E  IIN + F GN+ + +D+L+  V       Y    V  DV  + + Y 
Sbjct: 124 ENGDLVVRIVENPIINQVVFEGNSAINEDKLREEVTISPRGIYTRARVQEDVGKLIELYR 183

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTS 221
             G ++  V  +   +    +++ + I+EG +  + +I F+GN+ +S + L  V+  + S
Sbjct: 184 LSGRISATVTPKLVQLEQNRVDVVFEIDEGPETGVQAITFLGNQAFSDSELREVMVTKES 243

Query: 222 GYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDE 279
            ++  F K D Y   R+ +D E +R FY +RGY   +++S V       S + +   +DE
Sbjct: 244 AWYRLFTKNDNYDPGRLDYDREQLRKFYTNRGYYDFRITSAVAELVPDDSAFGMTLTVDE 303

Query: 280 GEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVR 339
           G+ Y  G I + +    +    L  L+ I+SG+LY   +I+ S + ++    S    FV 
Sbjct: 304 GDRYNFGTIDVVTENDRLNADFLKLLLPIQSGDLYESDKIESSVDALTFAAGSAGYAFVD 363

Query: 340 VKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSM 399
           +      +     VD+ + I +G  +YV RI I GN ++ D VIRREL L+EGD  N ++
Sbjct: 364 INPTYRANPDTDTVDVTFNISEGQRVYVDRINIIGNTRTVDPVIRRELLLTEGDAFNRTL 423

Query: 400 IERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVE 459
           +ER++  +   G+F +V I +   +   D  I+ V+V++   G + +   +       V 
Sbjct: 424 VERSRNNLRGLGFFKDVTIEEQRGS-APDRSIVNVTVQEQPTGELSVGAGFSSVDSFVVN 482

Query: 460 GHIDDNNFFGQGYR--ARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL---E 514
             I + NF G+G    AR+  G  R  +    F   +P FLG  I AGFDL  +     E
Sbjct: 483 LGISERNFRGRGQNVVARVEWGSLRQQID---FRFTEPRFLGRDIGAGFDLFHSRYDFQE 539

Query: 515 DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTT--------L 566
           + S D     A +R+  P+      + +Y ++        ++  +P+ Y +        L
Sbjct: 540 ESSFDYRSTGAGLRLTYPLNGYSRLATRYFIK-------DDEIIVPTGYCSGGGQGSAAL 592

Query: 567 IEH-GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
            E  G   + S+  +++ +  ++PI P +G   S   D AG GGD  Y +    +S +Y 
Sbjct: 593 CEQIGASLNSSVGYTLLVDRRNDPIRPTRGWTGSLRQDVAGLGGDVNYVKTEIESSVYYG 652

Query: 626 LSDDS--DIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAI 682
           ++      + GS  +  G    +   +++ D+F    N + RGF   G+GPR +    A+
Sbjct: 653 ITPSWIVTVTGSTGYVSGW---AGDAIRINDRFFKGGNTF-RGFENAGMGPRDLATNDAL 708

Query: 683 GGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL------YANHVALG---------- 726
           GG  Y+  S  ++ P  L PE+ G++ + F D  TL      Y  +   G          
Sbjct: 709 GGNFYAVGSVELTLPNGL-PEQYGIKTSLFADVGTLGVLDDRYTLNATTGLSSACPDGAV 767

Query: 727 -ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
             D    +D   R S G+ + W +P+G +   +   L   E D+ + F F
Sbjct: 768 IGDSCVADDLSLRASVGLSVHWRAPVGPIRFDFSKILSSEEYDRTETFRF 817


>gi|1766042|gb|AAC17600.1| outer membrane protein [Neisseria gonorrhoeae]
          Length = 792

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 194/771 (25%), Positives = 352/771 (45%), Gaps = 46/771 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D +L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGLLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +I    I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIVCPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  ++D + +++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSDRFDRQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTRQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAGTKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL-------QKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G+D+       +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDIYGKAFDPRKASTSV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI-EHGKFSS 574
                      VRM +P+TE    +F      L    ++   K P  Y   I ++GK   
Sbjct: 504 KQYKTTTAGGGVRMGIPVTEYDRVNFGLAAEHL---TVNTYNKAPKRYADFIKQYGKTDG 560

Query: 575 HSIS-QSIIY--------NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              S + ++Y        N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ADGSFKGLLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND------- 734
            GG   ++ SA + FPMP   +   +R + F D+ +++       A+   GN+       
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGRTYTAAE--NGNNKSVYSEN 738

Query: 735 -------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                  +  R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 739 AHKSTFTNELRYSAGGAVTWLSPLGPMKFIYAYPLKKKPEDEIQRFQFQLG 789


>gi|119386706|ref|YP_917761.1| surface antigen (D15) [Paracoccus denitrificans PD1222]
 gi|119377301|gb|ABL72065.1| surface antigen (D15) [Paracoccus denitrificans PD1222]
          Length = 782

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 203/758 (26%), Positives = 356/758 (46%), Gaps = 40/758 (5%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + I G   +    ILS + +  GQ +S   L+ A++ +   G F  V++      L++ +
Sbjct: 38  VRIEGNQRIEPATILSYLDLPRGQDVSAGALNDAMQRLQNSGLFETVELVPSGGTLVVRV 97

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   IN + F GN  LK++ L  IV+S+S   Y      AD   I Q YAS G L   V
Sbjct: 98  AEYPTINTVAFEGNRRLKNENLAEIVKSQSRRVYSPAQAEADAAAISQVYASQGRLAARV 157

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +        +++ + I EG   +I  I FVGN+ +S  RL  V+  + +G   +F + 
Sbjct: 158 DPRIIRRGSNQVDLVFEIREGDVTEIERIGFVGNRAFSDRRLRNVLQTKQAGILRTFIRR 217

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTVGNI 288
           D ++ ER+  DE+ +  FY  RGYA  +V +      +++  + + FQI EG  YT G I
Sbjct: 218 DTFAPERVPLDEKLLTDFYRSRGYADFRVQAVAPELARERDAFYITFQIHEGPRYTFGTI 277

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           +  S +  +      +  R++ G +YNP +I  +  ++          FV ++ R+ R+ 
Sbjct: 278 NTVSEIPGVDATEFAAQNRVKRGAVYNPTDIDTTIRRMEALALRKGLNFVNIEPRVTRNE 337

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
             + +D+ + + +G  ++V+RI+IEGN  + D VIRR+    EGDP N   I  +  R+ 
Sbjct: 338 RSQTLDLTFALTRGPRVFVERIDIEGNTTTLDEVIRRQFATVEGDPFNPREIRNSAERLR 397

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+FS+V     P +   + VI+ V+V++   GS+    +Y    G+G    + + NF 
Sbjct: 398 ALGFFSDVQAESRPGSS-PEQVIVDVNVEEQPTGSLNFGVSYGAATGVGFNISLSEKNFL 456

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVR 528
           G+G +  LA   G    Q+   +  +PYFLG  + A    Q  +     L+ +  +  V 
Sbjct: 457 GRGQQVDLAFSTGTD-TQSSGLTFVEPYFLGRNLRA--RAQAWYNTTDRLNSDYNTRTVG 513

Query: 529 MIVPITESISTSFKYDLRF-LQYGAISEKEKI--PSIYTTLI--------EHGKFSSHSI 577
            +  I   +S + + +LR+ L    + + E+I   S  + L+        E G F + ++
Sbjct: 514 FLTGIEFPVSENGRVELRYKLSKDTLFDVEEIHMDSESSRLVGSSPILFDEQGGFFTSAV 573

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD------SQYHRIGSRASYFYLLSDDSD 631
             +  Y++    + P     + +  D+AG GGD      + Y  + SRA       ++  
Sbjct: 574 GYTYSYDSRIAGLDPVTSYRLRAGQDFAGLGGDVKSVTSTLYAGVESRA-----WRENVT 628

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---VDKKYAIGGKIYS 688
           ++  L FG   ++  ++N +  ++F  + N  +RGF   G+GPR      + A+GG  + 
Sbjct: 629 MLAELEFGAVHML-DDQNSRFLNRF--TGNGKIRGFEPNGLGPRDLNAPNQDALGGNYFW 685

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGAD----KLEGNDSFW-RVSTGV 743
           +    + FP+ L PE  G+ G  F D+ +++      GA       E +D    R + G 
Sbjct: 686 ALRTELQFPLGL-PEEYGITGGLFADAGSVWGLDNTTGATPGDYPQEVDDGMKVRAAVGA 744

Query: 744 EIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            I W +P+G +   +   L+  + D+ Q F   I  R 
Sbjct: 745 SIFWTTPIGPLRFNFAKALKKEDYDEEQTFDLTISTRF 782


>gi|291614106|ref|YP_003524263.1| outer membrane protein assembly complex, YaeT protein [Sideroxydans
           lithotrophicus ES-1]
 gi|291584218|gb|ADE11876.1| outer membrane protein assembly complex, YaeT protein [Sideroxydans
           lithotrophicus ES-1]
          Length = 760

 Score =  271 bits (693), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 205/765 (26%), Positives = 356/765 (46%), Gaps = 31/765 (4%)

Query: 31  FYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYA 90
            +A+   ++V       ++ I + G        + S +PV VG ++ D     ++  ++A
Sbjct: 9   LFALLYSTSVMAIEPFTIKDIRVEGIQRTEPGTVFSYLPVKVGDTMDDEHATASLHALFA 68

Query: 91  MGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDED 147
            G+F +V++K   SVLI+ + ER  +  +  +G  +    QL   ++    A    +D+ 
Sbjct: 69  TGFFKDVELKAEGSVLIVVVKERPTVASVEINGVKDFPKSQLLDNLKYVGLAEGRIFDKS 128

Query: 148 TVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNY 207
            +    + +K+ Y + G  +V+VK     +    + +++ +EEG  +KI  I  VGNK Y
Sbjct: 129 ALEKSENELKRQYIARGKYSVVVKTTVKDLERNRVAVSFNVEEGSASKIRLINIVGNKAY 188

Query: 208 SHARLERVISIRTSGYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFD 265
           S   L   + + T G+FS F K D YSK+++S D E++R FY + GY    + S+QV   
Sbjct: 189 SEKDLLDTMQLTTPGWFSWFSKNDQYSKQKLSADMESLRTFYMNSGYMDFTIESTQVSIS 248

Query: 266 KQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEK 325
             K    +   I EG+ YTV +I +  T   +  + +  LI I+ G++++   I ES+ K
Sbjct: 249 PDKKDIFITLNISEGDKYTVSDIKVAGTQAVLSHEEMRKLIGIQPGDVFSRDAITESTRK 308

Query: 326 ISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRR 385
           I +        F  V      D AK  V   +++D     Y++RI I GND++ D VIRR
Sbjct: 309 IGERLGEEGYAFANVNAAPEIDKAKHQVAFTFVVDPLQRAYIRRINITGNDKTRDEVIRR 368

Query: 386 ELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVG 445
           E    EG     S I+++K+R+   G+FS+VN+   P     D + L + V + S G+  
Sbjct: 369 EFRQMEGGWFATSKIKKSKQRLDRLGFFSDVNVDTSPVQGTGDQLDLNLKVAERSTGNFS 428

Query: 446 IATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG 505
           I   Y   + + +   +  +N FG G          +   Q Y+ S  +PY+    IS G
Sbjct: 429 IGAGYSSLEKLTLMAGVTQSNVFGTGNSLSTQINTSKLN-QVYSVSYTNPYYTDDGISRG 487

Query: 506 FDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
           FD+ K       + ++  +     A VR  VPIT+     F Y L F Q   I      P
Sbjct: 488 FDVYKRRTNATQITVSQYTSDTYGAGVRYGVPITD--DQMFHYGLSFEQT-TIGLTSLSP 544

Query: 561 SIYTTLIEHGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
             +   I     ++ +   +I +  +T D+ I   +G++ +S  + +    D +Y++   
Sbjct: 545 QRFVDYINTFGPTNRNELGTIGWSQDTRDSAIFTTEGVMQNSYIELSIPSSDQRYYKWTY 604

Query: 619 RASYFYLLSDDSDIVGSLRF----GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGP 674
           +  +F+ LS    ++ +  F    GYG +      L  F  F       +RG+    +GP
Sbjct: 605 QNQWFHPLSRSFTLMTNANFGVAGGYGGM-----PLPFFKNFYAGGVGSVRGYDPNSLGP 659

Query: 675 RVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND 734
           R    Y++GG   +  +  + FPMP + +   LR + F+D   ++ +       ++ G D
Sbjct: 660 RDINNYSLGGNKLAVGNIELLFPMPGMEKEKSLRLSAFLDGGEIFGS-----GGQVPGTD 714

Query: 735 SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
              R STG+ + W SP G + + +  PL  +  DKIQ   F +G+
Sbjct: 715 GM-RYSTGLALTWFSPAGPLKLSWARPLNKQPQDKIQNLQFTLGS 758


>gi|269138101|ref|YP_003294801.1| conserved outer membrane protein [Edwardsiella tarda EIB202]
 gi|267983761|gb|ACY83590.1| conserved outer membrane protein [Edwardsiella tarda EIB202]
 gi|304558145|gb|ADM40809.1| Outer membrane protein assembly factor YaeT precursor [Edwardsiella
           tarda FL6-60]
          Length = 795

 Score =  271 bits (692), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 216/799 (27%), Positives = 371/799 (46%), Gaps = 54/799 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  ++L   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL + 
Sbjct: 3   MKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLSNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ +YA G F +V++    + LI+ + ER  I  + FSGN ++KD+ LK  + +   R  
Sbjct: 63  IRALYATGNFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  N  VK     +    +++  V  EG  A+I  I  
Sbjct: 123 EALDRTTLSSIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +S A L     +R    +++      Y K++++ D EA+R++Y DRGYA   + S
Sbjct: 183 VGNHAFSSAELLGHFQLRDDVPWWNLMADRKYQKQKLAGDLEALRSYYLDRGYARFAINS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EGE Y +  + +   +     + +  L ++  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGEQYKLEGVDVTGNMAGYSAE-ITRLTKVEPGELYNGAKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  ++I +        + RV+T+   +   + V +   ID G+  YV++I   GND S 
Sbjct: 302 TKMEDEIKQLLGRYGYAYPRVQTQPEINDKDKTVVLHMNIDAGNRYYVRQIRFVGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D+V+RRE+   EG  +    +E+ K R+  TGYF  V++         D V +   VK+ 
Sbjct: 362 DAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS      Y  + G+  +  +  +N+ G G    +A    ++  Q Y   S+ DPYF 
Sbjct: 422 NTGSFNFGIGYGTESGVSFQVGVQQDNWLGTG--NVVAINGTKNDYQTYAELSLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAV-----RMIVPITESISTSFKYDLRFLQYGAI 553
            + +S G  L     +    D++D + +       +  PI E  + S +  L ++ +  +
Sbjct: 480 VNGVSLGGRLFYNDFKANDADLSDYTNSSYGFDGTLGFPINE--NNSLRTGLGYV-HNDL 536

Query: 554 SEKEKIPSIYTTLIEHG-----------KFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
           S+ +   +++  L   G           K   ++ +    YN LD    P  G   S + 
Sbjct: 537 SDMQPQVAMWRYLRSVGQNPSDSQRASYKADDYTWTAGWAYNNLDRGFFPTAGSKASLNG 596

Query: 603 DYAGFGGDSQYHRIG-SRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y+++     SYF +  D + +V G  R GYG      K +  ++ F    
Sbjct: 597 KITLPGSDNEYYKLTFDSQSYFPINQDRTWVVLGRTRLGYGNGF-GGKEMPFYENFYAGG 655

Query: 661 NYYLRGFAYKGIGPR---------VDKKY-----AIGGKIYSSASAAVSFPMPLVPER-- 704
           +  +RGF    IGP+         VD+       A+GG   + AS  +  P P V E+  
Sbjct: 656 SGTVRGFQSNNIGPKAVYLNGDGSVDQSKTGDNDAVGGNAMAVASLELITPTPFVSEQYA 715

Query: 705 AGLRGAFFVDSATLYANHVALGA-----DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
             LR + F+D+ T++  +    A     D  +  +   R+S G+ + W SPLG +   Y 
Sbjct: 716 NSLRTSVFMDAGTVWDTNWDQAAYPTLPDYSKATNV--RLSAGIALQWMSPLGPLVFSYA 773

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P++  EGDK +QF F IG
Sbjct: 774 QPVKKYEGDKAEQFQFNIG 792


>gi|293394711|ref|ZP_06639003.1| protective surface antigen D15 [Serratia odorifera DSM 4582]
 gi|291422837|gb|EFE96074.1| protective surface antigen D15 [Serratia odorifera DSM 4582]
          Length = 800

 Score =  271 bits (692), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 208/804 (25%), Positives = 370/804 (46%), Gaps = 59/804 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVTDDDISNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +++  L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHAFTNDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y + ++ +   L       +  L +I  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITVNITEGDQYKLSDVVVNGNLAG-HSAEVAQLTKIEPGELYNGSKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  + I K        + RV+T+   + A + V +   ID G+  YV+RI+ EGND S 
Sbjct: 302 TKMEDNIKKMLGRYGYAYPRVQTQPEINDADKTVKLHVNIDAGNRFYVRRIKFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +    +E+ K R+   GYF  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNDQVEQGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + G+      Y  + G+  +  +  +N+ G GY   ++    ++  Q Y   S  +PYF 
Sbjct: 422 NTGTFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGVSG--TKNDYQTYAELSATNPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAV-----RMIVPITESISTSFKYDLRFLQYGAI 553
              +S G  +     +    D++D + +       +  PI E  + S +  L ++ + ++
Sbjct: 480 VDGVSLGGRIFYNDFKADDADLSDYTNSSYGVDGTLGFPINE--NNSLRAGLGYV-HNSL 536

Query: 554 SEKEKIPSIYTTLIEHG-----------KFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
           S+ +   +++  L   G           K    +++    YN LD    P  G   + + 
Sbjct: 537 SDMQPQIAMWRYLESMGQDPNTTDRASYKADDFTLNLGWTYNNLDRGYFPTSGNRTTLNG 596

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y+++   +  +  ++DD    ++G  R GY   +   K +  ++ F    
Sbjct: 597 KVTIPGSDNEYYKVTLDSVQYVPINDDRTWVLLGRGRLGYADGL-GGKEMPFYENFYAGG 655

Query: 661 NYYLRGFAYKGIGPR-----------------VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
           +  +RGF    IGP+                      A+GG   + AS  +  P P + E
Sbjct: 656 SSTVRGFQSNTIGPKAVYYNSNSYSCSNGTKICGSDDAVGGNAMAVASMELITPTPFISE 715

Query: 704 R--AGLRGAFFVDSATLYANHVALGADKLEGND-------SFWRVSTGVEIMWNSPLGMM 754
           +    +R + FVD+ T++  +    + +  G D          RVS G+ + W SPLG +
Sbjct: 716 KYANSVRTSLFVDAGTVWDTN--WDSSQTTGYDIPDYSKPGNIRVSAGIALQWMSPLGPL 773

Query: 755 GVYYGIPLRHREGDKIQQFGFRIG 778
              Y  PL+  EGDK +QF F IG
Sbjct: 774 VFSYANPLKDYEGDKSEQFQFNIG 797


>gi|313672265|ref|YP_004050376.1| outer membrane protein assembly complex, yaet protein
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939021|gb|ADR18213.1| outer membrane protein assembly complex, YaeT protein
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 743

 Score =  271 bits (692), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 216/777 (27%), Positives = 375/777 (48%), Gaps = 66/777 (8%)

Query: 27  FIILFYAI-FGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAV 85
           F+ILF  I F L A      S + ++ ++G   V    I S I +  G       +D +V
Sbjct: 5   FVILFLLISFNLFA------STIDQVLVQGNKRVSTSKIQSYI-LKAGDDFDLKKIDDSV 57

Query: 86  KNIYAMGYFSNVKIKIV---DSVLIIDLI-ERKIINHLFFSGNNNLKDDQLKMIVRSRSA 141
           K +Y  G F +VK+++    D ++I+ ++ E+  IN ++F GN  LK+D+LK  ++ +  
Sbjct: 58  KKLYESGLFLDVKVELKFEDDRMIIVYIVKEKPFINKVYFEGNKELKEDKLKEELKIKEN 117

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
           A +D++ +   + +I++ Y    + NV +           ++I + IEEGV++KI  I F
Sbjct: 118 APFDKNLIEDAIKDIRKKYEDNNFYNVKISYDIEERGNNAVDIVFSIEEGVESKIYKIEF 177

Query: 202 VGNKNYSHARLERVISIRTSGYFSF----GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
            GNK +    L+++I     G FS+    GK     ++ + +D E +R  Y + GY  VK
Sbjct: 178 YGNKQFKTKELKKLIETNEKGIFSWLTGSGKI---KRDNLDYDRERLRQHYLNNGYMRVK 234

Query: 258 VSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNP 316
           ++  ++ +   K    L+F+I+EGE Y VG I+ +  +  +  KTL + + ++ G++++ 
Sbjct: 235 IAEPELTYSDDKKKVTLVFRIEEGEKYKVGEIAFKGNVH-LDNKTLFNRLTLKPGDIFSA 293

Query: 317 QEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGND 376
           ++ +   + ++  F      F  V    +    ++IV+I Y I++    Y+ RI I GN+
Sbjct: 294 EKFQNDIKSLTDAFTEIGYAFANVDPLNDIKDNEKIVNITYNIEENILYYINRIIISGNN 353

Query: 377 QSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVI-LRVS 435
           ++ D VIRRE E+ EG+  N S I+++K+ +  T YF EVN+ +   + VS+ ++ L+++
Sbjct: 354 KTRDRVIRREFEIVEGEKYNSSKIKQSKQHVEFTNYFEEVNLKE---DVVSEGLMNLKLN 410

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDP 495
           VK+   G   I   Y    G+     ++  N FG GY   L A F      +YT S  +P
Sbjct: 411 VKEKPTGMFTIGAGYSSLDGVTGMASVNQQNLFGLGYSLGLKAEFSSKRT-DYTLSFTNP 469

Query: 496 YFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITE-SISTSFK--------YDLR 546
           +    PI+ G DL              E  A+R+  PI +  +  ++K        YDL 
Sbjct: 470 WLFDRPITFGVDLYNLKRSYYEYTKKSEGMALRLGHPIIKRKLYANYKLAYDKIRIYDLD 529

Query: 547 FLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
           +     + E+E            G+ ++ S + S+++NTL++P  P KG   +     AG
Sbjct: 530 WDASDYVREQE------------GETTTISFTPSLVWNTLNHPFDPSKGNKSTLFVKLAG 577

Query: 607 --FGGDSQYHRIG-SRASYFYLLSDDSDIVGSL--RFGYGCVIPSNKNLQLFDQFSVSSN 661
              GGD+ + + G   A YF L       VG L    GY   I  +K L + +++ +   
Sbjct: 578 TVLGGDNDFVKTGVESAQYFPLF---WSFVGMLHGETGYLAKI-GDKKLPIDERYRLGGM 633

Query: 662 YYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN 721
           Y +RG+ Y  I P+    Y  GG  Y   +A +SF    + +    +G FF D+  +Y  
Sbjct: 634 YSVRGYKYGDISPKDKNGYDYGGDKYVLFNAELSFD---ISKENKFKGVFFFDAGQVYDE 690

Query: 722 HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           +    +  L       R S G    W SP+G + + YG  L    G+   ++ F IG
Sbjct: 691 NEGYMSRSL-------RKSIGYGFRWFSPIGPLRIEYGHKLDREPGESSGRWDFSIG 740


>gi|237808848|ref|YP_002893288.1| outer membrane protein assembly complex, YaeT protein [Tolumonas
           auensis DSM 9187]
 gi|237501109|gb|ACQ93702.1| outer membrane protein assembly complex, YaeT protein [Tolumonas
           auensis DSM 9187]
          Length = 807

 Score =  270 bits (691), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 209/779 (26%), Positives = 354/779 (45%), Gaps = 49/779 (6%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           IV+ I I G   V     L  +PV VG  +      +AVK +Y+ G F +VK+      L
Sbjct: 28  IVKDIRIEGLQRVTLGAALLSLPVRVGDKLDSNTSANAVKRLYSSGNFDDVKLLRDGDAL 87

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAYDEDTVNADVHNIKQAYASI 163
           ++ + ER  I+ + F GN ++K++QLK  + S   R   A D   + +   +++  Y  +
Sbjct: 88  VVQVKERPTISQIEFDGNKDIKEEQLKQTLESSGVRVGEALDRTMLRSLEKSLEDFYYGV 147

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTS-G 222
           G  +  V+     +    +N+ +   EGV AKI  I  VGN  +   +L   +S+R    
Sbjct: 148 GKYSAKVQAVVTPLPRNRVNLKFKFIEGVSAKIQQINIVGNTKFPEEKLIAQLSLRDDVP 207

Query: 223 YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGE 281
           +++F     Y K+++  D E +R++Y +RGYA  KV S+QV     + G  +   I EGE
Sbjct: 208 WWNFMADQKYQKQKLEADIETLRSYYMNRGYAKFKVNSTQVSMTPDRKGLYVTLNIHEGE 267

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            YT+ NI ++    E     + +LI +  G +Y+  ++  + E +SKY       + +V 
Sbjct: 268 QYTINNIDLKGNF-EGHGAEMRNLIPLEKGAMYSAADVTHTEEVLSKYLGRFGYAYPKVT 326

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
           T  + +   + VD+   ++ G  +YV+RI   GN  + D V+RRE+   EG  ++   IE
Sbjct: 327 TYPSMNDETKQVDLNINVEPGPRVYVRRINFTGNQITKDEVLRREMRQMEGAWLSGDKIE 386

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
            +K R+   GYF +V++         D   L V VK+ S GS+     Y  + GM  +  
Sbjct: 387 SSKARLDKLGYFEKVDVQPHRVAGREDQADLDVDVKERSVGSINGGIGYGTESGMSFQAG 446

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS---L 518
           I  +NFFG G +  +     +++ +N   S  DPYF    +S G  +       G    +
Sbjct: 447 IQQDNFFGSGNKGAINFETNKYS-RNVELSFTDPYFTVDGVSLGGKVYYNKFTAGDANLV 505

Query: 519 DINDESAAVRMIV--PITE--SISTSFKYDLRFL----QYGAISEKEKIPSIYTTLIEHG 570
           D ++E+   R+ +  P+ E  ++     Y+   L     Y  I++   I SI  T   H 
Sbjct: 506 DYDNETVGARVSLGYPLDELNNLEYGLGYEHNKLSKTTNYAQINKFWYINSIDLTDDGHA 565

Query: 571 KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDS 630
            F  + +S +   N L+  + P +G    +S      G D Q+++I    +++Y    D 
Sbjct: 566 IFDDYDVSLTWTRNNLNKGVFPTQGNRQQASGKITIPGSDLQFYKISFEDAHYYPFDRDH 625

Query: 631 DIVGSLRF------GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV-------- 676
             V + RF      GYG     ++ L  F+ +    + ++RGF    +GPR         
Sbjct: 626 FWVVAGRFKTAYGNGYGQKDGYDQVLPFFENYYAGGSQWMRGFRSNAVGPRALQLDRSDI 685

Query: 677 ------DKKYAIGGKIYSSASAAVSFPMPLVPE--RAGLRGAFFVDSATLYAN------- 721
                  +   +GG   + ASA +  P P V +  R  LR  FF D  T++         
Sbjct: 686 SGPMVYPESKTVGGNALAVASAELIVPTPFVSDTYRGQLRTTFFYDVGTVWDTTFDDSLY 745

Query: 722 HVALGADKL--EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                 D+     + S  R+S G+ + W SP+G +   +  P++   GD+ + F F IG
Sbjct: 746 TCGYACDRYYDYASPSNIRMSVGISLQWLSPMGPLVFSFAQPIKKMSGDQTEVFNFNIG 804


>gi|261400097|ref|ZP_05986222.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           lactamica ATCC 23970]
 gi|269210324|gb|EEZ76779.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           lactamica ATCC 23970]
          Length = 806

 Score =  270 bits (691), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 200/790 (25%), Positives = 350/790 (44%), Gaps = 70/790 (8%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           VR I I G  +     + S +PV +G + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  VRDIRIEGLQHTEPSTVFSYLPVKIGDNYNDGRGGEIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    ++  T+N  V  +K  Y   G
Sbjct: 85  LTVIERPAIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNRATLNQAVAGLKDEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   +S   + I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLSRNRVAIDIAIDEGESAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ + + + + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNRFDRRKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEGKTKQTIKITVSEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+   +E+ K  L  L+ ++ G  Y  +++ E    I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTKEVPKAELEKLLTMKPGKWYERRQMTEVLGAIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P +   ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTDKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDQVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  V N + S  DPYF    +S G       FD +K+    
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTV-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKSSSGV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIE------- 568
                      VR  +P+TE    +F      L   A++   K P  Y   I+       
Sbjct: 504 KQYKTTTIGGGVRTGIPVTEYDRVNFGLAAEHL---AVNTYNKAPKRYADFIKQYGKTDG 560

Query: 569 -HGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
            +G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ANGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYAGGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN-------------------- 721
            GG   ++ SA + FPMP   +   +R + F D+ +++                      
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGTGAAGTT 740

Query: 722 -------------HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD 768
                        H +  A++L       R S G  + W SPLG M   Y  PL+ +  D
Sbjct: 741 GGRVQNVYGPGNIHKSTFANEL-------RYSAGGAVTWLSPLGPMKFSYAYPLKKKTED 793

Query: 769 KIQQFGFRIG 778
           +IQ+F F++G
Sbjct: 794 EIQRFQFQLG 803


>gi|309379119|emb|CBX22250.1| outer membrane protein Omp85 [Neisseria lactamica Y92-1009]
          Length = 806

 Score =  270 bits (690), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 200/790 (25%), Positives = 350/790 (44%), Gaps = 70/790 (8%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           VR I I G  +     + S +PV +G + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  VRDIRIEGLQHTEPSTVFSYLPVKIGDNYNDGRGGEIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    ++  T+N  V  +K  Y   G
Sbjct: 85  LTVIERPAIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNRATLNQAVAGLKDEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   +S   + I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLSRNRVAIDIAIDEGESAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ + + + + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNRFDRRKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEGKTKQTIKITVHEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+   +E+ K  L  L+ ++ G  Y  +++ E    I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTKEVPKAELEKLLTMKPGKWYERRQMTEVLGAIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P +   ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTDKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDQVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  V N + S  DPYF    +S G       FD +K+    
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTV-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKSSSGV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIE------- 568
                      VR  +P+TE    +F      L   A++   K P  Y   I+       
Sbjct: 504 KQYKTTTIGGGVRTGIPVTEYDRVNFGLAAEHL---AVNTYNKAPKRYADFIKQYGKTDG 560

Query: 569 -HGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
            +G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ANGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYAGGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN-------------------- 721
            GG   ++ SA + FPMP   +   +R + F D+ +++                      
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGTGAAGTT 740

Query: 722 -------------HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD 768
                        H +  A++L       R S G  + W SPLG M   Y  PL+ +  D
Sbjct: 741 GGRVQNVYGPGNIHKSTFANEL-------RYSAGGAVTWLSPLGPMKFSYAYPLKKKTED 793

Query: 769 KIQQFGFRIG 778
           +IQ+F F++G
Sbjct: 794 EIQRFQFQLG 803


>gi|74316811|ref|YP_314551.1| surface antigen (D15) [Thiobacillus denitrificans ATCC 25259]
 gi|74056306|gb|AAZ96746.1| surface antigen (D15) [Thiobacillus denitrificans ATCC 25259]
          Length = 770

 Score =  270 bits (690), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 205/774 (26%), Positives = 349/774 (45%), Gaps = 36/774 (4%)

Query: 27  FIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVK 86
             +   A+F   A       +V+ I + G        + S +PV VG +++D     A+K
Sbjct: 10  LTLALAAVFVTHAASAEAPFVVKDIRVEGIQRTEAGTVFSYLPVKVGDTMTDEKTAAAIK 69

Query: 87  NIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA---A 143
            +YA G+F +V+++  D V+I+ + ER  I  +  SG     +D LK  ++    A    
Sbjct: 70  ALYATGFFKDVRLEARDGVVIVTVQERPSIAKITLSGIKEFSEDDLKAGLKQTGLAEGRV 129

Query: 144 YDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVG 203
            D   V      +++ Y + G   V +K     +    + + + + EG  AKI  I  VG
Sbjct: 130 LDRSLVEKAEQELQRQYFNRGKYAVEIKSTLTPLERNRVAVQFDVVEGDSAKIRQINIVG 189

Query: 204 NKNYSHARLERVISIRTSGYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQ 261
           NK +    L   ++  T  + + + K D YSK R++ D EA+R+FY +RGY    V S+Q
Sbjct: 190 NKAFKEKELLNQLTSTTPNWLTWYTKNDQYSKTRLAGDLEALRSFYLNRGYLEFNVDSTQ 249

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
           V     K G  +   + EG  Y V ++ +   +  + +  L  LI +  G ++    + E
Sbjct: 250 VSISPDKQGIYITVNVTEGPQYRVSDVKLAGQML-VPEAELRKLITLEPGEVFERDRLTE 308

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           S++KI     +    F  V      D  K  V     +D G  +YV RI + GN ++ D 
Sbjct: 309 STKKIGDRLGNDGYAFANVNAVPELDKEKSTVAFTLFVDPGRRVYVNRINVAGNTRTRDE 368

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           V+RRE+   EG   +   I R++ R+   GYF+EVNI        +D V + VSV + S 
Sbjct: 369 VVRREIRQMEGAYYDAEKINRSRDRLNRLGYFNEVNIETPSVAGTTDQVDVNVSVAEKST 428

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN-YTFSVEDPYFLGS 500
           G++ +   +   +G+ + G +  +N FG G   RL+A     +V   Y+ S  +PY+   
Sbjct: 429 GNIMLGAGFSSSEGLVLSGSVSQSNVFGTG--NRLSAQINSGSVNTVYSLSYTNPYYTID 486

Query: 501 PISAGFDLQKTHLEDGSLD------INDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
            IS G+D+ +  ++   LD       +   A VR  +PI E           F+ +G   
Sbjct: 487 GISLGYDIYRRDVDASELDGVGDYETSTYGAGVRFGLPINER---------DFISFGLTY 537

Query: 555 EKEKIPSIYTTLIEHGKFSSH--------SISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
           E+  I +   +   + KF            +  S   +T ++ + P +G+    + +   
Sbjct: 538 EQTSITTDADSPTNYQKFEEEFGSDNDTVRVDTSWARDTRNSHLFPTRGLFQRVAAEVGT 597

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRG 666
             G  +Y+++  +   ++ LS    ++ +   G G  + S+K L  F  F       +RG
Sbjct: 598 PLGSLEYYKLSFQHQQYFPLSKRFTLMLNGEVGVGGGL-SDKPLPFFKNFYAGGTSSVRG 656

Query: 667 FAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDS-ATLYANHVAL 725
           F    +GP+ D+  A+GG      +A + FP+P + +   LR + FVD+ AT   N    
Sbjct: 657 FENGTLGPKDDENNALGGDKRVVGNAELFFPLPGLKDDQSLRMSAFVDAGATFGPNDDQH 716

Query: 726 GADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
             +     D   R S GV ++W SPLG +      PL  +E D+ + F F +GN
Sbjct: 717 RYENFAFGD--LRYSAGVAVLWVSPLGPLKFSLAQPLSSKEDDEEEMFQFTLGN 768


>gi|329119067|ref|ZP_08247759.1| outer membrane protein assembly complex [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327464806|gb|EGF11099.1| outer membrane protein assembly complex [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 802

 Score =  270 bits (690), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 207/807 (25%), Positives = 369/807 (45%), Gaps = 59/807 (7%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            +M  + L   + GLS    ++ + VR I + G  +     + + +PV VG +  D   +
Sbjct: 1   MKMKKLTLALMMLGLSLPAAADFT-VRDIRVEGLQHTEPATVFTYLPVKVGDTFRDGQSE 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---R 139
             + N+YA G F +V+++ +   L++ ++ER +I     SG   +++D +K  + +    
Sbjct: 60  EIISNLYATGLFDDVRVESMGDQLLLTVVERPVIASFEVSGGKLIQNDAIKKNLDAFGLG 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++  +N  V  +K+ Y   G   V +  +   ++   + +   I+EG    IN I
Sbjct: 120 QSRPFNQGRLNEAVAGLKEEYKKQGKYGVEITPEVTRLARNRVAVQLKIDEGKTTTINDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK- 257
            F GN+ YS  RL R +S+   G F++  K++ ++ ++ S D E I  FY + GY   + 
Sbjct: 180 EFEGNQRYSDRRLRRQMSLSEGGMFTWLTKSNRFNSDKFSQDLERITDFYQNNGYFDFRI 239

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           V + V     +    +   + EG+ Y  G +SI+   +E+ K+ L   ++++ G  Y   
Sbjct: 240 VDTDVQMSADQKHQTMKITVSEGQPYRWGKVSIEGDTREVPKEELYQYLKMKEGRKYERA 299

Query: 318 EIKESSEKISKYFFSGERPF--VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
           ++ ES EKI +   +    F  V V  + NRD    +VD    ++    +YV +I I GN
Sbjct: 300 QMLESLEKIQQAMGTAGYAFSEVNVIPQPNRDTG--VVDFVLQVEPNRKVYVNKINISGN 357

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           +++ D V+RREL   E  P + S ++R+K R+   GYF +V     P     D V + +S
Sbjct: 358 NKTRDEVVRRELRQMEAAPYDVSKLQRSKERVELLGYFDDVKFEVKPVEGTPDQVDVDMS 417

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGR-HAVQNYTFSVED 494
           V + + GS+ ++  +  D G+ +   +  +N FG G    ++A   R     N + S  D
Sbjct: 418 VNERATGSLDLSAGWVQDTGLVMAFGVAQDNLFGTG--KSISARVSRSKTTNNASLSFTD 475

Query: 495 PYFLGSPISAGFDL-QKTH---------LEDGSLDINDESAAVRMIVPITESISTSFKYD 544
           PYF    +S G+DL  KT+           +     +   A +RM VP+TE    +F   
Sbjct: 476 PYFTPDGVSLGYDLYGKTYDPRKSSSSTTSNNRYKTSTIGAGIRMGVPVTEYDRVNFGLG 535

Query: 545 LRFLQYGAISEKEKIPSIYTTLIEH---------GKFSSHSISQSIIY--NTLDNPIVPR 593
              +Q    +     P  Y   IE          GK+   +I  S+ +  N  D+ + P 
Sbjct: 536 AEHMQVETFA---GAPKRYREFIEKYAKNQTGGIGKYKGWTIKGSVGWGRNKTDSALWPT 592

Query: 594 KGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLF 653
           +G +I ++ +    GGD  Y+ +     +F+ LS +  ++     G        K+L  F
Sbjct: 593 RGYVIDANLEGGLPGGDLLYYSLTHNQKWFFPLSKNFTLMLGGSVGTADGYGKTKDLPFF 652

Query: 654 DQFSVSSNYYLRGFAYKGIGPRV----DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRG 709
             F       +RG+    +GP+V      K + GG    S +A + FP P + +   +R 
Sbjct: 653 QNFYGGGLGSVRGYESGTLGPKVYDVDGDKISYGGNKMLSGTAELLFPFPGIKDSRSVRL 712

Query: 710 AFFVDSATLYANHV-------ALGADKLE-----GN---DSF---WRVSTGVEIMWNSPL 751
           + F D+ +++            LG   ++     GN    +F    R S G  + W SPL
Sbjct: 713 SLFADAGSVWDGKTYNDSSSDPLGGRTVQNVYGVGNSHRSTFKEELRYSAGAAVTWLSPL 772

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G M   Y  P++ +  D+IQ+F F++G
Sbjct: 773 GPMKFSYAYPIKKKSTDEIQRFQFQLG 799


>gi|308388400|gb|ADO30720.1| outer membrane protein OMP85 [Neisseria meningitidis alpha710]
 gi|325137015|gb|EGC59611.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M0579]
 gi|325202983|gb|ADY98437.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M01-240149]
 gi|325207219|gb|ADZ02671.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis NZ-05/33]
          Length = 797

 Score =  270 bits (690), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 196/774 (25%), Positives = 354/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMFGGEVGIAGGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|296115048|ref|ZP_06833690.1| outer membrane protein assembly complex, YaeT protein
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295978385|gb|EFG85121.1| outer membrane protein assembly complex, YaeT protein
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 831

 Score =  270 bits (690), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 213/770 (27%), Positives = 356/770 (46%), Gaps = 56/770 (7%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           +  ++I+G   +    ILS + V  G       LD ++K +YA G F +V ++   ++L+
Sbjct: 72  IEAVDIKGNDRIETNTILSYMVVQPGDRFDQDLLDRSLKTLYATGLFKDVTMQRSGNMLV 131

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           + ++E  I+N + F GN++ KD+ L  ++  R  A +   T+ AD   I   YA      
Sbjct: 132 VHVVENPIVNRIIFEGNHSAKDEDLTKVISLRPRAVFSTKTIAADRQKILGVYAEKARYA 191

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-F 226
             V  Q   ++   +++ + I E  K  I  + FVGN+ +S  RL  V+S + + ++  F
Sbjct: 192 ATVTPQVIRLAHNRVDVIFRINEAQKTLIRKVTFVGNRTFSSTRLAGVVSSKETAWYRFF 251

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYA--AVKVSSQVLFDKQKSGYVLIFQIDEGEIYT 284
             +D Y+ ER+ +D E +  FY   G+    +K ++  L    K+ Y+  + ++EG  Y 
Sbjct: 252 SSSDQYNPERIKYDAELLHRFYLKNGFVDFQIKNATGELSPDHKAFYI-TYTMEEGPRYR 310

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
           +  + I+S+L+ +  ++L   I +     Y+   I+ ++  + +   +   PF  V   I
Sbjct: 311 LNKMDIRSSLRHVSAESLHKYISLFHNQWYDGSAIQHNATSMQEILQAKGYPFAMVHPEI 370

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER-- 402
            R+  KR V++ + + +G  +YV+RI+I GN  + D VIRR+L +SEGDP  Y+ ++R  
Sbjct: 371 ARNPEKRTVNLLFDVSEGPRMYVERIDINGNTITQDKVIRRQLPMSEGDP--YTPMDRKY 428

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K  +   G+F  V+I Q P +   D V +   V +   G   +   Y  D G+     +
Sbjct: 429 SKAVLEDLGFFKTVSIDQTPGSS-PDKVNISADVVEKPTGEFSLGGGYSSDAGVLGNLGL 487

Query: 463 DDNNFFGQGYRARLAAGFGRHAV---QNYTFSVEDPYFLGSPISAGFD---LQKTHLEDG 516
             +N  G G    + AGF   A         SV DPYFL   + AG D   +Q  ++   
Sbjct: 488 KQHNLLGTG----IDAGFSGTAAYYEDQADISVTDPYFLNRNLVAGIDIFGIQNRYMTYQ 543

Query: 517 SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHS 576
           +         +RM       +S S+ Y L     G         S +  L + G      
Sbjct: 544 NYSEGRYGMTLRMGYSYNNHLSQSWSYTLTDRNVGDTWSD----SSWYVLDQSGWSLLSQ 599

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSD---DSDIV 633
           +S ++ Y+T D    P  G +I    D+AG GG+ +Y R    A+Y+  L     + D  
Sbjct: 600 LSTTLTYDTRDRRSQPHSGYVIRVGGDFAGIGGNERYVRGKIDAAYYIPLDSLMGNHDWT 659

Query: 634 GSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPR--------VDK-KYA-- 681
             LR G G +         + D F +  N  LRGF   G GPR        +D  KY   
Sbjct: 660 VDLRAGAGDIANWGGGRSDIIDNFYLGGN-TLRGFLDGGAGPRSMGISARTIDGVKYPMH 718

Query: 682 -----IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHV---------ALGA 727
                +GG+   +ASA + FPMP   +  G++G +FVD+  L    V             
Sbjct: 719 SQEDFLGGRFMYTASATIHFPMPFAAD-MGIKGRYFVDAGGLDGLRVRERYTSPSDGYKY 777

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQ--QFGF 775
             + G+    RVSTGV   W SP G++ +  G+P+  ++ D+ Q  +FGF
Sbjct: 778 TPVYGDTLTPRVSTGVGFSWKSPFGLINIDLGVPIIKQKHDRTQLLRFGF 827


>gi|329889363|ref|ZP_08267706.1| outer membrane protein assembly complex, YaeT protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328844664|gb|EGF94228.1| outer membrane protein assembly complex, YaeT protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 757

 Score =  270 bits (690), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 204/754 (27%), Positives = 354/754 (46%), Gaps = 37/754 (4%)

Query: 46  SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKI-VDS 104
           ++V RI +RG   + +  +LS +P+  G +I    +D AV+ +   G F++V+I +  + 
Sbjct: 11  AVVNRIVVRGNQRIDQTTVLSYLPIQPGDTIDAVTIDVAVRTLSRTGLFADVQIGLQANG 70

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIG 164
            LI+++ E  IIN + F GN  L + +L+  V  R    Y    V  DV  I + Y   G
Sbjct: 71  DLIVEIAENPIINQVTFEGNKALAEKKLRDEVTIRPRGIYTRARVQEDVGKIVELYRLSG 130

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            ++  V  +   +    +++ + I+EG +  I ++ F+GN  +S + L +V+  + S ++
Sbjct: 131 RISATVTPKLVQLEQNRVDVVFEIDEGPETGIAAVTFLGNTAFSDSDLRQVMVTKQSAWW 190

Query: 225 S-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEI 282
             F   D Y   R+ +D E +R FY +RGY   ++ S V       S + +   +DEG+ 
Sbjct: 191 RLFSSNDNYDPNRIDYDREQLRKFYTNRGYYDFRILSSVAELKPDNSAFGVTVTVDEGDR 250

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y  G I + +    +    L  L+ IRSG+LY    I+ + + ++    S    FV +  
Sbjct: 251 YNFGEIKVVTENDRLNADFLQMLLPIRSGDLYESDRIQAAVDTLTFAAGSAGYAFVEINP 310

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
               D     V++ + + +G  +Y+ RI + GN ++ DSVIRREL + EGD  N S++ER
Sbjct: 311 TYRADPETDTVNVTFNVREGQRVYIDRINVVGNTRTLDSVIRRELMVGEGDAFNRSLVER 370

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           ++  + A G+F +V I +   +   D  ++ V+V++   G + +   +       +   I
Sbjct: 371 SRNNLRALGFFKDVKIEETRGS-APDRSVVNVTVEEQPTGELSVGAGFSSVDSFVLNLGI 429

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLED---GSLD 519
            + NF G+G      A +G    Q   F   +P FLG  + AGFDL     +     S D
Sbjct: 430 TERNFRGRGQNVVARAEWG-SLRQQIDFRFTEPKFLGRDVRAGFDLFHMRYDLSKYSSYD 488

Query: 520 INDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI---------EHG 570
                  VR+  P+    S S +Y L+        ++  IP  Y   +         + G
Sbjct: 489 YRSTGGGVRVTYPLNGYASFSARYFLK-------DDEVVIPFGYCGGVGAGSSALCDQAG 541

Query: 571 KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDS 630
            + + S   +++ N L++P+ P +G   S   D+AG GGD  Y +  + AS++Y +    
Sbjct: 542 SYINSSAGYTLLVNRLNDPVRPTRGWSASLRQDFAGIGGDVNYIKTEADASWYYGIR--P 599

Query: 631 DIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYS 688
           + V S++   G V   N + +++ D+F    N + RGF   G+G R +    A+GG  Y+
Sbjct: 600 NWVVSVQGQTGYVSGWNGDPIRINDRFFKGGNTF-RGFETAGMGARDLTTTDALGGNFYA 658

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATL------YANHVALGADKLEGNDSF-WRVST 741
             +  ++ P  L P+  G++ + F D  T+      Y    A G       D    R + 
Sbjct: 659 IGTVELTVPNYL-PDEYGIKTSLFADFGTIGKLDDRYLVDPATGLRNPNIVDELSLRAAA 717

Query: 742 GVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
           GV I W SP+G +       L   + DK + F F
Sbjct: 718 GVSIHWRSPMGPIRFDLSKVLSKEDYDKTETFRF 751


>gi|254670402|emb|CBA05945.1| probable surface antigen [Neisseria meningitidis alpha153]
 gi|254672758|emb|CBA06785.1| probable surface antigen [Neisseria meningitidis alpha275]
          Length = 797

 Score =  270 bits (689), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 196/774 (25%), Positives = 354/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|2460281|gb|AAC17599.1| outer membrane protein Omp85 [Neisseria meningitidis]
          Length = 797

 Score =  270 bits (689), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 196/774 (25%), Positives = 354/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFRYAYPLKKKPEDEIQRFQFQLG 794


>gi|270261868|ref|ZP_06190140.1| outer membrane protein assembly factor YaeT [Serratia odorifera
           4Rx13]
 gi|270043744|gb|EFA16836.1| outer membrane protein assembly factor YaeT [Serratia odorifera
           4Rx13]
          Length = 814

 Score =  270 bits (689), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 219/807 (27%), Positives = 362/807 (44%), Gaps = 65/807 (8%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           I+    +  LSA Y ++  +V+ I   G   V     L  +PV VG ++SD D+ + ++ 
Sbjct: 14  IVAMLFLNSLSA-YAADGFLVKDIHFEGLQRVAPGAALLSMPVRVGDTLSDEDISNTIRA 72

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAY 144
           ++  G F +V+I   D VLII + ER  I  + FSGN  +KDD LK  + S   R   A 
Sbjct: 73  LFTTGNFDDVQILRDDHVLIIKVKERPTIAGISFSGNKTVKDDMLKHNLESSGVRVGEAL 132

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D  T+++    ++  Y S+G  N  VK     +    +++  V  EGV AKI  I  +GN
Sbjct: 133 DRTTLSSIEQGMEDFYYSVGKYNARVKAVITPLPRNRIDLKLVFTEGVSAKIQQINVIGN 192

Query: 205 KNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
           + +    L   + +R    +++      Y K++++ D E +R+FY DRGYA  K+ S+QV
Sbjct: 193 QAFRTDELLANLQLRDDVPWWNLASDRKYQKQKLAGDLETLRSFYLDRGYANFKIDSTQV 252

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
                K G  +   ++EG  Y +  + +   +       + +L  I+ G LYN  +I   
Sbjct: 253 SLTPDKKGIYITINLNEGSQYLLSGVVLNGNMAG-HLPQIAALTNIQPGELYNGAKITRM 311

Query: 323 SEKISKYF--FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYD 380
              I +    +    P V ++  IN+    + V +   +D G    V+RI  EGN  S D
Sbjct: 312 ENDIKQLLGRYGYAFPLVGIEPEINQ--KAKTVKLHVNVDAGKRYSVRRIRFEGNGTSKD 369

Query: 381 SVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLS 440
           SV+RRE+   EG  +    +E+ K+R+  TG+F  V           D V +   VK+ +
Sbjct: 370 SVLRREMRQMEGAWLGNDQVEQGKQRLNRTGFFETVETETQRVPGSPDQVDVVYKVKERN 429

Query: 441 AGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTF---SVEDPYF 497
            G+      Y  D G   +  +  +N+ G G       GF      + T+   S+ DPYF
Sbjct: 430 TGTFNFGLGYGTDSGASFQVGVSQDNWLGSGN----TVGFNGTKSDSQTYIELSMTDPYF 485

Query: 498 LGSPISAGFDLQKTHLEDGSLDINDESAAVRMI-----VPITESISTSFKYDLRFLQYGA 552
               +S G  +     +    D+++ +     I      PI E+ S     D    +   
Sbjct: 486 TVDGVSLGGKISYNDYDAEDDDLSEYTMKSLGIGGNLGFPIGENSSLGLGLDYANTRLSG 545

Query: 553 ISEKEKI----------PSIYTTLIEH-GKFSSHSISQSI--IYNTLDNPIVPRKGMLIS 599
           ++ +  +          P I T   ++  +F+++    S+   YNTLD    P  G   S
Sbjct: 546 MAPQVAMWRYLNSVNVNPGITTQDNDNDARFTANDFFTSVGWNYNTLDRGFFPTDGTSAS 605

Query: 600 SSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFS 657
            +      G  + Y+++   A+ +  LS D+   ++G  + GY      ++ +  +D F+
Sbjct: 606 LNAKITVPGSTNSYYKVTFSANQYLPLSSDNKWIVMGRTKAGYADGFGGHE-VPFYDNFN 664

Query: 658 VSSNYYLRGFAYKGIGPR-----------------VDKK-YAIGGKIYSSASAAVSFPMP 699
              +  +RGF+   IGP+                 VDK   A+GG   + AS  + FP P
Sbjct: 665 AGGSSSVRGFSSNSIGPKAAYYHCSGSESAYSDCPVDKSDDAVGGNAMAIASTELIFPTP 724

Query: 700 LVPER--AGLRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEIMWNSPL 751
            + +R    LR + FVD+ T++  H    +  L       G+ S  RVS G+ + W SPL
Sbjct: 725 FINDRYANSLRTSLFVDAGTVWDTHWQNTSQTLAAGIPDYGDPSNVRVSAGIALQWQSPL 784

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P++  EGDK +QF F IG
Sbjct: 785 GPLSFSYAFPIKKYEGDKAEQFQFNIG 811


>gi|313667485|ref|YP_004047769.1| outer membrane protein OMP85 [Neisseria lactamica ST-640]
 gi|313004947|emb|CBN86374.1| outer membrane protein OMP85 [Neisseria lactamica 020-06]
          Length = 808

 Score =  270 bits (689), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 200/792 (25%), Positives = 350/792 (44%), Gaps = 72/792 (9%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           VR I I G  +     + S +PV +G + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  VRDIRIEGLQHTEPSTVFSYLPVKIGDNYNDGRGGEIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    ++  T+N  V  +K  Y   G
Sbjct: 85  LTVIERPAIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNRATLNQAVAGLKDEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   +S   + I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLSRNRVAIDIAIDEGESAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ + + + + D E +  FY + GY   ++  + +  ++ K+   +   + EGE 
Sbjct: 205 TWLTRSNRFDRRKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEGKTKQTIKITVSEGER 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+   +E+ K  L  L+ ++ G  Y  +++ E    I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTKEVPKAELEKLLTMKPGKWYERRQMTEVLGAIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P +   ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTDKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDQVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  V N + S  DPYF    +S G       FD +K+    
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTV-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKSSSGV 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIE------- 568
                      VR  +P+TE    +F      L   A++   K P  Y   I+       
Sbjct: 504 KQYKTTTIGGGVRTGIPVTEYDRVNFGLAAEHL---AVNTYNKAPKRYADFIKQYGKTDG 560

Query: 569 -HGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
            +G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 ANGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     GY       K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEIGYAGGYGKTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN-------------------- 721
            GG   ++ SA + FPMP   +   +R + F D+ +++                      
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGTGTGAAG 740

Query: 722 ---------------HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
                          H +  A++L       R S G  + W SPLG M   Y  PL+ + 
Sbjct: 741 TTGGRVQNVYGPGNIHKSTFANEL-------RYSAGGAVTWLSPLGPMKFSYAYPLKKKT 793

Query: 767 GDKIQQFGFRIG 778
            D+IQ+F F++G
Sbjct: 794 EDEIQRFQFQLG 805


>gi|254449854|ref|ZP_05063291.1| outer membrane protein assembly complex, YaeT protein
           [Octadecabacter antarcticus 238]
 gi|198264260|gb|EDY88530.1| outer membrane protein assembly complex, YaeT protein
           [Octadecabacter antarcticus 238]
          Length = 772

 Score =  270 bits (689), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 190/736 (25%), Positives = 348/736 (47%), Gaps = 19/736 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + + G   +    IL+ +    G++++   ++ A + I A G F +V +      LI+ +
Sbjct: 43  VSVEGNQRIEIATILTYLGFGQGEAVTAGVVNDAAQRIRATGLFESVDVVAQGRTLIVRV 102

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   IN + F GN+ ++D +L   VRS+    Y      +D   I Q YA  G +N  V
Sbjct: 103 VEFPTINQITFEGNSRIRDAELSAAVRSQPRRVYSPSQAESDTAAITQVYADQGRINATV 162

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + + EG   ++  I FVGN+ Y  +RL RV+  + +G   +    
Sbjct: 163 TPRIIQRSDNRIDLIFEVFEGGLTEVERISFVGNRAYGESRLRRVLETKQAGLLRAVISR 222

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D +  +R++FD++ +  FY  RGY    V +  V   +++  Y++ F + EG+ +  G +
Sbjct: 223 DTFIADRVAFDQQVLTDFYQSRGYVDFLVQNVDVSLTRERDAYLITFNVQEGQQFEFGIL 282

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           S+ S +         + +R+R+G  Y+P+ I+    ++       +  FVRV  R+ R+ 
Sbjct: 283 SVTSEVTGADPAIFENALRLRTGVTYSPELIERDISRLELLALHQQLNFVRVDPRVTRND 342

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+E+ +  G  ++++RI+IEGN+ + D VIR   ++ EGDP N   I  +  RI 
Sbjct: 343 RTLTLDVEFALVNGPRIFIERIDIEGNNTTLDRVIRSRFDVVEGDPFNPRQIRESAERIR 402

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A GYF   ++     +   D V++ V V +   GS+    N+  D G  +       NF 
Sbjct: 403 ALGYFGNADVDAREGSS-PDQVVIDVDVTEAPTGSLSFGGNFSTDNGFSLLASFKQGNFV 461

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD--LQKTHLEDGSL-DINDESA 525
           G+G     +   G    QN +FS  +P  LG  +S G D   + T+    +L D    S 
Sbjct: 462 GRGQSLSFSVQAGSDN-QNLSFSFTEPRLLGRDLSFGIDASFKSTNNNQNALYDTARASL 520

Query: 526 AVRMIVPITES--ISTSFKYD-LRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSII 582
             R+  PI+E+  ++  + YD +    Y +    +  P I   +++ G   + ++  S  
Sbjct: 521 RPRIGFPISENGLLTLYYAYDYIEVKDYNSADPSKPSPFIEEDVLQGG-IGTSALGYSYS 579

Query: 583 YNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGC 642
           Y+T    + P  G+L     ++ GFG            +   +LS++  +  ++    G 
Sbjct: 580 YDTRRTGLNPNAGVLFRFGQEF-GFGDSRFIDTTADVTAQTRVLSEEVILRAAIE--GGL 636

Query: 643 VIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDKKYAIGGKIYSSASAAVSFPMPLV 701
           +  ++ + ++ D++ + S   +RGF   G+GPR      A+GG  ++       FP+ L 
Sbjct: 637 LSYASGDSRITDRYFLGSG-TMRGFEPGGVGPRDASSDDALGGNAFAVVRLDAEFPLGL- 694

Query: 702 PERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
           PE  G+ G  F+D  +++    + G   +E +D   R   GV I W++P+G +   Y  P
Sbjct: 695 PEEYGISGGVFLDYGSVWDVGSSFG--PVEYDDFTPRTVAGVSIFWDTPIGPLRFNYTEP 752

Query: 762 LRHREGDKIQQFGFRI 777
           L  +E D+ +QF   I
Sbjct: 753 LDVQENDQTKQFDVTI 768


>gi|121634057|ref|YP_974302.1| outer membrane protein OMP85 [Neisseria meningitidis FAM18]
 gi|120865763|emb|CAM09492.1| outer membrane protein OMP85 [Neisseria meningitidis FAM18]
          Length = 797

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 196/774 (25%), Positives = 354/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|15676109|ref|NP_273240.1| outer membrane protein OMP85 [Neisseria meningitidis MC58]
 gi|81785144|sp|Q9K1H0|OMP85_NEIMB RecName: Full=Outer membrane protein omp85; Flags: Precursor
 gi|7225401|gb|AAF40639.1| outer membrane protein Omp85 [Neisseria meningitidis MC58]
 gi|316985707|gb|EFV64653.1| outer membrane assembly complex, YaeT protein [Neisseria
           meningitidis H44/76]
 gi|325199395|gb|ADY94850.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis H44/76]
          Length = 797

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 196/774 (25%), Positives = 354/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|218767125|ref|YP_002341637.1| outer membrane protein OMP85 [Neisseria meningitidis Z2491]
 gi|121051133|emb|CAM07404.1| outer membrane protein OMP85 [Neisseria meningitidis Z2491]
          Length = 797

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 196/774 (25%), Positives = 354/774 (45%), Gaps = 47/774 (6%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           ++ I + G        + + +PV VG + +D      +K++YA G+F +V+++  D  L+
Sbjct: 25  IQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLL 84

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + +IER  I  L  +G   L++D +K  + S   A    +++ T+N  V  +K+ Y   G
Sbjct: 85  LTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRG 144

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
            LN+ +  +   ++   ++I   I+EG  AKI  I F GN+ YS  +L R +S+   G +
Sbjct: 145 KLNIQITPKVTKLARNRVDIDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIW 204

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           ++  +++ +++++ + D E +  FY + GY   ++  + +  ++ K+   +   + EG  
Sbjct: 205 TWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGR 264

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           +  G +SI+    E+ K  L  L+ ++ G  Y  Q++     +I     S    +  +  
Sbjct: 265 FRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISV 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
           +   +   + VD    I+ G  +YV  I I GN+++ D V+RREL   E  P + S ++R
Sbjct: 325 QPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQR 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           +K R+   GYF  V    +P     D V L +S+ + S GS+ ++  +  D G+ +   +
Sbjct: 385 SKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGV 444

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG-------FDLQKTHLED 515
             +N FG G  A L A   +  + N + S  DPYF    +S G       FD +K     
Sbjct: 445 SQDNLFGTGKSAALRASRSKTTL-NGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSI 503

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------ 569
                    A +RM VP+TE    +F      L    ++   K P  Y   I+       
Sbjct: 504 KQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHL---TVNTYNKAPKHYADFIKKYGKTDG 560

Query: 570 --GKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
             G F       ++ +  N  D+ + P +G L   + + A  G   QY+      ++F+ 
Sbjct: 561 TDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFP 620

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV----DKKYA 681
           LS    ++     G        K +  F+ F       +RG+    +GP+V     +K +
Sbjct: 621 LSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKIS 680

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY------ANHVALGADKLE---- 731
            GG   ++ SA + FPMP   +   +R + F D+ +++       N  +    +++    
Sbjct: 681 YGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYG 740

Query: 732 -GN---DSF---WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            GN    +F    R S G  + W SPLG M   Y  PL+ +  D+IQ+F F++G
Sbjct: 741 AGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLG 794


>gi|290473665|ref|YP_003466537.1| putative outer membrane antigen [Xenorhabdus bovienii SS-2004]
 gi|289172970|emb|CBJ79741.1| putative outer membrane antigen [Xenorhabdus bovienii SS-2004]
          Length = 811

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 211/798 (26%), Positives = 367/798 (45%), Gaps = 48/798 (6%)

Query: 22  SFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
           +  M  +++   +FG +  Y S+  +VR I   G   V     L  +PV VG +ISD D+
Sbjct: 18  TMAMKKLLIASLLFGSATAYSSDGFVVRDIHFEGLQRVTSGAALLNMPVRVGDTISDEDI 77

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSA 141
              +  ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  + S   
Sbjct: 78  SRTIHTLFATGNFEDVRVLRDGNTLVVQVKERPTIASITFSGNKSVKDDMLKKNLESSRV 137

Query: 142 A---AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           +   A D   ++     ++  Y S+G  N  VK     +    +++  +  EG+ A+I  
Sbjct: 138 SVGEALDRTMLSNMEKGLEDFYYSVGKYNATVKAVVTPLPRNRIDLKLIFSEGISAQIQQ 197

Query: 199 IRFVGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  VGNK +S   L     +R    +++F     Y K++++ D E +R+FY DRGYA   
Sbjct: 198 INIVGNKAFSTNELLNRFQLRDDIPWWNFMADQKYQKQKLAGDLETLRSFYLDRGYARFN 257

Query: 258 V-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNP 316
           + S+QV     K G  +   I+EG  Y + ++ +   L   Q +    L  I+ G+LYN 
Sbjct: 258 IDSTQVNLTPDKKGIYITVNINEGAQYKIASVDLNGNLAGYQSEAT-KLTNIQPGSLYNG 316

Query: 317 QEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGND 376
            E+    + I          + RV T+   +   + V +   +D G+  YV++I  EGND
Sbjct: 317 TEVTSMEKAIKNLLGRYGYAYPRVITQPEINDTDKTVKLHVNVDAGNRFYVRKIRFEGND 376

Query: 377 QSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSV 436
            S DSV+RRE+   EG  +    +E+ K R+   G+F  VN+     +   D V +   V
Sbjct: 377 ISRDSVLRREMRQMEGAWLGSDRVEQGKERLDRLGFFETVNVDTERVSGSPDLVDVVYKV 436

Query: 437 KQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPY 496
           K+ + GS+     +  + GM  +  +   N+ G G    ++A    ++  +   S  DPY
Sbjct: 437 KERNTGSMNFGVGFGTESGMSFQVGLQQENWLGTGNSVGISASKNDYST-SADLSFTDPY 495

Query: 497 FLGSPISAGFDL--QKTHLEDGSLD-INDESAAVRMIV--PITESISTSFKYDLRFLQYG 551
           F    +S G  +       +D  L    +++     I+  P+ E+   + +       + 
Sbjct: 496 FTVDGVSLGGRVYYNDFRADDAELSGYTNKAYGTEGILGFPLNENNRLAMRLG---YAHN 552

Query: 552 AISEKEKIPSIYTTLIEHGK---------FSSH--SISQSIIYNTLDNPIVPRKGMLISS 600
           ++S      +++  L + GK         F S+   ++ S IY   D    P  G   S 
Sbjct: 553 SLSNMRPQAAMWRYLKKMGKEPPLKGKASFDSNDFPLTFSWIYGNFDRGFFPTSGFKSSV 612

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSV 658
               A  G D+QY+++   A+ +Y + D +   ++G  R GYG  +   K +  ++ F  
Sbjct: 613 DAKVALPGSDNQYYKLTWSATGYYPIDDKNSWIMMGRTRMGYGGGL-GGKEMPFYENFYA 671

Query: 659 SSNYYLRGFAYKGIGPRV-------------DKKYAIGGKIYSSASAAVSFPMPLVPERA 705
             +  +RGF    IGP+                + A+GG   ++AS  +  P P +  + 
Sbjct: 672 GGSNSVRGFRSNNIGPKAIYLGENKEPEKNSPSRDAVGGNALATASFELITPTPFLDAKY 731

Query: 706 G--LRGAFFVDSATLY---ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
              +R +FFVD+ T++    N+++ G       ++  RVS G+ + W SPLG +   YG 
Sbjct: 732 ANTVRTSFFVDAGTVWDTNWNNISPGLPDYSKPNNI-RVSAGIALQWLSPLGPLTFSYGK 790

Query: 761 PLRHREGDKIQQFGFRIG 778
           P++  EGD+ +QF F IG
Sbjct: 791 PIKEYEGDRAEQFQFNIG 808


>gi|126737629|ref|ZP_01753359.1| outer membrane protein, OMP85 family [Roseobacter sp. SK209-2-6]
 gi|126721022|gb|EBA17726.1| outer membrane protein, OMP85 family [Roseobacter sp. SK209-2-6]
          Length = 771

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 194/755 (25%), Positives = 352/755 (46%), Gaps = 31/755 (4%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           +++ G   +    I++   +  G ++S   L+ A + I A G F +V++      L+I +
Sbjct: 24  VKVEGNQRIQSSTIVAYTGIKRGTAVSAGQLNDAYQAILASGVFESVELVPRGGTLVIKV 83

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   IN + F GN  +KDD L+ I+ S     ++ +    D   I + Y   G L   V
Sbjct: 84  TEFPTINRINFEGNRRIKDDVLEGIIESSPRRVFNPEVAERDAAAIAELYGVRGRLASSV 143

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + I EG   ++  + F+GN+ YS  RL RV+  + +G   +F   
Sbjct: 144 TPRIIRRSDNRVDLVFEIGEGDTIEVERVSFLGNQVYSDRRLRRVLETKQAGLLRTFINK 203

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D   ++R+ FD++ +R FY  RGY   +V SS     +++    L+  + EG+ +  G I
Sbjct: 204 DTLVEDRIEFDKQVLRDFYLSRGYVDFRVNSSNAEVTRERDAVFLVLDVTEGQQFRFGEI 263

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           S+ S++     +   + ++I+ G +Y+P  ++ S E++          F+RV+ R+ R+ 
Sbjct: 264 SVTSSVSAADAEEFFAALKIKPGVVYSPSLVESSIERLETLAIQKGVDFLRVEPRVTRND 323

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+E+++ +G  ++V+RI+IEGN  + D VIR++    EGDP N   I R   RI 
Sbjct: 324 RDLTLDLEFVLSKGPRVFVERIDIEGNTTTLDRVIRQKFRTVEGDPFNPREIRRTAERIR 383

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+F+E ++  +      ++V++ V V++   GS+ +  +Y V+ G G+   + +NNF 
Sbjct: 384 ALGFFAEADV-DVREGSSPEHVVIDVDVEEQPTGSLNLGGSYSVNDGFGIAVGVTENNFL 442

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDES---- 524
           G+G R   +      + + Y     +P+ LG  I    DL  +   D S    D S    
Sbjct: 443 GRGQRLAFSISTASDS-EEYRLGFSEPHLLGRDIRFDLDLGLSET-DSSFSQYDTSRIFF 500

Query: 525 -AAVRMIVPITESISTSFKYDLRFL------QYGAISEKEKIPSIYTTLIEHGKFSSHSI 577
             AV        S++  + ++   +        G ++     P I +  I  G+ S+  I
Sbjct: 501 QPAVTFNTSENSSLTLRYGWETDEMIRRADVTSGGVTYPVAGPVIRSE-IAQGEESTSKI 559

Query: 578 SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR-ASYFYLLSDDSDIVGSL 636
             +  +++    + P  G L+    DYAG GGD++Y R  S+  +   + +++  +  + 
Sbjct: 560 GFTYTFDSRLTGLDPNAGFLVELGADYAGIGGDNEYLRTTSKIVAQKRIWNEEVTLRATF 619

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYA--------IGGKIYS 688
             G       N   +  D+F V S   +RGF   GIGPR     A        +GG  Y+
Sbjct: 620 EAG-ALHWMGNDTSRSIDRF-VLSPAIMRGFEPGGIGPRDQAPRADGANYNDFLGGNFYA 677

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYA--NHVALGADKLEGNDSFWRVSTGVEIM 746
            A     FP+ L PE  G+RG  F D   L+   +  A  +  + G +  +R + G  ++
Sbjct: 678 VARFDAEFPLGL-PEELGVRGGLFYDVGNLWGLQDSDASASGSVVGRNGSFRHAVGFSVL 736

Query: 747 WNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           W +  G +   +   L+  + D+ Q F   +  R 
Sbjct: 737 WTTGFGPLRFNFSRALKKEDFDQEQNFDLTLQARF 771


>gi|310816026|ref|YP_003963990.1| putative outer membrane protein [Ketogulonicigenium vulgare Y25]
 gi|308754761|gb|ADO42690.1| putative outer membrane protein [Ketogulonicigenium vulgare Y25]
          Length = 763

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 197/729 (27%), Positives = 342/729 (46%), Gaps = 16/729 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           I ++G   +    IL+++ +  GQ++S ADL+ A++ + A G F NV   +    L++ +
Sbjct: 37  ITVQGNQRIETGTILTQLGIQRGQAVSAADLNDAIQAVRASGLFENVDADLQGGTLVLRV 96

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   IN + F GN+ +  +QL  +V S     ++      D + I QAYA+ G +N  V
Sbjct: 97  QEYPTINRISFEGNSRISAEQLATLVSSTERRVFNPTQATEDANRIIQAYANEGRINASV 156

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
                + +   +++ + I EG   +I  I FVGN  +   RL RV+  + +G   +    
Sbjct: 157 TPSFINRTDNRVDLVFEIVEGAVTEIERISFVGNSAFGDGRLRRVLDTKEAGLLRAIVGR 216

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D YS +R++ D   +  FY  RGYA  +V +  V     +  YV+ F ++EG  Y +GN+
Sbjct: 217 DTYSPDRINVDRRLLTDFYQSRGYADFRVQNVDVALTAARDAYVVTFNVEEGPRYRMGNV 276

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ STL E       +++R+  G++Y+P  I    ++I          FVRV   I RD 
Sbjct: 277 TLSSTLPEADGAAFGNILRVSQGDVYSPTSIDADVQRIENQALRLGLNFVRVNPIITRDP 336

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
           A   +++EY +++G  L+++RI+IEGN  + D V+R +    EGDP N   I  +  RI 
Sbjct: 337 ASLRLNLEYRLERGERLFIERIDIEGNTTTLDRVVRSQFRTVEGDPFNPRAIRESAARIR 396

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+FS+  ++    +     VI    V+Q   GS     N+  D G  +     + NF 
Sbjct: 397 ALGFFSDAQVNTRQGSAPDQVVIDVDVVEQ-PTGSASFGVNFGSDDGAALVASYQEQNFL 455

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKTHLEDGSLDINDESAA 526
           G+G    L    G    Q  +FS  +P   G  +  G DL  ++T  +    + ++   +
Sbjct: 456 GRGQSLGLTLSTG-ETNQVLSFSFAEPMLFGRDLRGGIDLSYRRTESDYALYNTSNFRFS 514

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
             +  PI+E       Y L +     + +      +       G+  S+S+  S  +++ 
Sbjct: 515 PSLQFPISERGRIGVNYALTYTDIFNVDDDAS--ELIKEEAALGEQWSNSVGYSYTWDSR 572

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRAS-YFYLLSDDSDIVGSLRFGYGCVIP 645
            N +  R       S D+ GF GD+ Y R  + A+    + SD+  +  +L  GY  +  
Sbjct: 573 RNGVDERTSFGFRFSQDF-GF-GDTTYIRSAALATAQTRVFSDEVLLRATLEGGY--LHY 628

Query: 646 SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKK-YAIGGKIYSSASAAVSFPMPLVPER 704
           S+   ++ D++ + S   +RGF   GIGPR +     +GG  ++       FP+ L PE 
Sbjct: 629 SDGESRVTDRYFMGSR-VMRGFRSGGIGPRDENSDDPLGGNAFAVLRLEAEFPLGL-PEE 686

Query: 705 AGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
            G+ G  F+D  +L+     +    +  +D+  R   GV + W +PLG +   +  P+  
Sbjct: 687 YGISGGAFLDYGSLWDVGKQVDGVTIISDDAIARAVAGVSLFWTTPLGPLRFNFSTPITV 746

Query: 765 REGDKIQQF 773
            + D  + F
Sbjct: 747 EDYDNTRGF 755


>gi|322831596|ref|YP_004211623.1| outer membrane protein assembly complex, YaeT protein [Rahnella sp.
           Y9602]
 gi|321166797|gb|ADW72496.1| outer membrane protein assembly complex, YaeT protein [Rahnella sp.
           Y9602]
          Length = 806

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 213/805 (26%), Positives = 365/805 (45%), Gaps = 61/805 (7%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + ++ 
Sbjct: 6   LLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVTDDDISNTIRA 65

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAY 144
           ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  + +   R   A 
Sbjct: 66  LFATGNFEDVRVLRDGNSLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGEAL 125

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D  T+ +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  VGN
Sbjct: 126 DRTTIGSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINIVGN 185

Query: 205 KNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQV 262
             ++   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S+QV
Sbjct: 186 HAFTTDDLISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDSTQV 245

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
                K G  +   I EGE Y +  + +  ++       + SL +I  G LYN  ++ + 
Sbjct: 246 SLTPDKKGIYITLNITEGEQYKLSGVEVTGSMAG-HSAEVQSLTKIDKGELYNGAKVTKM 304

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
              I +        + RV T+   + A + V +   +D G+  YV+ I  EGND S DSV
Sbjct: 305 ENDIKQMLGRYGYAYPRVTTQPEINDADKTVKLHINVDAGNRFYVRHIRFEGNDTSKDSV 364

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           +RRE+   EG  +   ++++ K R+   GYF  V++         D V +   VK+ + G
Sbjct: 365 LRREMRQMEGAWLGNDLVDKGKERLNRLGYFETVDVDTQRVPGSPDQVDVVYKVKERNTG 424

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSP 501
           S      Y  + G+  +  +  +N+ G G    ++    ++  Q Y  F++ DPYF    
Sbjct: 425 SFNFGVGYGTESGVSFQVGVQQDNWLGTGNSVGISG--TKNDYQTYAEFTITDPYFTVDG 482

Query: 502 ISAGFDLQKTHLEDGSLDIN---DESAAV--RMIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G  +     +    D++   + S  +   +  PI E  + S +  L ++     + +
Sbjct: 483 VSLGGRIFYNDFKADDADLSSYTNRSYGIGGNLGFPINE--NNSLRLGLDYVHNDLSNME 540

Query: 557 EKI------------PSIYTTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGMLISSSY 602
            +I            P + T+      FS++    ++   YN LD    P  G   S + 
Sbjct: 541 PQIAMFRYLNSVGLKPPVTTSDNADADFSANDFFANLGWGYNNLDRGYFPTSGTKASLNG 600

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y++I   ++ +  L+ D D V  G  R GY   +   K +  +D F    
Sbjct: 601 KVTVPGSDNEYYKITFDSTSYMPLNQDRDWVLMGRARAGYADGL-GGKEVPFYDNFYAGG 659

Query: 661 NYYLRGFAYKGIGPRV------------------DKKYAIGGKIYSSASAAVSFPMPLVP 702
           +  +RGF    IGP+                   +   A+GG   +  SA +  P P V 
Sbjct: 660 SSSVRGFQSNTIGPKAAYYKCTTANTSYSGCPIDNSNDAVGGNAMAVLSAELIVPTPFVS 719

Query: 703 ER--AGLRGAFFVDSATLY-------ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGM 753
           E+    LR + FVDS T++          +A G        +  RVS+G+ + W SPLG 
Sbjct: 720 EKYANSLRTSLFVDSGTVWDTGWENTPQTIAAGVPDYSKPGNI-RVSSGLALQWMSPLGP 778

Query: 754 MGVYYGIPLRHREGDKIQQFGFRIG 778
           +   Y  P++  EGDK +QF F IG
Sbjct: 779 LVFSYAQPVKKYEGDKAEQFQFNIG 803


>gi|253988133|ref|YP_003039489.1| outer membrane protein assembly factor YaeT [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779583|emb|CAQ82744.1| outer membrane protein assembly factor yaet precursor [Photorhabdus
           asymbiotica]
          Length = 797

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 219/807 (27%), Positives = 366/807 (45%), Gaps = 68/807 (8%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG +  YG+N  +V+ I   G   V     L  +PV VG ++SD D+   
Sbjct: 3   MKKLLIASLLFGSATAYGANGFVVQDIHFEGLQRVAVGAALLNMPVRVGDTVSDEDIGRT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + LI+ + ER  I ++ FSGN ++KDD LK  + +   R  
Sbjct: 63  IQALFATGNFEDVRVLRDGNTLIVQVKERPTIANITFSGNKSVKDDMLKQNLEASHVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D   ++     ++  Y S+G  N  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTMLSNIEKGLEDFYYSVGKYNASVKAVVTPLPRNRVDLKLVFAEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK++S   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKSFSSDELLNRFQLRDDIPWWNLTADQKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  I +   +   Q + +  L  I  G+LYN  ++
Sbjct: 243 TQVSLTPDKKGIYVTLNITEGDQYKISGIDLNGNMAGYQSE-ITKLATIEPGSLYNGTQV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +   +I          + RV T+   +   + V +   ID G+  YV++I   GND S 
Sbjct: 302 TKMESEIKNLLGRYGYAYPRVMTQPEINDQDKTVKLHVNIDAGNRFYVRKIRFSGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +   ++E  K R+   GYF  V++        SD V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGSDLVELGKERLNRLGYFETVDVETQRIPGSSDQVDIVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     +  + G+  +     +N+ G G    + A   ++    Y   S  DPYF 
Sbjct: 422 NTGSMNFGIGFGTESGVSFQIGAQQDNWLGTGNSVGINA--SKNDYSTYAELSFTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAVR--------MIVPITESISTSFKYDLRFLQY 550
            + +S G    +    D   D  D S            +  P+ E+ S +F+     L Y
Sbjct: 480 VNGVSLG---GRVFYNDFRADDADLSGYTNKTYGLDGFLGFPVNENNSLNFR-----LGY 531

Query: 551 GAISEKEKIP--SIYTTLIEHG-----------KFSSHSISQSIIYNTLDNPIVPRKGML 597
              S  + +P  +++  L   G           K    +++    YN LD    P  G+ 
Sbjct: 532 VHNSLSDMLPQAAMWRYLNSMGEKPDYEKKAEFKADDFALTMGWTYNNLDRGFFPTSGVK 591

Query: 598 ISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQ 655
            + +      G D+++++I      +Y ++D     I+G  R GYG  +   K L  ++ 
Sbjct: 592 STLNGKVTIPGSDNKFYKITLDTFAYYPINDARTWVILGRGRLGYGDGL-GGKELPFYEN 650

Query: 656 FSVSSNYYLRGFAYKGIGPR---VDK----------KYAIGGKIYSSASAAVSFPMPLVP 702
           F    +  +RGF    IGP+   +DK          + AIGG   + AS  +  P P + 
Sbjct: 651 FYAGGSSTVRGFRSNNIGPKAIYLDKNGDPKKDSPSRDAIGGNAMAVASLELITPTPFLD 710

Query: 703 ER--AGLRGAFFVDSATLYANHVALGADKLE---------GNDSFWRVSTGVEIMWNSPL 751
            +    +R +FF+DS T++  + +  A   +         GN    RVSTG+ + W SPL
Sbjct: 711 GKYSNSVRTSFFIDSGTVWDTNWSDSATMRDRGIPDYSKPGN---IRVSTGIALQWLSPL 767

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P++  EGD+ +QF F IG
Sbjct: 768 GPLVFSYAKPIKDYEGDRSEQFQFNIG 794


>gi|84516077|ref|ZP_01003437.1| putative outer membrane protein [Loktanella vestfoldensis SKA53]
 gi|84509773|gb|EAQ06230.1| putative outer membrane protein [Loktanella vestfoldensis SKA53]
          Length = 773

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 192/729 (26%), Positives = 351/729 (48%), Gaps = 19/729 (2%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           + I G   V    ILS   +  G ++S ADL+ A + I   G F  V +      L+I +
Sbjct: 50  VTIEGNQRVADGTILSFAGISAGATLSAADLNTAAQQIRESGLFETVDVVPQGGTLVIRV 109

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
           +E   IN +   GN  ++D QL  +++S    A++     AD + I Q YAS G +N +V
Sbjct: 110 VEFPTINRISIEGNTRIRDAQLLPLLQSEPRRAFNPVQAEADTNAITQVYASEGRINAVV 169

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +   ++   +++ + + E    +I  I F+GN+ YS  RL RV+  + +G   +    
Sbjct: 170 TPRIIRLAENRVDLVFEVAESGVTEIERISFLGNRTYSEGRLRRVLDTKQAGLLRALVAR 229

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D +S +R++ D + +  FY  RGYA  +V +  V    ++  Y++ + I EG+ +  G +
Sbjct: 230 DTFSPDRVAQDRQLLTDFYMSRGYADFEVLNVDVTLTSERDAYLVTYNIREGQQFNFGTV 289

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           ++ ST+  +        IR R G +Y+P  I+    ++ +        FVRV+ RI R+ 
Sbjct: 290 TVSSTIPGVDPAVFQDAIRTRDGAVYSPVTIETDITRLERLAVQRNVNFVRVEPRITRNE 349

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+EY++ +G  ++V+RI+I+GN  + D VIR ++ + EGDP N   I  + RRI 
Sbjct: 350 RALTLDLEYVLVEGPRVFVERIDIQGNGTTLDRVIRNQVGVVEGDPFNPREIRDSARRIR 409

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+F    +     +  ++ VI+ V V +   G++    NY  D G+G+      +NF 
Sbjct: 410 ALGFFENATVDTRQGSS-ANQVIVDVGVTEGPTGTLSFGANYNTDTGVGLLASYGQSNFQ 468

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAG--FDLQKTHLEDGSLDINDESAA 526
           G+G +            Q  +F   +P  LG  +  G  F  ++T+ E+ S D  +   +
Sbjct: 469 GRGQQLDFDLSTA-ETNQRLSFRFAEPQLLGRDLRGGLEFSYRQTNNENASYDTQNGRFS 527

Query: 527 VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL 586
             +  P++++   S  Y   +     ++       I       G  +++S+  +  +++ 
Sbjct: 528 PSLAFPVSDNGRLSVFYAFNYADLTNVATTSS--QILRDEETIGAVATNSLGYAYSWDSR 585

Query: 587 DNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA-SYFYLLSDDSDIVGSLRFGYGCVIP 645
              I P  G ++    ++ GF GDSQ+ +  + A +   +L+++  +  ++  GY  +  
Sbjct: 586 RAGIDPNTGYILRFGQEF-GF-GDSQFIQTTAFAGAETKVLNEELTLRATVEGGY--LDY 641

Query: 646 SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPER 704
           ++   ++ D+F + S   +RGF   GIGPR  D   AIGG  ++ A     FP+ L P  
Sbjct: 642 TDGQSRVTDRFFLGSR-LMRGFDAGGIGPRARDGDDAIGGNAFAVARLEAEFPLGL-PSE 699

Query: 705 AGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
            G+ G  F D  +++ +     A +++ +D   R   G  I W +P+G +   +  PL  
Sbjct: 700 YGISGGLFYDYGSVWDSGY---AGQVDYDDFTARSVIGAAIFWTTPIGPLRFNFTEPLDV 756

Query: 765 REGDKIQQF 773
           +  DK + F
Sbjct: 757 QARDKTRAF 765


>gi|114768803|ref|ZP_01446429.1| putative outer membrane protein [alpha proteobacterium HTCC2255]
 gi|114549720|gb|EAU52601.1| putative outer membrane protein [alpha proteobacterium HTCC2255]
          Length = 774

 Score =  267 bits (683), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 204/785 (25%), Positives = 387/785 (49%), Gaps = 28/785 (3%)

Query: 7   DFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILS 66
           + + I   L K F     + FII+  +     A+  + ++ +  I I G   +  + ILS
Sbjct: 6   ELKDINSALSKKFNLVINVFFIIMLNSFIFYPALGNAESTNITGIHIVGNQRIESQTILS 65

Query: 67  RIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNN 126
              + +G+  SD ++++A+  + A  YF  VK+ +   +L I + E   IN + F GN N
Sbjct: 66  ISGLSIGERYSDTEINNALLRLNATKYFKLVKVNLDKKILTITVEENPTINSINFEGNFN 125

Query: 127 LKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITY 186
           LKD+ L  ++ +R    +    +  D   I +AY   G     V  +  + S   +++ +
Sbjct: 126 LKDENLLELIATRERQTFSASKIEHDAEKIAKAYNISGRNVAQVTPKIINKSNNRIDLVF 185

Query: 187 VIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIR 245
            I EG  ++I  I F GN+N+S  RL  VI+ + +G F  F K+D Y K+R+ +D + +R
Sbjct: 186 EINEGEISEIEKITFTGNRNFSDTRLRGVIATKQAGIFRRFIKSDTYIKDRLDYDLQLLR 245

Query: 246 AFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLS 304
            FY ++G+    V S+     ++K  +++ + I+EG+ Y  GNISI S    I    L  
Sbjct: 246 DFYINKGFINFNVISTSSKMTREKDAFLINYSIEEGQKYEFGNISILSKNDNIDLINLNK 305

Query: 305 LIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSP 364
           L +I+  + Y+P+++K+  E+I          F+ V  R+  D  K  V+IE  + Q + 
Sbjct: 306 LNKIKRNSTYDPRKLKKLIEEIEISLSKDGTNFINVIPRLLPDNDKLDVNIEINLSQSNK 365

Query: 365 LYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAN 424
           L+V+RI++ GN  + D VIR + +  EGD  +   +E++  RI A G+FS V ++    +
Sbjct: 366 LFVERIDVTGNSTTLDEVIRFKFDFVEGDAFDKRKVEKSIDRIRALGFFSNVGVTTREGS 425

Query: 425 DVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHA 484
             S  +I+ ++V++ + GS+GI   Y    G  +  +I + NF G+G +  L      + 
Sbjct: 426 S-SQKIIIDLNVEEKATGSLGIGAGYNSSDGSVLTFNISERNFLGKGQKVDLDIS-NSNV 483

Query: 485 VQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESA--AVRMIVPIT--ESISTS 540
            +  +  +EDP FL   + AG    +      S+ + +++   A ++  P++   ++S  
Sbjct: 484 EKQMSLGLEDPTFLDRNLLAGISFGRKSSTPYSVPLKNDNTYFAPKIKFPLSMDSTLSLI 543

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLI---EHGKFSSHSISQSIIYNTLDNPIVPRKGML 597
           ++YD   ++  +       PS+  + +   + G     +I  S   N  ++ + P  G  
Sbjct: 544 YRYDEDLIKLSS-------PSVTVSPLVSADVGDEIKSAIVLSYNLNKANSLVRPTAGYN 596

Query: 598 ISSSYDYAGFGGDSQYHRIG-SRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQF 656
                +  G GGD +Y +      +Y  L +DD  +  +L  G    I +  +  + ++F
Sbjct: 597 FEVKQEINGLGGDIKYLKTALDLKTYNTLFTDDIILASNLSSG----IINGNDANVLNRF 652

Query: 657 SVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSA 716
           S+  +  L GF   GIGP  D    +GGK++++ +   SFP+  VPE  G+ G  F+ + 
Sbjct: 653 SLGGD-ELPGFRNYGIGPN-DNGDPLGGKMFAAFNLEASFPIG-VPEEYGVFGGIFIGAG 709

Query: 717 TLYA-NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
           +++  ++ + G++ ++ + +  R + GV + W++ +G +   +  P++    D  + F F
Sbjct: 710 SVWKLDNTSSGSNVID-DSAKVRSAAGVSLFWDTIIGPLRFNFSRPIQKEINDITENFRF 768

Query: 776 RIGNR 780
            +  R
Sbjct: 769 TVDTR 773


>gi|302136428|gb|ADK94171.1| putative surface antigen [Edwardsiella tarda]
          Length = 795

 Score =  267 bits (683), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 218/801 (27%), Positives = 372/801 (46%), Gaps = 58/801 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  ++L   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL + 
Sbjct: 3   MKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLSNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ +YA G F +V++    + LI+ + ER  I  + FSGN ++KD+ LK  + +   R  
Sbjct: 63  IRALYATGNFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  N  VK     +    +++  V  EG  A+I  I  
Sbjct: 123 EALDRTTLSSIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +S A L     +R    +++      Y K++++ D EA+R++Y DRGYA   + S
Sbjct: 183 VGNHAFSSAELLGHFQLRDDVPWWNLMADRKYQKQKLAGDLEALRSYYLDRGYARFAINS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I E E Y +  + +   +     + +  L ++  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITESEQYKLEGVDVTGNMAGYSAE-ITRLTKVEPGELYNGAKV 301

Query: 320 KESSEKISKYF--FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            +  ++I +    +    P V+ +  IN D  K +V +   ID G+  YV++I   GND 
Sbjct: 302 TKMEDEIKQLLGRYGYAYPCVQTQPEIN-DKDKTVV-LHMNIDAGNRYYVRQIRFVGNDT 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S D+V+RRE+   EG  +    +E+ K R+  TGYF  V++         D V +   VK
Sbjct: 360 SKDAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPY 496
           + + GS      Y  + G+  +  +  +N+ G G    +A    ++  Q Y   S+ DPY
Sbjct: 420 ERNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTG--NVVAINGTKNDYQTYAELSLTDPY 477

Query: 497 FLGSPISAGFDLQKTHLEDGSLDINDESAAV-----RMIVPITESISTSFKYDLRFLQYG 551
           F  + +S G  L     +    D++D + +       +  PI E  + S +  L ++ + 
Sbjct: 478 FTVNGVSLGGRLFYNDFKANDADLSDYTNSSYGFDGTLGFPINE--NNSLRTGLGYV-HN 534

Query: 552 AISEKEKIPSIYTTLIEHG-----------KFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
            +S+ +   +++  L   G           K   ++ +    YN LD    P  G   S 
Sbjct: 535 DLSDMQPQVAMWRYLRSVGQNPSDSQRASYKADDYTWTAGWAYNNLDRGFFPTAGSKASL 594

Query: 601 SYDYAGFGGDSQYHRIG-SRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSV 658
           +      G D++Y+++     SYF +  D + +V G  R GYG      K +  ++ F  
Sbjct: 595 NGKITLPGSDNEYYKLTFDSQSYFPINQDRTWVVLGRTRLGYGNGF-GGKEMPFYENFYA 653

Query: 659 SSNYYLRGFAYKGIGPR---------VDKKY-----AIGGKIYSSASAAVSFPMPLVPER 704
             +  +RGF    IGP+         VD+       A+GG   + AS  +  P P V E+
Sbjct: 654 GGSGTVRGFQSNNIGPKAVYLNGDGSVDQSKTGDNDAVGGNAMAVASLELITPTPFVSEQ 713

Query: 705 --AGLRGAFFVDSATLYANHVALGA-----DKLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
               LR + F+D+ T++  +    A     D  +  +   R+S G+ + W SPLG +   
Sbjct: 714 YANSLRTSVFMDAGTVWDTNWDQAAYPTLPDYSKATNV--RLSAGIALQWMSPLGPLVFS 771

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P++  EGDK +QF F IG
Sbjct: 772 YAQPVKKYEGDKAEQFQFNIG 792


>gi|238918782|ref|YP_002932296.1| outer membrane protein assembly factor YaeT [Edwardsiella ictaluri
           93-146]
 gi|259710199|sp|C5B7R5|YAET_EDWI9 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|238868350|gb|ACR68061.1| outer membrane protein assembly complex, YaeT protein, putative
           [Edwardsiella ictaluri 93-146]
          Length = 795

 Score =  267 bits (683), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 215/811 (26%), Positives = 370/811 (45%), Gaps = 78/811 (9%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  ++L   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL + 
Sbjct: 3   MKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLSNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ +YA G F +V++    + LI+ + ER  I  + FSGN ++KD+ LK  + +   R  
Sbjct: 63  IRALYATGNFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  N  VK     +    +++  V  EG  A+I  I  
Sbjct: 123 EALDRTTLSSIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +S A L     +R    +++      Y K++++ D EA+R++Y DRGYA   + S
Sbjct: 183 VGNHAFSSAELLGHFQLRDDVPWWNLMADRKYQKQKLAGDLEALRSYYLDRGYARFTINS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + +   +     + +  L ++  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGDQYKLEGVDVTGNMAGYSAE-ITRLTKVEPGELYNGAKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  ++I +        + RV+T+   +   + V +   ID G+  YV++I   GND S 
Sbjct: 302 TKMEDEIKQLLGRYGYAYPRVQTQPEINDKDKTVILHMNIDAGNRYYVRQIRFVGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D+V+RRE+   EG  +    +E+ K R+  TGYF  V++         D V +   VK+ 
Sbjct: 362 DAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS      Y  + G+  +  +  +N+ G G    +A    ++  Q Y   S+ DPYF 
Sbjct: 422 NTGSFNFGIGYGTESGISFQVGVQQDNWLGTG--NVVAINGTKNDYQTYAELSLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAV-----RMIVPITESISTSFKYDLRFLQYGAI 553
            + +S G  L     +  + D++D + +       +  PI E  + S +  L ++ +  +
Sbjct: 480 VNGVSLGGRLFYNDFKANNADLSDYTNSSYGFDGTLGFPINE--NNSLRTGLGYV-HNDL 536

Query: 554 SEKEKIPSIYTTLIEHG-----------KFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
           S+ +   +++  L   G           K   ++ +    YN LD    P  G   S + 
Sbjct: 537 SDMQPQVAMWRYLRSVGQNPSDSERASYKADDYTWTAGWAYNNLDRGFFPTAGSKASLNG 596

Query: 603 DYAGFGGDSQYHRIG-SRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y+++     SYF +  D + +V G  R GYG      K +  ++ F    
Sbjct: 597 KITLPGSDNEYYKLTFDSQSYFPINQDRTWVVLGRTRLGYGNGF-GGKEMPFYENFYAGG 655

Query: 661 NYYLRGFAYKGIGPR---------VDKKY-----AIGGKIYSSASAAVSFPMPLVPER-- 704
           +  +RGF    IGP+         VD+       A+GG   + AS  +  P P V E+  
Sbjct: 656 SGSVRGFQSNNIGPKAVYLNSDGSVDQNKTGGNDAVGGNAMAVASLELITPTPFVSEQYA 715

Query: 705 AGLRGAFFVDSATLYANHVALGADKLEGNDSFW-----------------RVSTGVEIMW 747
             LR + F+D+ T++              D+ W                 R+S G+ + W
Sbjct: 716 NSLRTSVFMDAGTVW--------------DTNWDQTTYPTLPDYSKATNVRLSAGIALQW 761

Query: 748 NSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            SPLG +   Y  P++  EGDK +QF F IG
Sbjct: 762 MSPLGPLVFSYAQPVKKYEGDKSEQFQFNIG 792


>gi|253996529|ref|YP_003048593.1| outer membrane protein assembly complex protein YaeT [Methylotenera
           mobilis JLW8]
 gi|253983208|gb|ACT48066.1| outer membrane protein assembly complex, YaeT protein
           [Methylotenera mobilis JLW8]
          Length = 774

 Score =  266 bits (681), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 205/757 (27%), Positives = 351/757 (46%), Gaps = 41/757 (5%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V+ I + G        + S +PV VG+ + D     A+K++Y+ G+F +V+I+  ++VLI
Sbjct: 36  VKDIRVEGIQRTEAGTVFSHLPVKVGEIMDDDLASQAIKSLYSTGFFKDVRIEAENNVLI 95

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + + ER  I  + FSGN +   D++K  ++    A    +D+  ++     IK+ Y S G
Sbjct: 96  VTVQERAAIAQIEFSGNKSFPTDKMKEGLKQIGIAESQIFDKSQLDRAEQEIKRQYLSQG 155

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
                VK     +    + + + IEEG  +KI  I  VGNK Y+   L     + T  + 
Sbjct: 156 KYGATVKTVVTPLERNRVAVRFDIEEGAVSKIRDINIVGNKAYTIEDLRAQFLLTTPNWM 215

Query: 225 SF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           S+  K D YSK++++ D EA+R+FY ++GY    + S+QV     K    +   I EGE 
Sbjct: 216 SWWNKDDQYSKQKLNADLEALRSFYMNQGYLEFNIDSTQVSITPDKKDIYITINITEGEK 275

Query: 283 YTVGNISIQ-STLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
           YT+  + +   TL  + +  L  LI++++G+ ++ +++ ++S+ IS    +    F  V 
Sbjct: 276 YTISEVKLAGETL--VPEDELRQLIQVQAGDTFSREKVTQTSKAISDRLSNDGYAFSNVN 333

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
              + +  +      + +D G  +YV+RI + GN ++ D VIRRE+   E      + I 
Sbjct: 334 PVPDINKEQHTAAFTFFVDPGKRVYVRRINVVGNTRTRDEVIRREVRQLESAWYASNKIN 393

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
           R+K RI  T +FS+VN+        +D V L +SV + S GSV        ++G+     
Sbjct: 394 RSKERITRTDFFSDVNVETPAVAGTADQVDLNISVTEKSTGSVQFGAGLSSNEGVVFGIT 453

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDIN 521
           ++ NNF G G R       G+     Y+ S  DPYF    +S G DL +  +   SL+I 
Sbjct: 454 VNQNNFLGTGNRVSAQVNTGKVNT-TYSLSYTDPYFTPDGVSRGIDLYRRDVNTSSLNIG 512

Query: 522 DESAA-----VRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGK-FSSH 575
             S +     VR  +P+ E    +F     F      S+    P  Y    +     SS+
Sbjct: 513 TYSTSSYGGGVRFGIPLNERDGVNFGLAADFTSVDLTSQS---PQQYKDFCDKASGCSSN 569

Query: 576 SI--SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV 633
           SI  S    +++ D+ +   KG+L   S +      D +Y++I  + ++F  L     ++
Sbjct: 570 SIVASAGWTHDSRDSIMFTTKGVLQRLSGEVTIPVLDLEYYKIDYKHAWFKELLTGYTLM 629

Query: 634 GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-----VDKKYAIGGKIYS 688
            +   GY      NKN   F  F +     +RG+    +GPR         +A+GG    
Sbjct: 630 LNGEIGYADSY-GNKNYPFFKNFYMGGVNSVRGYTNGSLGPRGIDSTTGNDFALGGTKRM 688

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSF----WRVSTGVE 744
             +A +  P+P + +    R + F D+  ++             NDS+     R STG+ 
Sbjct: 689 LGNAELYVPIPGLKDSKQFRMSVFADAGNVFG-----------ANDSYDFGELRYSTGLG 737

Query: 745 IMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           + W SP G + + +  PL  + GD  Q   F++G + 
Sbjct: 738 LSWVSPFGPLKLVFAKPLNSKPGDNTQTIQFQLGQQF 774


>gi|188533045|ref|YP_001906842.1| outer membrane protein assembly factor YaeT [Erwinia tasmaniensis
           Et1/99]
 gi|226708909|sp|B2VE18|YAET_ERWT9 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|188028087|emb|CAO95944.1| Outer membrane protein assembly factor YaeT [Erwinia tasmaniensis
           Et1/99]
          Length = 803

 Score =  266 bits (680), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 212/794 (26%), Positives = 360/794 (45%), Gaps = 64/794 (8%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
            VYG++  +V+ I   G   V     L  +PV VG ++SD DL + ++ ++A G F +V+
Sbjct: 17  TVYGADGFVVKDIHFDGLQRVAVGAALLSMPVRVGDTVSDEDLSNTIRALFATGNFEDVQ 76

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAYDEDTVNADVHN 155
           +    + LI+ + ER  I  + FSGN  +K+D LK  + +   R   A D  TV+     
Sbjct: 77  VLRDGNTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVRVGEALDRTTVSTIEKG 136

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  VGNK +S   L   
Sbjct: 137 LEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINVVGNKAFSSDELISR 196

Query: 216 ISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVL 273
             +R    +++      Y K++++ D E +R+FY DRGYA   + S+QV     K G  +
Sbjct: 197 FQLRDDVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDSTQVSLTPDKKGIYI 256

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
              I EGE Y +  +++   L       +  L +++ G LYN  ++  + + I K     
Sbjct: 257 TVNITEGEQYKLSGVAVSGNLAG-HSAEIEGLSKVKPGELYNGAKVTRTEDDIKKLLGRY 315

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
              + RV+T+   D A + V +   +D G+  YV+++  EGND S D+V+RRE+   EG 
Sbjct: 316 GYAYPRVQTQTEIDDANKTVKLHINVDAGNRYYVRKVRFEGNDTSKDAVLRREMRQMEGA 375

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
            +   ++E+ K R+   GYF  V+   +     +D V +   VK+ + G++     Y  +
Sbjct: 376 WLGSDLVEQGKDRLNRIGYFETVDTDTVRVPGSADQVDVVYKVKERNTGTLNFGVGYGTE 435

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSPISAGFDLQKTH 512
            G+  +  I   N+ G G    ++    ++  Q Y  FS+ DPYF    +S G  L   +
Sbjct: 436 SGVSFQAGITQENWLGTGNTVGISGT--KNDYQTYAEFSLTDPYFTVDGVSLGGRLFYNN 493

Query: 513 LEDGSLDINDESAAV-----RMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLI 567
            +    D++D +         +  P+ E+   + +  L ++ + ++S  +   +++  L 
Sbjct: 494 FKADDADLSDYTNKSYGLDGTLGFPVNEN--NTLRVGLGYV-HNSLSNMQPQVAMWRYLR 550

Query: 568 EHGKFSSHSISQSI-----------IYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRI 616
             G   S S ++              YNTLD    P  G   + +      G D+ +++ 
Sbjct: 551 SVGMNPSLSSNEDFSTDDFTFNYGWTYNTLDRGFFPTAGNRTNLNGKVTIPGSDNAFYKA 610

Query: 617 GSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGP 674
                 +  L  D    ++G  R GY   + S K L  ++ F    +  +RGF    IGP
Sbjct: 611 TLDTQQYVPLDQDHSWVLLGRGRVGYADGL-SGKELPFYENFYAGGSSTVRGFRSNTIGP 669

Query: 675 R-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPER--AGLRGAFFV 713
           +                        A+GG   + ASA +  P P + E+    +R + FV
Sbjct: 670 KAAYYNNGSSNCSGSDVAKICSSDDAVGGNAMAVASAELITPTPFLSEKYANSVRTSLFV 729

Query: 714 DSATLYANH-----VALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
           D+ T++  H       LGA   +    GN    R+S G+ + W SPLG +   Y  P + 
Sbjct: 730 DAGTVWDTHWDDTAATLGAGVPDYSKPGN---IRMSAGLALQWMSPLGPLVFSYAQPFKK 786

Query: 765 REGDKIQQFGFRIG 778
            +GDK +QF F IG
Sbjct: 787 YDGDKAEQFQFNIG 800


>gi|307129828|ref|YP_003881844.1| hypothetical protein Dda3937_01884 [Dickeya dadantii 3937]
 gi|306527357|gb|ADM97287.1| conserved protein [Dickeya dadantii 3937]
          Length = 805

 Score =  266 bits (680), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 208/807 (25%), Positives = 371/807 (45%), Gaps = 60/807 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVTDEDIGNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      L+I + ER  I  L FSGN  +K++ LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGDSLLIQVKERPTIASLTFSGNKAVKEEMLKENLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTLSNIEKGLEDFYYSVGKYSATVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK++S   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S
Sbjct: 183 VGNKSFSSDELISRFQLRDEVPWWNVVGDRKYEKQKLSGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + ++  L       +  L R++SG LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITVNITEGDQYKLSGVVVRGNLVG-HATEIEDLTRVQSGELYNGTKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               E I K        + RV T+   +   + V +   +D G+   V+RI  +GND S 
Sbjct: 302 TRMEEDIKKLLGRYGYAYPRVVTQPEINDTDKTVRLNINVDAGNRFTVRRIRFDGNDVSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +   ++++ K R+   GYF  V++         D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGGWLGNDLVQQGKERLNRLGYFESVDVETQRVPGTPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     +  + G+  +  +  +N+ G G    ++    R+  Q Y   S+ DPYF 
Sbjct: 422 NTGSLNFGIGFGTESGVSFQAGVQQDNWLGTGNSVGISG--TRNDYQTYVELSMTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQYGAI 553
              +S G  +   + +    D++D +     A   +  PI E  + S +  L ++ + ++
Sbjct: 480 VDGVSLGGRIFYNNFKALDADLSDYTNQSYGAGTTLGFPINE--NNSLRVGLDYV-HNSL 536

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSI-------------IYNTLDNPIVPRKGMLISS 600
           S+ +   +++  L + G     S + S               YN LD    P  G   + 
Sbjct: 537 SDMKPQVAMWRYLSKAGVDPDPSTTSSASFDANDFFLTSGWTYNNLDRGYFPTAGNRANL 596

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSV 658
           +      G D++Y+++   ++ ++ LS++ + V     + GY   + S K +  +D F  
Sbjct: 597 NAKVTVPGSDNEYYKLTFDSASYFPLSENHNWVLMARTKAGYADGL-SGKEVPFYDNFFA 655

Query: 659 SSNYYLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAVSFPMP 699
             +  +RGF    IGP+                      + A+GG   + ASA +  P P
Sbjct: 656 GGSSSVRGFRSNTIGPKAAYYTGCSTANVSSCSIDSTKMRDAVGGNAMAVASAELIVPTP 715

Query: 700 LVPER--AGLRGAFFVDSATLYANHVALGADKLEGNDSFW------RVSTGVEIMWNSPL 751
            + ++  + +R +FFVD+ T++  H    A  L      +      R+S+G+ + W SPL
Sbjct: 716 FISDKYSSSIRTSFFVDAGTVWDTHWENTAQTLAAGVPDYSTPGNIRMSSGLAVQWMSPL 775

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P +  +GD+ +QF F IG
Sbjct: 776 GPLVFSYAQPFKKYDGDRSEQFQFNIG 802


>gi|307824007|ref|ZP_07654234.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacter tundripaludum SV96]
 gi|307734791|gb|EFO05641.1| outer membrane protein assembly complex, YaeT protein
           [Methylobacter tundripaludum SV96]
          Length = 793

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 201/787 (25%), Positives = 349/787 (44%), Gaps = 62/787 (7%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
           AV G    +V  I+++G   +    + + +PV VG+  S  ++  A+K ++  G+F ++ 
Sbjct: 19  AVKGDEEFVVEDIKVKGLQRISVGTVYNYLPVNVGEKFSLDNVAPAIKALFKTGFFKDIS 78

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA---AYDEDTVNADVHN 155
           ++   S LI++++ER  I  + F GN +L  D L   ++    A    +D+  ++     
Sbjct: 79  LEREGSTLIVNVVERPSIAKIIFEGNKDLSKDDLTKALKKIGLAEGKVFDQQVLDKVEQE 138

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           + + Y S G   + +     +++   + I   I EG  AKI  I  VGN  +    L R 
Sbjct: 139 LSRQYFSHGKYGLKITTDVSNLTRNRVGIHIKISEGRVAKIKQINVVGNNVFDDKTLLRN 198

Query: 216 ISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVL 273
           + + TS   SF  K D YSK+++  D E +R++Y DRGY    + S+QV     K    +
Sbjct: 199 LELNTSNLLSFYTKDDQYSKQKLQADLETLRSYYLDRGYINFNIESTQVAITPDKKDIYV 258

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
              + EG+IY +  + +   L  +    L+ L+++  G  ++ +   E+S+ IS      
Sbjct: 259 TINVKEGDIYKLEKVKLAGNLV-VAPPELIKLVKVGPGETFSRKNATETSKAISDRLGDD 317

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
              F  V      + AK+ VD+ + +D G  +YV+RI ++GN ++ D V+RRE+   E  
Sbjct: 318 GYAFANVNMVPEINEAKKTVDMTFFVDPGKRVYVRRINMKGNSKTRDEVLRREMRQMESS 377

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             + S IER+K R+   GYF EVN+   P    +D + +  SV +  +G++     +   
Sbjct: 378 WASSSKIERSKTRLERLGYFEEVNVETPPVTGTADQIDVNYSVVEKPSGNLSAGVGFSQT 437

Query: 454 KGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHL 513
           +G+ +  +I  +N FG G R  +A     +A  +Y F   +PYF    +S G++L  T  
Sbjct: 438 QGIVLNANIAQDNVFGSGKRVNVAFNNSSYAT-SYQFGFFNPYFTVDGVSQGYNLGYTKR 496

Query: 514 EDGSLDI-----NDESAAVRMIVPITESISTSFKYDLRFLQY------------------ 550
             G ++I     N  +A V   +P+ E  S  F  D +  +                   
Sbjct: 497 NAGQINIANYSTNVMNAGVNFGIPLNEFDSLRFDVDAKHTELSTTDYSSNEICDFIYGNN 556

Query: 551 ---------GAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
                    G I      P +  T      F + + +    ++TL+  I P +G     S
Sbjct: 557 GTNQCTNNSGTIGAANTRPIVKAT---GDTFLTLAPAVGWTHDTLNRAIFPNRGQQQRFS 613

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSN 661
                 G D +Y+++G +   ++ L+ D         GYG    +  +L  F+ +     
Sbjct: 614 ALATVPGSDLEYYKVGYKHQLYFPLAKDFTFRLQGEVGYGDGYGNTASLPFFENYFGGGT 673

Query: 662 YYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN 721
             +RGF    +GPR    +A GG      +A + FP+P +PE   +R   F+D+ ++   
Sbjct: 674 GSIRGFKNNTVGPRDSNGFAFGGSSKIIGNAEMFFPVPFMPETKSVRLGTFLDAGSI--- 730

Query: 722 HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE----------GDKIQ 771
           +    A+ L       + S GV   W SP G + V   +PL              GD+ Q
Sbjct: 731 NNGFKANNL-------KYSVGVSGEWLSPFGALSVSAALPLNAASSATAADGTITGDQKQ 783

Query: 772 QFGFRIG 778
            F F  G
Sbjct: 784 MFQFNFG 790


>gi|238754799|ref|ZP_04616150.1| Outer membrane protein assembly factor yaeT [Yersinia ruckeri ATCC
           29473]
 gi|238706959|gb|EEP99325.1| Outer membrane protein assembly factor yaeT [Yersinia ruckeri ATCC
           29473]
          Length = 795

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 215/803 (26%), Positives = 371/803 (46%), Gaps = 62/803 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ + 
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDISNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      LI+ + ER  I  + FSGN  +K+D LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +S   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHAFSTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   + EGE Y + ++ +   L   Q +    L +I  G L+N  ++
Sbjct: 243 TQVSLTPDKKGIYITINLTEGEQYKLDSVIVSGNLAGHQSEAE-KLTKIEPGELFNGGKV 301

Query: 320 KESSEKISKYF--FSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
               + I K    +    P V+++  IN   A + V +   +D G+  YV+++  EGND 
Sbjct: 302 TRMEDDIKKMLGRYGYAYPRVQIQPEIND--ANKTVKLRVNVDAGNRFYVRKVRFEGNDT 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S DSV+RRE+   EG  +    +E+ K R+   GYF  V++        +D V +   VK
Sbjct: 360 SKDSVLRREMRQMEGAWLGNDQVEQGKDRLNRLGYFETVDVETQRVPGTADQVDVTYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPY 496
           + + GS+     Y  + G+  +  +  +N+ G G    +     ++  Q Y  F++ DPY
Sbjct: 420 ERNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGING--TKNDYQTYAEFTMTDPY 477

Query: 497 FLGSPISAG-------FDLQKTHLE---------DGSL--DINDESAAVRMIVPITESIS 538
           F    +S G       F      L          DG+L   IN+ ++    +  +  S+S
Sbjct: 478 FTVDGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGVGYVHNSLS 537

Query: 539 TSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGM 596
                   +    ++ +K      YT   +  +F++   + ++   YN LD    P  G+
Sbjct: 538 DMLPQVAMWRYLESVGQKPN----YT---DRAEFTADDFTLNLGWTYNNLDRGFFPTSGV 590

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFD 654
             S +      G D++++++    S +  L  D    ++G  R GYG  +   K +  ++
Sbjct: 591 KSSVNSKVTVPGSDNEFYKVTFDTSAYLPLDQDRSWVLLGRGRLGYGDGL-GGKEMPFYE 649

Query: 655 QFSVSSNYYLRGFAYKGIGP----------RVDKKY-AIGGKIYSSASAAVSFPMPLVPE 703
            F    +  +RGF    IGP          +++K   A+GG   + AS  +  P P + E
Sbjct: 650 NFYAGGSSTVRGFRSNNIGPKAAYYADNGTKINKSTDAVGGNAMAVASIELITPTPFISE 709

Query: 704 R--AGLRGAFFVDSATLYANH-----VALGADKLEGND-SFWRVSTGVEIMWNSPLGMMG 755
           +    +R + F+DS T++  H     ++  A   + ND S  RVS GV + W SPLG + 
Sbjct: 710 KYSNSVRTSVFIDSGTVWDTHWENTAMSQTAGIPDYNDPSNIRVSAGVALQWMSPLGPLV 769

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P++   GDK +QF F IG
Sbjct: 770 FSYAKPVKDYPGDKSEQFQFNIG 792


>gi|294012394|ref|YP_003545854.1| outer membrane protein YaeT [Sphingobium japonicum UT26S]
 gi|292675724|dbj|BAI97242.1| outer membrane protein YaeT [Sphingobium japonicum UT26S]
          Length = 878

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 206/833 (24%), Positives = 369/833 (44%), Gaps = 106/833 (12%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           +R I + G   +  + +LS   + +GQS +   LD A++++Y    F++V+I+  +  L 
Sbjct: 51  IRAISVTGQQRLEPDTVLSYTKLRIGQSFTQESLDQALRDLYETELFADVQIRNDNGALT 110

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           +++ E  +IN +   GN  LK+D+++  ++      Y    V ADV  I + Y   G   
Sbjct: 111 VEVKENPVINRIVLEGNKRLKEDKIRPEIKLAPRQIYTRSKVRADVARIIELYRRQGRFA 170

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-F 226
             V+ +   +    ++I + I EG K+K+  I  +GN+ +    L   +  + S +F  F
Sbjct: 171 ATVEPKMVQLDQNRVDIVFEISEGPKSKVRQINIIGNEKFKDGELRSQMVTKQSRWFRIF 230

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
                Y  +R+++D++ +R FY   GYA  +V S V      K  +++ + ++EG+ Y  
Sbjct: 231 SSGTSYDPDRLAYDQQKLRQFYLTEGYADFRVISAVAELTPDKQDFIITYVVEEGQRYKF 290

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           G++ + S ++++   +L  ++ ++ G+ YN ++++++ + +S+        F  V+    
Sbjct: 291 GDVKVNSDIRDLSGDSLTRMLPMKKGDWYNAKQVEDTVDTLSETAGLFGYAFADVQPDFQ 350

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           RD     + I++ I     +YV+R++I GN  + D V+RRE  L+EGD  N  +++R+K 
Sbjct: 351 RDKDTLTMGIDFRIANAPRVYVERVDINGNTLTQDKVVRREFRLAEGDAFNSFLVKRSKD 410

Query: 406 RIMATGYFSE-VNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDD 464
           RI + G+F E ++I Q P +   D ++L  +V++ S G + ++  +   +   V   I  
Sbjct: 411 RINSLGFFQEKLDIEQKPGS-APDRIVLETNVQEKSTGELSLSAGFSSLERFIVSASITQ 469

Query: 465 NNFFGQGYRARLAAGFGRHAVQNYTFSVE----DPYFLGSPISAGFDLQKTHLEDGS-LD 519
            NF G+G   R +  +       Y+ SVE    +PYF+   I+ G D+ +  L     L+
Sbjct: 470 RNFRGKGQELRTSVNY-----SAYSKSVEVGFTEPYFMDRNIALGGDIYRRDLNSFRYLN 524

Query: 520 INDESAA---------VRMIVPITESISTSFKYDLRFLQ--------YGAISEKEKIPSI 562
            ND             +R  VPITE +S + +Y L            Y        +   
Sbjct: 525 NNDRDTTYEQTTTGFQLRAGVPITEYMSLALRYTLNLDDVTLDKDSYYSDPDGAGPLGLQ 584

Query: 563 YTTLIEH-------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
              L+         GK ++ S+  S+IY+T DN I P +G  +  S D+AG GG  +Y R
Sbjct: 585 CDPLLAGRYLCDAIGKRTTSSLGYSLIYDTRDNRIRPTRGHNVVLSQDFAGLGGSVKYVR 644

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNK---NLQLFDQFSVSSNYYL-----RGF 667
                S ++ +        S   GY   +  ++   + +L D+  ++  ++L     RGF
Sbjct: 645 TRLNGSKYWPVGGGFIFSVSAEGGYIHSLEGDRRDASNELVDKVRLTDRFFLGNPQIRGF 704

Query: 668 AYKGIGPRVDKKY-------------------------AIGGKIYSSASAAVSFPMPLVP 702
             +GIGPRV + Y                         A+GGK Y  A A +  P+    
Sbjct: 705 DIRGIGPRVKRYYLQSQTNPDGSITYVRGEGNNNVSDDALGGKAYYLARAEMEIPLGSGA 764

Query: 703 ERAGLRGAFFVDSATL-------YANHVALGADKLEGNDSFW------------------ 737
              GLR + F D   +         +   + AD   G+ S                    
Sbjct: 765 REMGLRPSIFADVGAVAGLRNPRTTDSNGICADNTTGSRSEAGTPGTCGTGQTLLIGPFE 824

Query: 738 ----------RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
                     RV+ G  + WNSP G   +     L    GD  Q   F +G +
Sbjct: 825 EEYLGDTLKPRVAVGFGVNWNSPFGPFRIDIAKALLKEPGDDTQLISFNVGTQ 877


>gi|317053973|ref|YP_004117998.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           At-9b]
 gi|316951968|gb|ADU71442.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           At-9b]
          Length = 812

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 217/806 (26%), Positives = 368/806 (45%), Gaps = 75/806 (9%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           +  +G++   +R I   G   V     +  +PV VG  ++D D+ + ++ ++A G F +V
Sbjct: 14  TTAFGADDFTLRDIHFDGLQRVAPGAAMLSMPVRVGDRVNDDDIKNTIRALFATGNFEDV 73

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA---AYDEDTVNADVH 154
           ++      L+I + ER  I  + FSGN  +K+DQLK  + +   +   A D  T+++   
Sbjct: 74  QVLRDGDTLLIKVRERPSIASISFSGNKAIKEDQLKQNLEASGVSVGNALDRTTLSSIEK 133

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
            ++  Y S+G     VK     +    +++ ++  EGV AKI  I  VGN  +S   L  
Sbjct: 134 GLEDFYYSVGKYTASVKAVVTPLPRNRVDLKFIFTEGVSAKIQQINIVGNHAFSDDELIT 193

Query: 215 VISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYV 272
              +R S  +++F     Y K++++ D E +R++Y DRGYA   + S+QV     + G  
Sbjct: 194 QFQLRDSVPWWNFIADQKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDRKGIY 253

Query: 273 LIFQIDEGEIYTVGNISIQSTLQ----EIQKKTLLSLIRIRSGNLYNPQEIKESSEKISK 328
           +   I EG++Y V  + +   L     EI+K     L +I  G LY+  +I ++   I  
Sbjct: 254 ITVNIHEGDVYHVSGVEVNGNLAGHSAEIEK-----LAQIPQGGLYSGAKITQNENAIKD 308

Query: 329 YFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELE 388
                   F +V T+   + A + V +   +D G+  YV+++  EGND S DSV+RRE+ 
Sbjct: 309 LLGRYGYAFPQVSTQPEINDADKTVKLHVNVDAGNRFYVRKVRFEGNDTSKDSVLRREMR 368

Query: 389 LSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIAT 448
             EG  +  +++++ K R+  TGYF  V++         D V +   VK+ + GS  I  
Sbjct: 369 QMEGAWLANNLVDKGKERLNRTGYFESVDVDTQRVPGSPDQVDVVYKVKERNTGSFNIGV 428

Query: 449 NYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFLGSPISAGFD 507
            Y  D G+  +  +  +N+ G G     +    ++  Q Y   S  +PYF    +S G  
Sbjct: 429 GYGTDSGVSFQLGVSQDNWMGTGNTVGFSGT--KNDYQTYVEISATNPYFTVDGVSLGGK 486

Query: 508 LQKTHLEDGSLDINDES-----AAVRMIVPITE--SISTSFKY-------------DLRF 547
           L     +    D+++ +     A   +  PI+E  SI+T F Y               R+
Sbjct: 487 LFYNDYKADDDDLSEYTLKSLGAGTTLSFPISENNSINTGFDYVYNRVSNMAPQVAMWRY 546

Query: 548 LQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSII-------YNTLDNPIVPRKGMLISS 600
           L   ++    K+        +    SS++ S + +       YN+LD    P  G+    
Sbjct: 547 LD--SVGVHPKVIETDDDDDDDYATSSNTFSANDVFWNVGWGYNSLDRGFFPTSGVTAGF 604

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSV 658
           +      G  + Y++    A+ +  LS D   V  G  + GY   +   K +  +D F  
Sbjct: 605 NTKVTVPGSTNSYYKSTLSANAYLPLSSDHRWVLMGRTKAGYADGL-GGKEVPFYDNFYA 663

Query: 659 SSNYYLRGFAYKGIGPRV--------DKKY----------AIGGKIYSSASAAVSFPMPL 700
             +  +RGF+   IGP+         +  Y          A+GG   + ASA +  P P 
Sbjct: 664 GGSSSVRGFSSNTIGPKAAYYSCTGSESSYSNCAVTKSDDAVGGNAMAVASAELIVPTPF 723

Query: 701 VPER--AGLRGAFFVDSATLY----ANHVALGADKLE--GNDSFWRVSTGVEIMWNSPLG 752
           V ER  + LR + FVD+ T++     N  A  A  +   G+ +  RVS+G+ + W SPLG
Sbjct: 724 VSERYESSLRTSVFVDAGTVWDTKWENTAATRAAGIPDYGDPNNIRVSSGLALQWQSPLG 783

Query: 753 MMGVYYGIPLRHREGDKIQQFGFRIG 778
            +   Y +P++  EGDK +QF F IG
Sbjct: 784 PLVFSYAVPIKKYEGDKSEQFQFNIG 809


>gi|242240388|ref|YP_002988569.1| outer membrane protein assembly factor YaeT [Dickeya dadantii
           Ech703]
 gi|242132445|gb|ACS86747.1| outer membrane protein assembly complex, YaeT protein [Dickeya
           dadantii Ech703]
          Length = 807

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 213/810 (26%), Positives = 363/810 (44%), Gaps = 64/810 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVTDEDIGNI 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + L+I + ER  I  L FSGN ++K++ LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGNALLIQVKERPTIASLTFSGNKSVKEEMLKENLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T++     ++  Y S+G  +  VK     +    +++  V  EG+ AKI  I  
Sbjct: 123 EALDRTTLSNIEKGLEDFYYSVGKYSATVKAVVTPLPRNRVDLKLVFTEGISAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK+++   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S
Sbjct: 183 VGNKSFNSDELISRFQLRDEVPWWNVVGDRKYEKQKLSGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + ++  L       +  L RI+ G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGDQYKLSGVVVRGDLAG-HASEIEGLTRIQPGELYNGTKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               E I K        + RV T+   + + + V +   +D G+   V RI  EGND S 
Sbjct: 302 TRMEEDIKKLLGRYGYAYPRVVTQPEINDSDKTVRLSINVDAGNRFTVHRIRFEGNDVSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +   ++++ K R+   GYF  V++         D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGGWLGNDLVQQGKERLNRLGYFESVDVETQRVPGTPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     +  + G+  +  +  +N+ G G    ++    R+A Q Y   S+ DPYF 
Sbjct: 422 NTGSLNFGIGFGTESGVSFQAGVQQDNWLGTGNSVGISG--TRNAYQTYVELSMTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQYGAI 553
              +S G  +   + +    D+ D +         +  PI E+ S     D     +  +
Sbjct: 480 VDGVSLGGRIFYNNFKAYDADLADYTNRSYGVGSTLGFPINENNSLRLALD---YVHNDL 536

Query: 554 SEKEKIPSIYTTLIEHGKFSSHS----------------ISQSIIYNTLDNPIVPRKGML 597
           S+ +    ++  L + G                      ++    YN LD    P  G  
Sbjct: 537 SDMKPQVGMWRYLDKVGTHPEVVTSSNSSTSNYAANDFFLTPGWTYNDLDRGYFPTAGNR 596

Query: 598 ISSSYDYAGFGGDSQYHRIG-SRASYFYLL-SDDSDIVGSLRFGYGCVIPSNKNLQLFDQ 655
            S +      G D++Y++     ASYF L  S +  ++   R GYG  +   K +  +D 
Sbjct: 597 ASLNVKVTVPGSDNEYYKATFDSASYFPLTESKNWVLMARTRVGYGDGL-GGKEVPFYDN 655

Query: 656 FSVSSNYYLRGFAYKGIGPRV------------------DKKYAIGGKIYSSASAAVSFP 697
           F    +  +RGF    IGP+                       A+GG   + ASA    P
Sbjct: 656 FFAGGSSSVRGFRSNTIGPKAAYYQCSSSDSSYSTCPVSKSSDAVGGNAMAVASAEFIVP 715

Query: 698 MPLVPER--AGLRGAFFVDSATLYANH-------VALGADKLEGNDSFWRVSTGVEIMWN 748
            P + ++  + +R +FFVD+ T++  H       +A G        +  R+S+G+ + W 
Sbjct: 716 TPFISDKYASSVRTSFFVDTGTVWDTHWENTAATIAAGIPDYSQPGNI-RMSSGIAVQWM 774

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           SPLG +   Y  P +  EGDK +QF F IG
Sbjct: 775 SPLGPLVFSYAQPFKKHEGDKSEQFQFNIG 804


>gi|83951890|ref|ZP_00960622.1| outer membrane protein, OMP85 family protein [Roseovarius
           nubinhibens ISM]
 gi|83836896|gb|EAP76193.1| outer membrane protein, OMP85 family protein [Roseovarius
           nubinhibens ISM]
          Length = 727

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 195/723 (26%), Positives = 338/723 (46%), Gaps = 18/723 (2%)

Query: 63  VILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFS 122
            IL+   +  G++I+   L+ A + I + G F +V ++   ++L I + E   I+ + F 
Sbjct: 11  TILTYAGIARGETINAGQLNQAYQRIVSSGLFESVSLEPRGNLLKITVKEYPTISKIAFE 70

Query: 123 GNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTL 182
           GN  LKDD L   + S     ++ +    D   I +AY   G L   VK +    S   +
Sbjct: 71  GNRKLKDDDLSGFIESSPRQVFNPEKAERDAQTIVEAYEQNGRLAARVKPRIIRRSDNRV 130

Query: 183 NITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDE 241
           ++ + I EG   ++  I FVGN+ YS  RL RV+  + +G   +    D + ++R+ FD+
Sbjct: 131 DLVFEIFEGGAIEVQRIGFVGNRAYSDRRLRRVLESKQAGLLRALIARDTFVEDRLEFDK 190

Query: 242 EAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           + +  FY  RG+   +V+       +++  Y + F I+EG+ +  G I+  S +  +   
Sbjct: 191 QVLADFYAARGFVDFRVTGVNAELARERDTYFVTFNIEEGQQFRFGEITTISEINGVDPD 250

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
              ++++IR G +Y+P  ++ S  ++ +        F+R++ RI R+     +D+E+ I 
Sbjct: 251 IYQNVLKIRPGVIYSPTAVENSIARMERQGVRDGVDFLRIEPRITRNDRDLTLDVEFAIV 310

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           +G  ++V+RI+IEGN  + D VIRR+ +  EGDP N   I +A  RI A GYF+  +++ 
Sbjct: 311 RGPRVFVERIDIEGNTTTLDRVIRRQFKTVEGDPFNPREIRQAAERIRALGYFANADVNA 370

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
              +   D V++ V V++   G++    +Y    G GV   + + NF G+G     +   
Sbjct: 371 REGSR-PDQVVVDVDVEEQPTGTLSFGASYSTSSGFGVSVGLRERNFLGRGQTVAASVSV 429

Query: 481 GRHAVQNYTFSVEDPYFLGSPIS--AGFDLQKTHLEDGSLDINDESAAVRMIVPITESIS 538
           G   V NY     +P FLG  +    GF   +T  ++   D N  +   R+  P++E+  
Sbjct: 430 GADTV-NYNLDFSEPAFLGRDVEFGVGFSYLETDSDNALYDTNIGTFRPRLSFPVSENGR 488

Query: 539 TSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLI 598
            +  Y  R+ +    +    I  +     E G F+S     +  Y+T  + + P  G+L+
Sbjct: 489 FTVLYSARYSEMDNYTGTSGI--LARESAESGSFAS-GFGYNYTYDTRRSGLNPNAGVLL 545

Query: 599 SSSYDYAGFGGDSQYHRIGSR-ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFS 657
           S   D+ G GGD  Y    +R  +   +  ++  +  +L  G      S  N +  D+F 
Sbjct: 546 SFGQDFYGVGGDLDYIHTSARVVAQTRVFHEEVTLRATLE-GGALTFGSGSNSRAVDRF- 603

Query: 658 VSSNYYLRGFAYKGIGPRVDKKYA---IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
             S   +RGF   GIGP          +GG  Y++      FP+ L P+  GL G  F D
Sbjct: 604 --SGQIIRGFESNGIGPAETNGTTTEQLGGNYYAALKLDAEFPLGL-PDEYGLTGGAFYD 660

Query: 715 SATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
              ++  + A     L       R S G+ ++W SP G +   +  PL+    DK Q F 
Sbjct: 661 IGAIWDVNTAGATGTLSSTGFEDRHSIGLSLIWRSPFGPLRFNWSTPLKKEPTDKTQNFD 720

Query: 775 FRI 777
             I
Sbjct: 721 ISI 723


>gi|251790737|ref|YP_003005458.1| outer membrane protein assembly factor YaeT [Dickeya zeae Ech1591]
 gi|247539358|gb|ACT07979.1| outer membrane protein assembly complex, YaeT protein [Dickeya zeae
           Ech1591]
          Length = 805

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 212/811 (26%), Positives = 370/811 (45%), Gaps = 68/811 (8%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADGFLVKDIHFEGLQRVAVGAALLSMPVRVGDTVTDEDIGNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      L+I + ER  I  L FSGN  +K++ LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGDSLLIQVKERPTIASLTFSGNKAVKEEMLKENLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTLSNIEKGLEDFYYSVGKYSATVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK++S   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S
Sbjct: 183 VGNKSFSSDELISRFQLRDEVPWWNVVGDRKYEKQKLSGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTL----QEIQKKTLLSLIRIRSGNLYN 315
           +QV     K G  +   I EG  Y +  + ++  L     EI+      L RI+ G LYN
Sbjct: 243 TQVSLTPDKKGIYITINISEGNQYKLSGVMVRGNLVGHATEIE-----DLTRIQPGELYN 297

Query: 316 PQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
             ++    E I K        + RV T+   + A + V +   +D G+   V+R+  EGN
Sbjct: 298 GTKVTRMEEDIKKLLGRYGYAYPRVVTQPEINDADKTVRLNINVDAGNRFTVRRVRFEGN 357

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           D S DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   
Sbjct: 358 DVSKDSVLRREMRQMEGGWLGNDLVQQGKERLNRLGYFESVDTETQRVPGTPDQVDVVYK 417

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNY-TFSVED 494
           VK+ + GS+     +  + G+  +  +  +N+ G G    ++    R+  Q Y   S+ D
Sbjct: 418 VKERNTGSLNFGVGFGTESGISFQAGVQQDNWLGTGNSVGISG--TRNDYQTYIELSMTD 475

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQ 549
           PYF    +S G  +   + +    D++D +     A   +  PI E  + S +  L ++ 
Sbjct: 476 PYFTVDGVSLGGRIFYNNFKALDADLSDYTNQSYGAGTTLGFPINE--NNSLRVGLDYV- 532

Query: 550 YGAISEKEKIPSIYTTLIEHGKFSSHSISQSI-------------IYNTLDNPIVPRKGM 596
           + ++S+ +   +++  L + G     S + S               YN LD    P  G 
Sbjct: 533 HNSLSDMKPQVAMWRYLNKAGVDPDPSTTSSASFDANDFFLTSGWTYNNLDRGYFPTAGN 592

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFD 654
             + +      G D++Y+++   ++ ++ LS+  + V     + GY   + S K +  +D
Sbjct: 593 RANLNSKVTVPGSDNEYYKLTFDSASYFPLSESHNWVLMARTKAGYADGL-SGKEVPFYD 651

Query: 655 QFSVSSNYYLRGFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVS 695
            F    +  +RGF    IGP+                        A+GG   ++ASA + 
Sbjct: 652 NFFGGGSSSVRGFRSNTIGPKAAYYTNCANQSVSSCSIDGSKMSDAVGGNAMATASAELI 711

Query: 696 FPMPLVPER--AGLRGAFFVDSATLYANHVALGADKLEGNDSFW------RVSTGVEIMW 747
            P P + ++  + +R +FFVD+ T++  H    A  L      +      R+S+G+ + W
Sbjct: 712 VPTPFISDKYSSSVRTSFFVDAGTVWDTHWENTAQTLAAGVPDYSTPGNIRMSSGLAVQW 771

Query: 748 NSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            SPLG +   Y  P +  EGD+ +QF F IG
Sbjct: 772 MSPLGPLVFSYAQPFKKYEGDRSEQFQFNIG 802


>gi|300724786|ref|YP_003714111.1| putative outer membrane antigen [Xenorhabdus nematophila ATCC
           19061]
 gi|297631328|emb|CBJ92023.1| putative outer membrane antigen [Xenorhabdus nematophila ATCC
           19061]
          Length = 796

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 212/799 (26%), Positives = 370/799 (46%), Gaps = 53/799 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG +  YGS+  +VR I   G   V     L  +P+ VG  +SD D+   
Sbjct: 3   MKKLLIASLLFGSATAYGSDGFVVRDIHFEGLQRVTVGAALLNMPIRVGDPVSDEDISRT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSA 141
           +  ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +   R R  
Sbjct: 63  IHALFATGNFEDVRVLRDGNSLVVQVKERPTIASITFSGNKSVKDDMLKQNLEASRIRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D   ++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTMLSNIEKGLEDFYYSVGKYSAAVKAVVTPLPRNRVDLKLVFSEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK +S   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKAFSTNELLNYFQLRDDIPWWNMTADQKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + +   L   Q + +  L +I  G+LYN  E+
Sbjct: 243 TQVNLTPDKKGIYITVNITEGDQYKIAGVDLNGNLVGYQSQ-IAELTKIEPGSLYNGTEV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +    I          + RV T+   D A + V +   +D G+  YV++I   GND S 
Sbjct: 302 TKMETAIKNLLGRHGYAYPRVMTQPEIDDADKTVKLHVNVDAGNRFYVRKIRFSGNDVSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG  +   ++E+ K R+   GYF  V++         D V +   VK+ 
Sbjct: 362 DMVLRREMRQMEGAWLGSDLVEQGKERLNRLGYFESVDVDTERVPGSQDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           + GS+  +  +  + GM  +  +  +N+ G G    ++A    ++ ++   SV DPYF  
Sbjct: 422 NTGSMNFSVGFGTESGMSFQVGVQQDNWLGTGNSVAVSATKNDYS-KSADLSVTDPYFTV 480

Query: 500 SPISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQYGAIS 554
           + +S G  L  +     + D+++ +         +  P+ E+ S +F+  L ++ + ++S
Sbjct: 481 NGVSLGGRLFYSDFGAAAADLSNYTNKGYGTEGLLGFPLNENNSLNFR--LGYV-HNSLS 537

Query: 555 EKEKIPSIYTTLIEHG---------KFSSHSISQSI--IYNTLDNPIVPRKGMLISSSYD 603
                 +++  L + G         KF ++  + ++   YN+L+    P  G+  S    
Sbjct: 538 NMRPQAAMWRYLNKMGKNPGMDDKAKFDTNDFTMTVGWSYNSLNRGFFPTSGLRSSLDTK 597

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSN 661
               G  +Q++++   +S +Y L DD   V  G  R GYG      K +  ++ F    +
Sbjct: 598 VTIPGLSNQFYKVTWNSSGYYPLDDDHSWVLAGRSRLGYGGGF-GGKEMPFYENFYAGGS 656

Query: 662 YYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLVPER- 704
             +RGF    IGP+                   + A+GG   + AS  +  P P +  + 
Sbjct: 657 NSVRGFRSNNIGPKAIYLENGKEGIKPVKNSPSRDAVGGNAVAVASFELITPTPFLDAKY 716

Query: 705 -AGLRGAFFVDSATLYANHV----ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
              +R + FVD+ T++  +     A   D  + N+   RVS G+ + W SPLG + + Y 
Sbjct: 717 SNSVRTSVFVDAGTVWDTNWTKTYAGMPDYSKPNNI--RVSAGIALQWLSPLGPLSLSYA 774

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P++  EGD+ +QF F IG
Sbjct: 775 KPIKDYEGDRSEQFQFNIG 793


>gi|254294071|ref|YP_003060094.1| outer membrane protein assembly complex, YaeT protein [Hirschia
           baltica ATCC 49814]
 gi|254042602|gb|ACT59397.1| outer membrane protein assembly complex, YaeT protein [Hirschia
           baltica ATCC 49814]
          Length = 891

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 184/657 (28%), Positives = 329/657 (50%), Gaps = 36/657 (5%)

Query: 44  NTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVD 103
           N   +  I + G   +    ILS + V  G +     LD ++K ++A   F++V  +   
Sbjct: 36  NQEAISHIVVEGNQRIETRTILSYLLVEPGDNFDSERLDLSLKTLFATQLFADVLFEKNG 95

Query: 104 SVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASI 163
           S L++ + E  IIN + F GN++++DD+L     +     + +  V  DV  I +AY   
Sbjct: 96  SELVVRVSENPIINQVIFEGNSSIRDDKLTEETEAAPREVFTQARVQQDVQKILEAYRRA 155

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G     V   +  ++   +++ + I EG K  + SI F+GN+ +  ++L   +  R S +
Sbjct: 156 GRFAASVTPTYKPLAQNRVDLIFEITEGPKTGVKSINFIGNEVFKDSKLRSEVVTRQSRW 215

Query: 224 FS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQV--LFDKQKSGYVLIFQIDEG 280
           +  F   D +  +RM +D E +R FY + GYA  +V+S +  L   QK  Y + F IDEG
Sbjct: 216 WRVFESNDNFDPDRMEYDRELLRQFYTNEGYADFRVTSSIAELTPDQKDFY-MTFTIDEG 274

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
            +Y  G IS+++TL+++    L +++  R GNLY    I+++ E I+    S     V V
Sbjct: 275 PLYNFGEISVETTLEKLSTVRLKAIVPTREGNLYKADLIEDAVEAITFAAGSAGYASVDV 334

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
           K +I+RD   + V++ +++D+G  +YV+R++I GN Q+ D V+RREL L+EGD  N  ++
Sbjct: 335 KPQIDRDPETQKVNVTFVVDEGPRVYVERLDIVGNTQTLDHVVRRELLLAEGDAFNRILL 394

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
           ++++ RI + G+F +V I++ P +   D  I++V+V++   G +  +  Y       V  
Sbjct: 395 DQSRNRIRSLGFFKDVEITEEPGS-APDKTIVKVAVQEQPTGELAFSVGYSSADAFLVSV 453

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDL--QKTHLEDGSL 518
                NF G+G          ++  +NY F   +P F    ++AGFDL   KT+     L
Sbjct: 454 SATQRNFRGRGQSVTANIQSSQYQ-ENYEFRFTEPRFQDRNMAAGFDLYANKTNY----L 508

Query: 519 DINDES-----AAVRMIVPITESISTSFKY-----DLRFLQYGAISEKEKIPSIYTTLIE 568
           +I + S     A +R+  P+        +Y     DL+  Q  +   +  I S    L+ 
Sbjct: 509 NIANYSNSVIGAGLRVGFPLGNRTQLGLRYNLRQDDLQLAQTNSDGTRSTIESREQCLLT 568

Query: 569 H--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRA 620
           +        G+  + S+  S++ +  ++PI P  G  I+   D+AG GGD  Y +    A
Sbjct: 569 NSISICDQLGEQLTSSVGYSLVRDHRNDPIDPTGGYRITWQQDFAGLGGDVNYVKQELNA 628

Query: 621 SYFYLLSDDSDIVGSLRFGY--GCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           S +  ++    +   ++ GY  G    ++ ++++ ++F    N + RGF   G+GPR
Sbjct: 629 STYKGIAPGFTLTAGVKAGYIDGW---NDDSIRVNNRFYKGGNTF-RGFDTAGLGPR 681



 Score = 46.6 bits (109), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 17/112 (15%)

Query: 681 AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD--SATLYANHVALGAD---------- 728
           A+GGK Y+  +  +S P+P  PE  G+  A F +  S  L  +    G++          
Sbjct: 774 ALGGKAYAIGTVELSIPIPFAPEEMGIGAALFTEFGSVGLLDDIAKTGSNPTVETFGSTG 833

Query: 729 ----KLEGNDSF-WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
               +   +D+F  R S G+ + W+SP G +   +   L   E D+ + F F
Sbjct: 834 FALSETSIDDTFGLRASAGLSVFWDSPFGPIRFDFSEILASEEYDRTESFRF 885


>gi|291616353|ref|YP_003519095.1| YaeT [Pantoea ananatis LMG 20103]
 gi|291151383|gb|ADD75967.1| YaeT [Pantoea ananatis LMG 20103]
          Length = 811

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 212/813 (26%), Positives = 376/813 (46%), Gaps = 68/813 (8%)

Query: 22  SFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
           +  M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+
Sbjct: 8   TMAMKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDV 67

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS--- 138
            + +++++A G F +V++    + LI+ + ER  I  + FSGN  +KDDQLK  + +   
Sbjct: 68  RNTIRSLFATGNFEDVQVLRDGNTLIVQVKERPTIASITFSGNKAVKDDQLKQNLEASGV 127

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R   A D  T+++    ++  Y S+G     VK     +    +++  V  EGV AKI  
Sbjct: 128 RVGEALDRTTISSIEKGLEDFYYSVGKYTASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQ 187

Query: 199 IRFVGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  VGNK +S   L     +R    +++      Y K++++ D E +R+FY DRGYA   
Sbjct: 188 INIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFN 247

Query: 258 V-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNP 316
           + S+QV     K G  +   I EG+ Y +  + +  ++       +  L +I +G LYN 
Sbjct: 248 IDSTQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAG-HSAEIEHLTKIPAGELYNG 306

Query: 317 QEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGND 376
            ++    + I K        + RV T+   + A + V +   +D G+  YV+++  EGND
Sbjct: 307 TKVTSMEDDIKKLLGRYGYAYPRVVTQPEINDADKTVKLHINVDAGNRYYVRKVRFEGND 366

Query: 377 QSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSV 436
            S D+V+RRE+   EG  +   ++++ K R+  TGYF  V++         D V +   V
Sbjct: 367 TSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKV 426

Query: 437 KQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDP 495
           K+ + G+      Y  + G+  +  +  +N+ G G    ++    ++  Q Y  FS+ DP
Sbjct: 427 KERNTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISGT--KNDYQTYAEFSLTDP 484

Query: 496 YFLGSPISAG------------FDL----QKTHLEDGSLDIN-DESAAVRMIVPITESIS 538
           YF    +S G             DL     +++  DG+L    +E+ ++R+ +    +  
Sbjct: 485 YFTVDGVSLGGRVFYNNFKASNADLSGYTNRSYGTDGTLGFPINENNSLRVGLGYVHNDL 544

Query: 539 TSFKYDLRFLQY-GAISEKEKIPSIYTTLIEHGKFSSH--SISQSIIYNTLDNPIVPRKG 595
           +  +  +   +Y  ++ + +++ S       +G FS+   + +    YNTLD       G
Sbjct: 545 SDMRPQVAMWRYLDSVGKPQQLNS-------NGDFSADDFTFNYGWTYNTLDRGFFATSG 597

Query: 596 MLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLF 653
              + +      G D+Q++++   +  +  ++ D    ++G  R GYG  I S K +  +
Sbjct: 598 NRTNLNGKVTIPGSDNQFYKMTLDSQQYVPINKDHTWVVLGRGRVGYGDGI-SGKEMPFY 656

Query: 654 DQFSVSSNYYLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAV 694
           + F    +  +RGF    IGP+                        AIGG   + AS  +
Sbjct: 657 ENFYAGGSSTVRGFQSNTIGPKAAYLNNGSSYCNLSDPNGICKSSDAIGGNAMAIASLEL 716

Query: 695 SFPMPLVPER--AGLRGAFFVDSATLY-------ANHVALGADKLEGNDSFWRVSTGVEI 745
             P P + E+    +R + FVD+ T++       A   A G       ++  RVSTGV +
Sbjct: 717 ITPTPFLSEKYSNSVRTSLFVDAGTVWDTKWQNTAETRAAGIPDYSDPNNI-RVSTGVSL 775

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            W SPLG +   Y  P++  EGDK +QF F IG
Sbjct: 776 QWMSPLGPLVFSYAQPVKKVEGDKSEQFQFNIG 808


>gi|327392805|dbj|BAK10227.1| outer membrane protein assembly factor YaeT precursor [Pantoea
           ananatis AJ13355]
          Length = 803

 Score =  264 bits (675), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 212/810 (26%), Positives = 375/810 (46%), Gaps = 68/810 (8%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDVRNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           +++++A G F +V++    + LI+ + ER  I  + FSGN  +KDDQLK  + +   R  
Sbjct: 63  IRSLFATGNFEDVQVLRDGNTLIVQVKERPTIASITFSGNKAVKDDQLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G     VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYTASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK +S   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + +  ++       +  L +I +G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAG-HSAEIEHLTKIPAGELYNGTKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               + I K        + RV T+   + A + V +   +D G+  YV+++  EGND S 
Sbjct: 302 TSMEDDIKKLLGRYGYAYPRVVTQPEINDADKTVKLHINVDAGNRYYVRKVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D+V+RRE+   EG  +   ++++ K R+  TGYF  V++         D V +   VK+ 
Sbjct: 362 DAVLRREMRQMEGAWLGSDLVDQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + G+      Y  + G+  +  +  +N+ G G    ++    ++  Q Y  FS+ DPYF 
Sbjct: 422 NTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISGT--KNDYQTYAEFSLTDPYFT 479

Query: 499 GSPISAG------------FDL----QKTHLEDGSLDIN-DESAAVRMIVPITESISTSF 541
              +S G             DL     +++  DG+L    +E+ ++R+ +    +  +  
Sbjct: 480 VDGVSLGGRVFYNNFKASNADLSGYTNRSYGTDGTLGFPINENNSLRVGLGYVHNDLSDM 539

Query: 542 KYDLRFLQY-GAISEKEKIPSIYTTLIEHGKFSSH--SISQSIIYNTLDNPIVPRKGMLI 598
           +  +   +Y  ++ + +++ S       +G FS+   + +    YNTLD       G   
Sbjct: 540 RPQVAMWRYLDSVGKPQQLNS-------NGDFSADDFTFNYGWTYNTLDRGFFATSGNRT 592

Query: 599 SSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQF 656
           + +      G D+Q++++   +  +  ++ D    ++G  R GYG  I S K +  ++ F
Sbjct: 593 NLNGKVTIPGSDNQFYKMTLDSQQYVPINKDHTWVVLGRGRVGYGDGI-SGKEMPFYENF 651

Query: 657 SVSSNYYLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAVSFP 697
               +  +RGF    IGP+                        AIGG   + AS  +  P
Sbjct: 652 YAGGSSTVRGFQSNTIGPKAAYLNNGSSYCNLSDPNGICKSSDAIGGNAMAIASLELITP 711

Query: 698 MPLVPER--AGLRGAFFVDSATLY-------ANHVALGADKLEGNDSFWRVSTGVEIMWN 748
            P + E+    +R + FVD+ T++       A   A G       ++  RVSTGV + W 
Sbjct: 712 TPFLSEKYSNSVRTSLFVDAGTVWDTKWQNTAETRAAGIPDYSDPNNI-RVSTGVSLQWM 770

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           SPLG +   Y  P++  EGDK +QF F IG
Sbjct: 771 SPLGPLVFSYAQPVKKVEGDKSEQFQFNIG 800


>gi|30249672|ref|NP_841742.1| surface antigen (D15) [Nitrosomonas europaea ATCC 19718]
 gi|30180709|emb|CAD85621.1| Bacterial surface antigen (D15) [Nitrosomonas europaea ATCC 19718]
          Length = 758

 Score =  264 bits (674), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 204/773 (26%), Positives = 356/773 (46%), Gaps = 37/773 (4%)

Query: 24  QMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           ++ F+ILF++++ L  +  +++ +VR I + G        + S +PV VG  +       
Sbjct: 2   KLRFLILFFSLYSLGCM-ANDSLVVRDIRVEGIQRTEAGTVFSYLPVKVGDVLDSKKASA 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA 143
           A+K +YA G+FS+VK+K    +LI+ + ER  I  +  +G      D+LK  ++    + 
Sbjct: 61  AIKALYATGFFSDVKLKSEGGLLIVQVQERPAIAQISINGAKEFDKDKLKEGLKQAGLSE 120

Query: 144 ---YDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +    +      +K+ Y S G   V +      +    + I + I+EG  A+I  I 
Sbjct: 121 SRIFSRSLLEKAEQELKRQYISRGKYAVKITTTTTPLERNRIGINFDIKEGKTARIKQIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV- 258
            VGN  +    L  + S++T G+ + F K D YSK+++S D E +R++Y DRGY    + 
Sbjct: 181 IVGNHVFPEDDLVDLFSLKTPGFMTWFTKDDQYSKQKLSADLETLRSYYLDRGYLEFNIE 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
           S+QV          +   + EG  YTV +I +   L  + ++ L  LI++  G ++  ++
Sbjct: 241 STQVSITPDMKDIYITVNVTEGPQYTVSDIKLAGELL-VPEEELRKLIKLEPGGIFVREK 299

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + ES + IS    +    F  V      D   R     + ID G  +YV+RI I GN+++
Sbjct: 300 LTESIKLISDRLGNDGYAFANVNASPELDKETRKTAFTFFIDPGRRVYVRRINISGNERT 359

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D VIRRE    EG   +   I R+++R+    +F+ VNI   P  DV D V + V+V +
Sbjct: 360 RDEVIRREFRQMEGGWHSTEQINRSRQRVDRLDFFTGVNIETPPVADVPDQVDINVNVVE 419

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
              G++     Y   +G+ + G I  NN  G G    L    G    +  + S  +PY+ 
Sbjct: 420 KPTGAIMFGAGYSDREGIILNGSIAQNNILGTGNFLSLQVNTG-SVNKVISASFNNPYYT 478

Query: 499 GSPISAGFDLQKTHLEDGSL------DINDESAAVRMIVPITES--ISTSFKYDLRFLQY 550
            + +S G +  K  +   SL      + +   A +R  +P+ E+  +S    Y     ++
Sbjct: 479 INGVSLGLEAFKRDINTRSLSSVGMFNTDTTGANIRFGIPVAENDIVSLGLGY-----EH 533

Query: 551 GAISEKEKIPSIYTTLIEH-GKFSSH-SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
             I  ++  P  +   ++  GK S++  I+ S   +  ++ I    GM   +   +  FG
Sbjct: 534 TKIDLRDDSPQRFKDFVDQFGKTSNNLPITLSWARDRRNSAIWTTSGM---TQRLFGEFG 590

Query: 609 ---GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
              GD  Y+++     +F+ ++    ++ +   G G    S+K L  F  F       +R
Sbjct: 591 LPFGDLNYYKVSYEQRWFFPVTKMFTLMLNGEVGVGDGY-SDKPLPFFKNFFAGGFNSVR 649

Query: 666 GFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAL 725
           G+    +GPR      +GG      +  V FP+P + E   +R + F D  T+  +   L
Sbjct: 650 GYNINTLGPRDSDDRVLGGSKRIVGNIEVLFPVPFMKEDKSVRLSAFADGGTIVNSFSGL 709

Query: 726 GADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G D        +R S G+   W SP+G +      PL ++ GDK+Q+F F+ G
Sbjct: 710 GFDD-------FRYSAGLAATWISPMGPLKFSVAQPLNNQSGDKLQRFQFQFG 755


>gi|37524681|ref|NP_928025.1| outer membrane protein assembly factor YaeT [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|81420298|sp|Q7N8N9|YAET_PHOLL RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|36784106|emb|CAE12975.1| Probable outer membrane protein precursor YaeT [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 797

 Score =  263 bits (673), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 212/799 (26%), Positives = 364/799 (45%), Gaps = 52/799 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG +  YG++  +V+ I   G   V     L  +PV VG ++SD D+   
Sbjct: 3   MKKLLIASLLFGSATAYGADGFVVQDIHFEGLQRVAVGAALLNMPVRVGDTVSDEDIGRT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           +  ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IHALFATGNFEDVRVLRDSNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASHVRIG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D   ++     ++  Y S+G  N  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTMLSNIERGLEDFYYSVGKYNASVKAVVTPLPRNRVDLKLVFAEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK++S   L     +R    +++      Y K++++ D EA+R+FY DRGYA   + S
Sbjct: 183 VGNKSFSSDELLNRFQLRDDVPWWNLTADQKYQKQKLTGDLEALRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  I +   +   Q + +  L  I  G+LYN  ++
Sbjct: 243 TQVSLTPDKKGIYVTINITEGDQYKISGIDLNGNMAGYQSE-ITKLAAIEPGSLYNGTQV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +    I          + RV T+   +   + V +   ID G+  YV++I   GND + 
Sbjct: 302 TKMENDIKNLLGRYGYAYPRVMTQPEINDQGKTVKLHVNIDAGNRFYVRKIRFSGNDTTK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   E   +   +IE  K R+   GYF  V++         D V +   VK+ 
Sbjct: 362 DSVLRREMRQMERAWLGSDLIELGKERLNRLGYFETVDVETQRVPGSPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     +  + G+  +     +N+ G G    + A   ++    Y   S  DPYF 
Sbjct: 422 NTGSLNFGVGFGTESGVSFQIGAQQDNWLGTGNSVGVNA--SKNDYSTYAELSFTDPYFT 479

Query: 499 GSPISAGFDL--QKTHLEDGSLD-INDESAAVRMIV--PITESISTSFKYDLRFLQYGAI 553
            + +S G  +       +D  L    ++S  +   +  PI E  + S ++ L ++ + ++
Sbjct: 480 VNGVSLGGRVFYNDFRADDAELSGYTNQSYGIDGFLGFPINE--NNSLRFGLNYV-HNSL 536

Query: 554 SEKEKIPSIYTTLIEHG-----------KFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
           S+     +++  L   G           K    +++    YN LD    P  G+  + + 
Sbjct: 537 SDMLPQAAMWRYLNSMGEKPDYKSKAEFKADDFALNVGWTYNNLDRGFFPTSGVKSTLNG 596

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++++++    S +Y ++DD    I+G  R GYG  +   K L  ++ F    
Sbjct: 597 KVTIPGSDNEFYKVTFDTSAYYPINDDRTWVILGRSRLGYGDGL-GGKELPFYENFYAGG 655

Query: 661 NYYLRGFAYKGIGPRV-------DKKY------AIGGKIYSSASAAVSFPMPLVPER--A 705
           +  +RGF    IGP+        D K       A+GG   + AS  +  P P +  +   
Sbjct: 656 SSTVRGFRSNNIGPKAIYMNGKDDPKKDSPSRDAVGGNAMAVASLELITPTPFLDSKYSN 715

Query: 706 GLRGAFFVDSATLYANH----VALGADKLE--GNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            +R +FF+DS T++  +     A+    +   G     RVS G+ + W SPLG +   Y 
Sbjct: 716 SVRTSFFIDSGTVWDTYWNDSAAMKGSGIPDYGKPGNIRVSAGIALQWVSPLGPLVFSYA 775

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P++  EGD+ +QF F IG
Sbjct: 776 KPIKDYEGDRSEQFQFNIG 794


>gi|307293413|ref|ZP_07573259.1| outer membrane protein assembly complex, YaeT protein [Sphingobium
           chlorophenolicum L-1]
 gi|306881479|gb|EFN12695.1| outer membrane protein assembly complex, YaeT protein [Sphingobium
           chlorophenolicum L-1]
          Length = 884

 Score =  263 bits (673), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 207/842 (24%), Positives = 371/842 (44%), Gaps = 118/842 (14%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           +R I + G   +  + +LS   + +GQ  +   LD A++++Y    F++V+I+  +  L 
Sbjct: 51  IRDISVTGQQRLEPDTVLSYTKLRIGQPFTQESLDQALRDLYETELFADVQIRNDNGALT 110

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLN 167
           +++ E  +IN +   GN  LK+D+++  ++      Y    V ADV  I + Y   G   
Sbjct: 111 VEVKENPVINRIVLEGNKRLKEDKIRPEIKLAPRQIYTRSKVRADVARIIELYRRQGRFA 170

Query: 168 VMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFS-F 226
             V+ +   +    ++I + I EG K+K+  I  +GN+ +    L   +  + S +F  F
Sbjct: 171 ATVEPKMVQLDQNRVDIVFEISEGPKSKVRQINIIGNEKFKDGELRGQMVTKQSRWFRIF 230

Query: 227 GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEGEIYTV 285
                Y  +R+++D++ +R FY   GYA  +V S V      K  +++ + ++EG+ Y  
Sbjct: 231 SSGTSYDPDRLAYDQQKLRQFYLTEGYADFRVISAVAELTPDKQDFIITYVVEEGQRYKF 290

Query: 286 GNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRIN 345
           GN+ + S ++++   +L  ++ ++ G+ YN ++++++ + +S+        F  V+    
Sbjct: 291 GNVKVNSDIRDLSGDSLTKMLPMKKGDWYNAKQVEDTVDTLSETAGLFGYAFADVQPDFQ 350

Query: 346 RDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKR 405
           RD     + I++ I     +YV+R++I GN  + D V+RRE  L+EGD  N  +++R+K 
Sbjct: 351 RDKDTLTMGIDFRIANAPRVYVERVDINGNTLTQDKVVRREFRLAEGDAFNSFLVKRSKD 410

Query: 406 RIMATGYFSE-VNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDD 464
           RI + G+F E +++ Q P +   D ++L  +V++ S G + ++  +   +   V   I  
Sbjct: 411 RINSLGFFQEKLDVEQKPGS-APDRIVLETNVQEKSTGELSLSAGFSSLERFIVSASITQ 469

Query: 465 NNFFGQGYRARLAAGFGRHAVQNYTFSVE----DPYFLGSPISAGFDLQKTHL------- 513
            NF G+G   R +  +       Y+ SVE    +PYF+   I+ G D+ +  L       
Sbjct: 470 RNFRGKGQELRTSVNY-----SAYSKSVEVGFTEPYFMDKNIALGGDIYRRDLNSFRYLN 524

Query: 514 ---EDGSLDINDESAAVRMIVPITESISTSFKYDLRF--------LQYGAISEKEKIPSI 562
               D + + +     +R  VPITE +S + +Y L            Y        +   
Sbjct: 525 NNDRDTTYEQSTTGFQLRAGVPITEYMSLALRYTLNLDDVTLDKDTYYSDPDGAGPLGLQ 584

Query: 563 YTTLIEH-------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
              L+         GK ++ S+  S+IY+T DN I P +G  +  S D AG GG  +Y R
Sbjct: 585 CDPLLAGRYLCDAIGKRTTSSLGYSLIYDTRDNRIRPTRGHNVVLSQDLAGLGGSVKYVR 644

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPS------NKNLQLFDQFSVSSNYYL----- 664
               AS ++ L   S  + S+  G G  I S      + +  L D   ++  ++L     
Sbjct: 645 TRLNASKYWPLG--SGFIFSIS-GEGGYIHSLEGDRRDASGALVDPIRLTDRFFLGEPQI 701

Query: 665 RGFAYKGIGPRVDKKY---------------------AIGGKIYSSASAAVSFPMPLVPE 703
           RGF  +GIGPRV + Y                     A+GG++Y  A A V  P+     
Sbjct: 702 RGFNIRGIGPRVKRWYLTQDSTGAYVRQSGNSNVSDDALGGRMYYMARAEVEIPLGSGAR 761

Query: 704 RAGLRGAFFVDSATL--------------YANHVALGADKLEGNDSFW------------ 737
             GLR + F+D+  +                 ++A G      +D               
Sbjct: 762 EMGLRPSVFLDAGAVAGLRNPQVTGHSPGVCANIATGQRTQAVSDGICPGNNATDPTQNT 821

Query: 738 -------------------RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                              RVS G  + WNSP G   +     L    GD  +   F +G
Sbjct: 822 HTLIIGPFEEEYLGDTLKPRVSVGFGVNWNSPFGPFRIDIAKALLKEPGDDTKLITFNVG 881

Query: 779 NR 780
            +
Sbjct: 882 TQ 883


>gi|254475738|ref|ZP_05089124.1| outer membrane protein assembly complex, YaeT protein [Ruegeria sp.
           R11]
 gi|214029981|gb|EEB70816.1| outer membrane protein assembly complex, YaeT protein [Ruegeria sp.
           R11]
          Length = 782

 Score =  263 bits (672), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 194/750 (25%), Positives = 349/750 (46%), Gaps = 24/750 (3%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           +++ G   +    I++   +  G+S+S  +L+ A + I   G F +V+I    + L+I +
Sbjct: 38  VQVEGNQRIQTSTIVAYTGIERGKSVSAGELNDAYQRILDSGVFESVEIVPRGNTLVIKV 97

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   I+ + F GN  +KDD L  ++ S     ++      D   + +AY + G L   V
Sbjct: 98  TEFPTISRISFEGNRRIKDDALLALIESSPRRVFNPTVAERDAAALAEAYGAQGRLASTV 157

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + I EG   ++  + FVGN+ +S  RL RV+  + +G   +F + 
Sbjct: 158 TPRIIRRSDNRVDLVFEISEGDTTEVERVSFVGNRVFSDRRLRRVLETKQAGLLRTFIRA 217

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D   ++R+ FD + +R FY  RGY  V+V S+     +++ G  L+  I EG+ +T G I
Sbjct: 218 DTLIEDRLQFDRQVLRDFYLSRGYVDVRVNSTNAEVTEERDGVFLVVDITEGQQFTFGEI 277

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           S+ S + E        ++R+R G +YNP  ++ +  ++          F+R + R+ R+ 
Sbjct: 278 SVTSEMSEADADEFREVLRLRPGVVYNPALVENAITRLETLAIRKGIDFLRAEPRVTRND 337

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+E+++ +G  ++V+RI+IEGN  + D VIRR+    EGDP N   I  +  RI 
Sbjct: 338 RDLTLDVEFVLTRGPRVFVERIDIEGNTTTLDRVIRRQFRTVEGDPFNPREIRESAERIR 397

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+F    +     +  S+ V+    V+Q   GS+ +   Y VD G G+   + +NNF 
Sbjct: 398 ALGFFETAEVEVREGSSPSEVVVDVDVVEQ-PTGSLSLGGAYSVDDGFGLALGLSENNFL 456

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVR 528
           G+G R        + A + YT    +P+ LG  +    DL     +    + + + A   
Sbjct: 457 GRGQRLSFNISTAQDA-EEYTLGFTEPFLLGRDLRFDLDLGLAETDSSFSEYDTKRAFFS 515

Query: 529 MIVPITESISTSFK----YDL-RFLQYGAISEKEKIPS-IYTTLIEHGKFSSHSISQSII 582
             +    S ST  +    +D+   +  G  +    +   +  + I  G+ ++ +I  +  
Sbjct: 516 PALTFNTSESTRLQVRYTWDMDEMISRGNDTNGTPLAGPVVRSEIAQGEQNASTIGFTYT 575

Query: 583 YNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR-ASYFYLLSDDSDIVGSLRFGYG 641
           Y++  N +   +  L     DYAG GGD +Y R  ++  +   +L+D+  +  ++  G  
Sbjct: 576 YDSRLNGLDSNRSFLFEVGADYAGLGGDQEYVRTTAKIVAQRRILNDEVTLRATIEAG-A 634

Query: 642 CVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYA--------IGGKIYSSASAA 693
                +   +  D+F +S +  LRGF   G+GPR              +GG  Y+ A   
Sbjct: 635 FSWQGDGFSRSIDRFVLSPS-ILRGFEPGGVGPRDQSSNGAGGNYNDFLGGNYYAVARLD 693

Query: 694 VSFPMPLVPERAGLRGAFFVDSATLYA-NHVALGADK-LEGNDSFWRVSTGVEIMWNSPL 751
             FP+ L PE  GLRG  F D   L+  N+   GA   + G +  +R   G  ++W +  
Sbjct: 694 AEFPLGL-PEEIGLRGGLFYDVGNLWGLNNANTGASSAIVGREGSFRHVVGFSLLWTTGF 752

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           G +   +   L+  + D+ Q F   +  R 
Sbjct: 753 GPLRFNFSKALKKEDFDEEQNFDLTLQARF 782


>gi|320540039|ref|ZP_08039695.1| outer membrane protein assembly factor [Serratia symbiotica str.
           Tucson]
 gi|320029888|gb|EFW11911.1| outer membrane protein assembly factor [Serratia symbiotica str.
           Tucson]
          Length = 801

 Score =  263 bits (672), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 208/802 (25%), Positives = 365/802 (45%), Gaps = 54/802 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I+D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTITDDDIGNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDCNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +++  L     +R    +++      Y K+++S D E +R+FY DRGYA   + S
Sbjct: 183 VGNHAFTNDELISRFQLRDEVPWWNLVGDRKYQKQKLSGDLENLRSFYLDRGYACFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   + EGE Y +  + +   L     +    L +I  G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITINMTEGEQYKLSEVVVNGNLAG-HSQEAAQLTKIEPGELYNGGKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               + I          + RV T+   +   + V +   +D G+  YV+RI+ EGN+ S 
Sbjct: 302 TNMEDNIKTMLGRYGYAYPRVATQPEINDQDKTVKLNVNVDAGNRFYVRRIKFEGNNTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +    +E+ K R+   GYF  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNVQVEQGKERLNRLGYFETVDVETQRVPSSADQVDVIYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS      Y  + G+  +  +  +N+ G GY   +     ++  Q YT  SV DPYF 
Sbjct: 422 NTGSFNFGIGYGTESGVSFKMGMQQDNWLGTGYSVGING--SKNNYQTYTELSVTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDIND---ESAAV--RMIVPITESISTSFKYDLRFLQYGAI 553
              +S G  +   + +  + D++D   +S  V   +  PI E  + S +  L ++  G  
Sbjct: 480 MDGVSLGGRVFYNNFKADNADLSDYTNKSYGVDGTLGFPINE--NNSLRSCLGYVHNGLS 537

Query: 554 SEKEKIP--------SIYTTLIEHGKFSSHSISQSI--IYNTLDNPIVPRKGMLISSSYD 603
           + + +I          +    ++   +S+   + ++   +N LD    P  G   + +  
Sbjct: 538 NMQPQIAMWRYLKSVGMEPNTVDRASYSADDFTLNLGWTHNDLDRGYFPTSGNRTTLNGK 597

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSSN 661
               G D++Y+++   +  +  +++D    ++G  R  Y   +   K    ++ F    +
Sbjct: 598 VTIPGSDNKYYKVTLDSVQYVPINNDHTWVLLGRGRLSYADGL-GGKETPFYENFYAGGS 656

Query: 662 YYLRGFAYKGIGPR-----------------VDKKYAIGGKIYSSASAAVSFPMPLVPER 704
             LRGF    IGP+                  +   A+GG   + AS  +  P P + E+
Sbjct: 657 STLRGFQSNTIGPKAVYYNSHSHSCADKTKICNSDNAVGGNAMAVASLELITPTPFISEK 716

Query: 705 AG--LRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEIMWNSPLGMMGV 756
               +R + F+D+ T++       AD L+         S  R S GV + W SPLG +  
Sbjct: 717 YANLVRTSLFLDTGTVWDTKWQNTADTLKYDVPDYNKVSNIRASFGVALQWMSPLGPLVF 776

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  PL+  +GDK +QF F IG
Sbjct: 777 SYAKPLKKHDGDKSEQFQFNIG 798


>gi|163736302|ref|ZP_02143721.1| surface antigen (D15) [Phaeobacter gallaeciensis BS107]
 gi|163741169|ref|ZP_02148561.1| outer membrane protein, OMP85 family [Phaeobacter gallaeciensis
           2.10]
 gi|161385522|gb|EDQ09899.1| outer membrane protein, OMP85 family [Phaeobacter gallaeciensis
           2.10]
 gi|161390172|gb|EDQ14522.1| surface antigen (D15) [Phaeobacter gallaeciensis BS107]
          Length = 765

 Score =  263 bits (672), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 196/755 (25%), Positives = 349/755 (46%), Gaps = 33/755 (4%)

Query: 51  IEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDL 110
           +++ G   +    I++   +  G+S+S   L+ A + I   G F +V+I    + L+I +
Sbjct: 20  VQVEGNQRIQTSTIVAYTGIERGKSVSAGQLNDAYQRILDSGVFESVEIVPQGNTLVIKV 79

Query: 111 IERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMV 170
            E   IN + F GN  +KDD +  ++ S     ++      D  N+ +AY + G L   V
Sbjct: 80  TEFPTINKISFEGNRRIKDDAMLALIESAPRRVFNPTVAERDASNLAEAYGAQGRLASTV 139

Query: 171 KVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKT 229
             +    S   +++ + I EG   ++  + FVGN+ YS  RL RV+  + +G   +F + 
Sbjct: 140 TPRIIRRSDNRVDLVFEISEGDTIEVERVSFVGNRVYSDRRLRRVLETKQAGLLRTFIRA 199

Query: 230 DVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNI 288
           D   ++R+ FD++ +R FY  RGY  V++ S+     +++    L+  I EG+ +  G I
Sbjct: 200 DTLIEDRLEFDKQVLRDFYLSRGYVDVRINSTNAEVTEERDAAFLVVDITEGQQFEFGEI 259

Query: 289 SIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDF 348
           S+ S + E        ++++R G  Y+P  I+ +  ++  +       F+RV+ RI+R+ 
Sbjct: 260 SVTSEMSEADADEFRKVLKVRPGVTYSPSVIENAIRRLETFAIRKGIDFLRVEPRISRND 319

Query: 349 AKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIM 408
               +D+++++ +G  ++V+RI+IEGN  + D VIR++    EGDP N   I  +  RI 
Sbjct: 320 RDLTLDVDFVLTRGPRVFVERIDIEGNTTTLDRVIRQQFRTVEGDPFNPREIRESAERIR 379

Query: 409 ATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFF 468
           A G+F    +         + V+     ++   G++ +   Y V+ G G+   + +NNF 
Sbjct: 380 ALGFFETAEVDVREGGSAGEVVVDVDVEEK-PTGALSLGGAYSVNDGFGISLGLSENNFL 438

Query: 469 GQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLE-DGSLDINDE---- 523
           G+G R        + A + YT    +PY LG  +   FDL   + E D S  + D     
Sbjct: 439 GRGQRLSFNISTAQDA-EEYTLGFTEPYLLGRDLR--FDLDLGYAETDSSFALYDTKRAF 495

Query: 524 -SAAVRMIVPITESISTSFKYDL-RFLQYGAISEKEKIPS-IYTTLIEHGKFSSHSISQS 580
            S A+        ++   + +D    +  G  S    +   +  + I  G  ++ +I  +
Sbjct: 496 FSPALTFQTSENSNLQVRYTWDEDEMISRGDDSSGFPLAGPLVRSEINQGAINASTIGFT 555

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFY---LLSDDSDIVGSLR 637
              ++  N + P  G LI    DYAG GGDS+Y R  S A +     + +++  +  ++ 
Sbjct: 556 YTVDSRLNGLDPNSGYLIQVGADYAGLGGDSEYLR--STAKFIAQRRVFNEEVTLRATIE 613

Query: 638 FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYA--------IGGKIYSS 689
            G       +   +  D+F +S +  LRGF   GIGPR              +GG  Y++
Sbjct: 614 AG-AFSWQGDGFSRSIDRFVLSPS-ILRGFEPGGIGPRDQSPNGSGGNYNDFLGGNYYAA 671

Query: 690 ASAAVSFPMPLVPERAGLRGAFFVDSATLYA-NHVALGA--DKLEGNDSFWRVSTGVEIM 746
           A     FP+ L PE  GLRG  F D   L+  N+   GA    + G    +R   G  ++
Sbjct: 672 ARFDAEFPLGL-PEEIGLRGGLFYDVGNLWGLNNADTGAAGGNIVGRGGSYRHVVGFSLL 730

Query: 747 WNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           W +  G +   +   L+  + D+ Q F   +  R 
Sbjct: 731 WTTGFGPLRFNFSKALKKEDFDQEQSFDLTLQARF 765


>gi|257094436|ref|YP_003168077.1| outer membrane protein assembly complex, YaeT protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046960|gb|ACV36148.1| outer membrane protein assembly complex, YaeT protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 766

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 207/752 (27%), Positives = 356/752 (47%), Gaps = 33/752 (4%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V+ I + G   V    + S +PV VG++++D     A+K ++A G+F +V+I++  SVLI
Sbjct: 26  VKDIRVEGIQRVEAGTVFSYLPVKVGETMTDEKAAQAIKALFATGFFKDVRIEVDGSVLI 85

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASIG 164
           + L ER  I  + F G      DQL   ++    AA   +D  T+      +K+ Y + G
Sbjct: 86  VVLEERPAIAQIDFVGLKEFDKDQLLKGLKEVGIAASRTFDRATLEKAEQELKRQYLARG 145

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF 224
              V +      +    + I + I+EG  A+I  I  VG + +    L  V+ +RT  + 
Sbjct: 146 RYAVAITTTITPLDRNRVAINFNIDEGEAARIKQINIVGAQAFKEKELVGVMQLRTPNWI 205

Query: 225 S-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           S + K+D YSK+++S D E +R++Y DRGY    V S+QV     K    +   I+EGE 
Sbjct: 206 SWYTKSDQYSKQKLSADLETLRSYYLDRGYLEFSVESTQVSISPDKKDIYITVSINEGER 265

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           + V ++ +   L  + ++     ++I++G++++ +++ ES++ I+    +    F  V  
Sbjct: 266 FMVSSVKLAGELI-LSEEEFRKAVKIKAGDVFSREKLNESTKAIADKLGAQGYAFANVNA 324

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
               D  KR V     +D G   YV+R+ I GN ++ D VIR+E+   EG   +   +  
Sbjct: 325 APELDKEKRQVAFTIFVDPGKRAYVRRVNITGNTKTRDEVIRQEMRQMEGAWYDAERVSA 384

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           ++ RI  TGYF+EVN+   P     D V + V+V + S G++ I   Y   + + + G I
Sbjct: 385 SRERIDRTGYFAEVNVETPPVPGTIDLVDVNVNVTEKSTGNISIGAGYSSAEKVILSGSI 444

Query: 463 DDNNFFGQGYRARLAAGFG---RHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLD 519
             +N FG G    L    G   R    NYT    +PYF    IS GFDL    L   SL 
Sbjct: 445 SQSNIFGSGKFLSLQVNTGKLNRTLGINYT----NPYFTVDGISQGFDLYDRKLNPTSLG 500

Query: 520 INDES----AAVRMIVPITE--SISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFS 573
              +S      +R   PI E  ++S     D   +    I+             EHG  S
Sbjct: 501 YAFQSHSTGGGIRFGFPIDEKDTLSVGLAVDQTTIDITPITPGVTPVQYIKFQAEHGD-S 559

Query: 574 SHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           + ++  ++ +  +T ++ I    G +  +  ++A  G D  ++R+  +   F+ L+ D  
Sbjct: 560 NITVPATVGWTRDTRNSSIYTTSGGIQRAGLEWAIPGADLTFYRLTYQNQQFFSLAKDVV 619

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR--VDKKYAIGGKIYSS 689
           ++ +  FGY   +   + L  +  F       +RG+    +GP    +    +GG   + 
Sbjct: 620 LMLNAEFGYANGL-QGQTLPFYKNFFAGGVNSVRGYDTASLGPVEITNPDTRLGGTRKAV 678

Query: 690 ASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKL--EGNDSFWRVSTGVEIMW 747
            +A +  P+P + ++A   G FF D+  ++ ++ A+ +     EG     R S G+   W
Sbjct: 679 FNAEILMPIPGM-DKAFRIGPFF-DAGNVFTDNNAVPSYTYSKEG----LRYSAGLAAAW 732

Query: 748 NSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
            SPLG +   YG PL  +  DK+Q+F F++G 
Sbjct: 733 ISPLGPLKFSYGQPLNEQSNDKLQKFQFQLGT 764


>gi|238026911|ref|YP_002911142.1| outer membrane protein, OMP85 family protein [Burkholderia glumae
           BGR1]
 gi|237876105|gb|ACR28438.1| Outer membrane protein, OMP85 family protein [Burkholderia glumae
           BGR1]
          Length = 768

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 198/781 (25%), Positives = 369/781 (47%), Gaps = 66/781 (8%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A+ GL+A + +   +V+ I+I G   V    + + +P+  G + +D     A++ +YA G
Sbjct: 18  AVHGLAA-HATTPFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATG 76

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTV 149
           +F++VKI    +V+I+ + ER  I+ + F+G      D L   +++   +    YD+  V
Sbjct: 77  FFNDVKIATQGNVVIVQVQERPAISSIDFTGIKEFDKDNLLKALKAVGLSQGRYYDKSLV 136

Query: 150 NADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSH 209
           +     +K+ Y + GY    V      +    ++I + + EG  AKI  I F+GNK +S 
Sbjct: 137 DKAEQELKRQYLTRGYYAAEVTTTVTPVDANRVSILFSVAEGPSAKIRQINFIGNKTFSS 196

Query: 210 ARLERVISIRTSGYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQ 267
           + L   + + T  +FS + K D+YSKE+++ D E +R++Y +RGY    + S+QV     
Sbjct: 197 STLRNEMQLSTPNWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIDSTQVSISPD 256

Query: 268 KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKIS 327
           K    L   + EGE YT+ ++ +   L + ++  L  L++I++G+ ++ ++++++++ I 
Sbjct: 257 KKDMYLTVTLHEGEPYTISSVKLAGNLLD-REAELQKLVKIKAGDRFSAEKLQQTTKAIV 315

Query: 328 KYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRREL 387
                    F  V  + N D +   V +  ++D G  +YV+RI + GN ++ D V+RRE+
Sbjct: 316 DKLGEYGYAFATVNAQPNIDQSTHKVGLTLMVDPGRRVYVRRINVVGNSRTRDEVVRREM 375

Query: 388 ELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIA 447
              E    +   +  +K RI   GYF++V+++ +P    SD V + V V +   G++ + 
Sbjct: 376 RQLESSWFDSGRLALSKDRINRLGYFTDVDVTTVPVEGTSDEVDVNVKVTEKPTGAITLG 435

Query: 448 TNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
             +     + +   I  +N FG G    +     R + +  T +  DPYF          
Sbjct: 436 AGFSSTDKVVLSAGISQDNVFGSGTSLSVNVNTAR-SYRTLTVTQVDPYF---------- 484

Query: 508 LQKTHLEDGSLDINDESAAVRMIVPITESISTSFKY-----DLRF---------LQYGAI 553
                  DG   I D     R   P+  S ++SF+      DL+F         + +GA 
Sbjct: 485 -----TVDGIKRITD--VFYRTYQPLYYSTNSSFRIITAGGDLKFGIPFSETDTVFFGAG 537

Query: 554 SEKEKI------PSIYTTLIEHGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYA 605
            E+ ++      P+ Y   ++     S+++  +I +  +  D+ ++P +G    ++ +Y 
Sbjct: 538 FEQNRLDIDDNTPASYKAYVQQFGRVSNTVPLTIGWSRDARDSALIPSRGYFTQANAEYG 597

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY-- 663
                 QY+++  +A Y+Y  +    +  +L+ GYG  I         + + +  NYY  
Sbjct: 598 APVDKIQYYKMDVQAQYYYSFARGFILGLNLQGGYGNGIG--------NSYPIFKNYYAG 649

Query: 664 ----LRGFAYKGIGPR-VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
               +RG+    +GPR       IGG      +  ++FP+P       LR   F+D   +
Sbjct: 650 GIGSVRGYEPSSLGPRDATTNDPIGGSKMVVGNIELTFPLPGTGYDRTLRVFTFLDGGNV 709

Query: 719 YANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           + N    G +    N    R   GV + W SP+G + +  G PL+  EGD+ Q+F F+IG
Sbjct: 710 WGN--VPGGNSTGANG--LRYGYGVGLAWISPIGPLKLSLGFPLQKHEGDQYQKFQFQIG 765

Query: 779 N 779
            
Sbjct: 766 T 766


>gi|220934341|ref|YP_002513240.1| outer membrane protein assembly complex, YaeT protein
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995651|gb|ACL72253.1| outer membrane protein assembly complex, YaeT protein
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 758

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 189/747 (25%), Positives = 346/747 (46%), Gaps = 27/747 (3%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
           T  +  IE+ G   +    + + +PV VG +  DA     V+ ++  G+FS+V ++  D+
Sbjct: 23  TFTIEDIEVEGLERIAPGTVFTNLPVQVGDAFDDARSAEVVRALFRTGFFSDVSLRRRDN 82

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAA---AYDEDTVNADVHNIKQAYA 161
           VL++ + ER  IN +  SGN ++KDD+L   +R    A    ++   +    + ++Q Y 
Sbjct: 83  VLVVVVEERPAINEINISGNRDIKDDELMDALRQVGMARGRVFNRTVLERMENELRQQYY 142

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHAR-LERVISIRT 220
           + G  NV + V+   +    +++   I EG  AKI  I  VGN  +     L R  S   
Sbjct: 143 ARGKYNVRIDVEVEELERNRVDVNIDIAEGQVAKIRRINLVGNDAFEDREILRRFDSGIP 202

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDE 279
             Y  F + D YS++++S D E +R+ Y D G+    + S+QV     +    +   +DE
Sbjct: 203 RWYAFFSRRDHYSRQKLSGDLETLRSKYLDSGFVNFNIDSTQVTLTPDRKDIYVTVNVDE 262

Query: 280 GEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVR 339
           G+ YT+ ++ +   L  + ++ L+ L+R+  G++++   I  S++ I++        F  
Sbjct: 263 GDQYTISDVRLGGNLI-VDEQELMELVRVAPGDVFSRARINASADAITRRLGDEGYAFAN 321

Query: 340 VKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSM 399
           V      D   R V +   +D G  +YV+RI   GND++ D V RRE+   EG   + S 
Sbjct: 322 VNPIPEVDEENRTVSLTLFVDPGQRVYVRRINFTGNDRTQDEVFRREMRQMEGGWYSTSN 381

Query: 400 IERAKRRIMATGYFSEVNIS--QLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           ++R++ R+    +   VN+   ++P +D  D V L +SVK+  +GS  +   Y   +G+ 
Sbjct: 382 VDRSRVRLQRLSFVESVNVETRRVPGSD--DQVDLDISVKERFSGSFTVGVGYAQSEGVL 439

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAV-QNYTFSVEDPYFLGSPISAGFDLQKTHLEDG 516
               +   NF G G R  LA  F   +V + Y+ S  +PY+    IS GF L     +  
Sbjct: 440 FNLGLSQENFMGTGRRVSLA--FNNSSVNRTYSISYLNPYYTLDGISRGFTLFFRETDAS 497

Query: 517 SLDI-----NDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGK 571
            LDI     N     +   +P+TE    +F++   + +   ++       ++  + +   
Sbjct: 498 QLDISRYATNRYGGTLTYGIPLTE--FDTFRFSPGYERVEVVTTSGTSDEVFDYIADGNT 555

Query: 572 FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD 631
           F+ +++  S  ++T D  +   +G L  +    A  G  ++Y ++  R+ +F  L D+  
Sbjct: 556 FNFYTLESSFTHDTRDRTVFASEGNLQRAGVKVALPGSTAEYFKLDLRSQWFLPLRDNLS 615

Query: 632 IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSAS 691
           I  +    Y      N  +  F+ +    +  +RG+    +GP+       GG      +
Sbjct: 616 IGLNGEINYAEPYGDNDRVPFFEHYFAGGSRSVRGYRDFSLGPQDSNNDPFGGTFRVVTT 675

Query: 692 AAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPL 751
           A + FP P + +   +R + F+D+  +Y ++ A  A ++       R S G+ + W SP+
Sbjct: 676 AELLFPPPFLDDSGNMRMSLFLDAGQVYQSYEAFDAGEI-------RTSAGIGMTWLSPV 728

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +       L  +  D  Q F F IG
Sbjct: 729 GALTFSLAQALNDKPEDDRQVFQFSIG 755


>gi|77918855|ref|YP_356670.1| putative outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77544938|gb|ABA88500.1| putative outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 751

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 199/744 (26%), Positives = 358/744 (48%), Gaps = 34/744 (4%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVD---- 103
           V ++ + G   V +  I   + V   + I+ AD+D  ++ I+  G F +V  ++V+    
Sbjct: 26  VDQVVVEGNRRVERSYIEGVLTVSADKPITVADVDRNIQAIFKTGRFRDVSAELVERNGK 85

Query: 104 SVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASI 163
            VL+ ++ ER ++  + FSGN+ +K D+L  +V ++    Y    +      IK+AY   
Sbjct: 86  QVLVFNVSERPLLRKIVFSGNSEIKTDKLGEMVNAQKIEFYRPQIIREGTEIIKRAYIQE 145

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           GY    ++            IT+ I+EG K  +  I+F GN  +    L++ +  +   +
Sbjct: 146 GYYATEIEASVDINDRQEATITFTIDEGDKVYVTDIQFEGNTVFKAKELKKAMLTKEKWF 205

Query: 224 FSF--GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVLIFQIDEG 280
            SF  G+   Y++E    D + +   Y++ GY  V+V   ++     K    L+++I+EG
Sbjct: 206 LSFITGRGG-YNEEMTKVDRDILSDQYYNEGYIQVRVKGPIVNLLPDKKSIELLYEIEEG 264

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
             +  GN+ I   L +  K+ LL  + +  G +++ + ++E   K++  +      +V V
Sbjct: 265 VQFFAGNLDISGDLLK-DKQELLETMTLHKGAVFSRKVMREDMSKLNDLYADSGFAYVNV 323

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
                 +   R VDI Y ++QG    + RI I GN ++ D VIRR+++L+EG+  + S+I
Sbjct: 324 TPETQVNEQTRQVDITYDVEQGIRARIGRINISGNTRTRDKVIRRQVKLAEGETYSASLI 383

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
           + ++R+I   GYF EVN++    +D+S  + + + VK+ + GS  I   +    GM V+G
Sbjct: 384 KNSRRKINNLGYFDEVNLTTRKGDDLS-LMDIDIDVKERATGSFSIGAGFSSVDGMMVQG 442

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDI 520
            +  +NF G+G R  L+   G  +   Y   + DPYFL   ++ GFD+  T  E    D 
Sbjct: 443 SVSQDNFLGRGLRLDLSGSLG-GSRTVYRVGLLDPYFLDRDLALGFDVYDTEREWTDFDR 501

Query: 521 NDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQS 580
           +     +++ +PIT+ I T F Y  R+ +   I++ +   S +T   + GK +  SI+ S
Sbjct: 502 DTTGGDIKLGLPITDDIRTFFVY--RYEEKN-ITDVDDDAS-WTIRKQAGKHTLSSITAS 557

Query: 581 IIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGY 640
           +  NT D    P +G +   + +YAG GG  ++ +  +   YFY L          + GY
Sbjct: 558 LSRNTTDFRPDPSRGNISELAIEYAGLGGTERFIKYTADHRYFYPLPWGMVFSAHGQVGY 617

Query: 641 GCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR------VDKKYAIGGKIYSSASAAV 694
              +   K+  L ++F +     LRGF  + +GPR       D  +  G K    A   +
Sbjct: 618 IQEM-GGKDAPLDERFFLGGMNSLRGFESREVGPREANDDGTDYDFVGGVK---EAVFNL 673

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
               PL+ +   ++G  F D+   +A+   + ++         R S G  I WNSP+G +
Sbjct: 674 ELTFPLIKDMK-MKGLVFFDTGNAWADDETMFSEM--------RYSVGAGIAWNSPMGPL 724

Query: 755 GVYYGIPLRHREGDKIQQFGFRIG 778
              +G  L  +E ++   F F +G
Sbjct: 725 RFAWGYNLSPKEWEEPSAFDFSVG 748


>gi|284008512|emb|CBA75028.1| outer membrane protein assembly factor [Arsenophonus nasoniae]
          Length = 801

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 210/805 (26%), Positives = 364/805 (45%), Gaps = 60/805 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG    YGS+  +V+ I   G   V     L  +PV VG +I++ D+   
Sbjct: 3   MKKLLIASLLFGSVTAYGSDGFVVQDIHFEGLQRVAVGAALLNMPVRVGDTINNDDIGRT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ +++ G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDLLKQNLEASNIRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D   +      ++  Y S+G  N  VK     +     ++  +  EGV AKI  I  
Sbjct: 123 EALDRTKLANIEKGLEDFYYSVGKYNATVKAIVTPLPRNRADLKLIFSEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK ++ A L     +R    +++F     Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKAFTTAELVNRFQLRDDVPWWNFIADQKYQKQKLAGDLETLRSFYLDRGYAKFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTL----QEIQKKTLLSLIRIRSGNLYN 315
           + V     K G  +   + EG+ YT+  + +         EI +     LI I+  +LYN
Sbjct: 243 TNVSLTPDKKGIYVTINVTEGDRYTISGVELNGETAGHYDEINQ-----LITIKPASLYN 297

Query: 316 PQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
             E+     KI          + RV T+   +   + V +   +D GS  YV++I   GN
Sbjct: 298 GTEVTNMENKIKDLLGRYGYAYPRVITQPEINDEDKTVKLHVNVDAGSRFYVRQIRFVGN 357

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           D S DSV+RRE+   EG  +   ++   K R+  TG+F  V++         D V +   
Sbjct: 358 DVSKDSVLRREMRQMEGAWLGNDLVNLGKERLNRTGFFETVDVETQRVPGTPDEVDVIYK 417

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVED 494
           VK+ + GS+     +  + G+  +  +   N+ G G    ++A   ++    Y   S+ D
Sbjct: 418 VKERNTGSMNFGIGFGTESGISFQVGVQQENWLGTGNAVGISA--SKNDYSTYAELSLTD 475

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDI---NDESAAVRMIVPITESISTSFKYDLRFLQYG 551
           PYF  + +S G  L          D+   N+++  V   +    + + +F+    F+ + 
Sbjct: 476 PYFTVNGVSLGGRLFYNDFSAKDADLSRYNNKTYGVDSTLSFPFNENNAFRIGAGFV-HN 534

Query: 552 AISEKEKIPSIYTTLIEHGK-----------FSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           ++S+ +    ++  L   G+            +  +++    YN LD    P  G   S 
Sbjct: 535 SLSDMKAQVGMWRYLQSMGENPNFDDKARYNANDFTLNLGWTYNNLDRGFFPTAGNKTSL 594

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSV 658
           +      G ++QY++I    S +Y + +D+   ++G  + GYG      K L  ++ F  
Sbjct: 595 NSKITIPGSNNQYYKIRFDTSQYYPIDEDNKWVLLGRAQLGYGNGF-GGKELPFYENFYA 653

Query: 659 SSNYYLRGFAYKGIGPRV-----DKKY------------AIGGKIYSSASAAVSFPMPLV 701
                +RGF    IGP+      DKK             A+GG   ++AS  +  P P +
Sbjct: 654 GGAGTVRGFRSNNIGPKAIYLEKDKKGDISPKSGSPSTDAVGGNAMATASLELITPTPFI 713

Query: 702 PER--AGLRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEIMWNSPLGM 753
            E+    +R +FF+D+ T++ ++ +             G  S  RVSTG+ + W SPLG 
Sbjct: 714 DEKYANSIRTSFFIDAGTVWDSNWSNTPASWRAGMPDYGKASNIRVSTGIALQWMSPLGP 773

Query: 754 MGVYYGIPLRHREGDKIQQFGFRIG 778
           +   Y  P++  EGDK ++F F IG
Sbjct: 774 LVFSYAKPIKDYEGDKSEEFQFNIG 798


>gi|172060959|ref|YP_001808611.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria MC40-6]
 gi|171993476|gb|ACB64395.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria MC40-6]
          Length = 768

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 197/769 (25%), Positives = 363/769 (47%), Gaps = 71/769 (9%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +V+
Sbjct: 31  VVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGNVV 90

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASI 163
           I+ + ER  I  + F+G      D L   +R+   A    YD+  V+     +K+ Y + 
Sbjct: 91  IVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYLTR 150

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G+    VK     +    ++I + + EG  AKI  I F+GNK +S ++L   + + T  +
Sbjct: 151 GFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSKLRDEMQLSTPNW 210

Query: 224 FS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGE 281
           FS + K D+YSKE+++ D EA+R++Y +RGY    + S+QV     K    L   + EGE
Sbjct: 211 FSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHEGE 270

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            YTV  I +   L + ++  L  LI+I+ G+ ++ ++++++++ I          F  V 
Sbjct: 271 PYTVSGIKLSGNLLD-REAELTKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATVN 329

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
            + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + + 
Sbjct: 330 AQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRLA 389

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
            +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +   
Sbjct: 390 LSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVTVKVDEKPTGAITLGAGFSSTDKVVLSAG 449

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDIN 521
           +  +N FG G    +     + + +  T +  DPYF                 DG   I 
Sbjct: 450 VSQDNVFGSGTSLSVNVNTAK-SYRTLTVTQVDPYF---------------TVDGIKRIT 493

Query: 522 DESAAVRMIVPITESISTSFKY-----DLRF---------LQYGAISEKEKI------PS 561
           D     R   P+  S S+SF+      +L+F         + +GA  E+ ++      P+
Sbjct: 494 D--VYYRTYQPLYYSTSSSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDTDDNTPA 551

Query: 562 IYTTLIEHGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR 619
            Y   +      S+++  ++ +  +  D+ ++P +G    ++ +Y    G  QY++   +
Sbjct: 552 SYKAYVNEFGRVSNTVPLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQ 611

Query: 620 ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY------LRGFAYKGIG 673
           A Y+Y  S    +  +L+ GYG  I         + + +  NYY      +RG+    +G
Sbjct: 612 AQYYYSFSRGFILGMNLQGGYGNGIG--------NPYPIFKNYYAGGIGSVRGYEPSSLG 663

Query: 674 PRVDKKY-AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADK 729
           PR  K    IGG      +  ++FP+P       LR   F+D   ++ N     + GA+ 
Sbjct: 664 PRDTKTNDPIGGSKMLVGNIELTFPLPGTGYDRTLRVFTFLDGGNVWGNAPGGTSTGANG 723

Query: 730 LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           L       R   GV + W SP+G + +  G PL+  EGD+ Q+F F+IG
Sbjct: 724 L-------RYGYGVGLAWISPIGPLKLSLGFPLQKHEGDQYQKFQFQIG 765


>gi|254468700|ref|ZP_05082106.1| outer membrane protein assembly complex, YaeT protein [beta
           proteobacterium KB13]
 gi|207087510|gb|EDZ64793.1| outer membrane protein assembly complex, YaeT protein [beta
           proteobacterium KB13]
          Length = 777

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 203/780 (26%), Positives = 360/780 (46%), Gaps = 39/780 (5%)

Query: 30  LFYAIFGLSAVYGSNTS---IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVK 86
           L Y +F +     SN +   +V  I+I+G   V   VI   IP  +G  ++D D    +K
Sbjct: 3   LLYKLFFIFLFLISNLTYAEVVNDIKIKGLQRVEPGVIFDSIPFDIGDDVNDIDPSEIIK 62

Query: 87  NIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRS---AAA 143
            IY  G F +V ++     L + + E+ II  + F+GN  +++D+L+  +R  +    A 
Sbjct: 63  YIYKSGQFRDVSVEFDSGNLTVVVSEKPIIASIEFNGNQLIQEDKLREGIRQVNLYEGAV 122

Query: 144 YDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVG 203
           +D+  ++    ++ ++Y S+G  N+ VK     +    + I   I+EG   +I+ I   G
Sbjct: 123 FDKQVLSNLEKDLSKSYNSMGRYNISVKASFRPLERNRVAIKVDIDEGTLTRISRISING 182

Query: 204 NKNYSHARLERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQ 261
              +S   L  VI ++ +   S+  K D YSK  ++ D E I++FY D+GY   K+ S+ 
Sbjct: 183 LTKFSEEDLLEVIGLKATNILSWWEKDDRYSKSELTADLEKIKSFYLDKGYLKFKILSTD 242

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
           V     K    +   ++EGE YT G+ISI   + E     + S I I+ G+ ++ + + +
Sbjct: 243 VSITPNKKKLAITIDVEEGEKYTFGDISISGDINEFSDADIKSNIAIKKGDFFSSKLVNK 302

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           SS+ +SKY  +    F  +    N D   + V  ++ +D G+ +YV+ I   GN ++ D 
Sbjct: 303 SSDNLSKYLGNFGYAFANINPISNIDEQNKSVSYDFFVDTGNKIYVRNINFIGNTRTKDR 362

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ--LPANDVSDYVILRVSVKQL 439
           V+RRE+   E    + S + R+K R+    YFS V++    +P N  +D V L V+V + 
Sbjct: 363 VLRREMRQFESSWYDESKVARSKFRLTRLQYFSAVDVDTAVVPGN--TDQVDLNVNVTER 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           + G + +       +G+    ++   NF G G    L    GR   + Y+ S  DPY+  
Sbjct: 421 NTGKIMLGAGVSSAEGLMGSFNVSQRNFAGSGNTVALGVSTGRIN-RTYSLSYTDPYYTD 479

Query: 500 SPISAGF-----DLQKTHLED-GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
             +S GF     D     L   G+ +       V   +P++E    +    L F +   +
Sbjct: 480 DGVSRGFQVYRRDRNTAKLRGIGTYNTYSYGGGVNFGIPLSEKDFLNLGVTLDFTE---L 536

Query: 554 SEKEKIPSIYTTLIEHGKFS--------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
              ++ P++Y         S        S +    I+ +T DN ++P +GM+   +    
Sbjct: 537 ELTDRSPALYKDYCNKASSSGAVDCTANSIAFDVGIVTDTRDNVLIPTEGMMTKYTATVT 596

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYL 664
               D QY+++ ++  ++  L D       LR G G      +++   F  F +     +
Sbjct: 597 APVLDMQYYKLQAQTEFYKPLDDAKKFTLKLRGGLGYADDYGSEDYPFFKNFYMGGPRTV 656

Query: 665 RGFAYKGIGPR-----VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           RG+    IGP+       + Y  GG     ASA + FP+P + +    R + F D+  ++
Sbjct: 657 RGYRTSSIGPKYYNSTAKRWYTTGGTTSILASAELYFPVPGLKKNDSFRLSAFFDAGGVF 716

Query: 720 ANHVAL-GADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           +++ ++ G ++ E  +   R S G  + WNSP G + V    PL     D+ Q+F F +G
Sbjct: 717 SDNESIDGTEQYEQGE--MRYSMGFGVQWNSPFGPLQVSIAEPLNDDNKDRTQRFQFGMG 774


>gi|271499503|ref|YP_003332528.1| outer membrane protein assembly complex, YaeT protein [Dickeya
           dadantii Ech586]
 gi|270343058|gb|ACZ75823.1| outer membrane protein assembly complex, YaeT protein [Dickeya
           dadantii Ech586]
          Length = 805

 Score =  262 bits (670), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 211/811 (26%), Positives = 373/811 (45%), Gaps = 68/811 (8%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVTDEDIGNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + L+I + ER  I  L FSGN  +K++ LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGNSLLIQVKERPTIASLTFSGNKAVKEEMLKENLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTLSNIEKGLEDFYYSVGKYSATVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK++S   L     +R    +++      Y K+++S D E +R+FY DRGYA   + S
Sbjct: 183 VGNKSFSSDELISRFQLRDEVPWWNVVGDRKYEKQKLSGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTL----QEIQKKTLLSLIRIRSGNLYN 315
           +QV     K G  +   I EG  Y +  + ++  L     EI+      L RI+ G LYN
Sbjct: 243 TQVSLTPDKKGIYITVNITEGNQYKLSGVVVRGNLVGHATEIE-----DLTRIQPGELYN 297

Query: 316 PQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
             ++    E I K        + RV T+ + +   + V +   +D G+   V+RI  EGN
Sbjct: 298 GTKVTRMEEDIKKLLGRYGYAYPRVVTQPDINDTDKTVRLNINVDAGNRFTVRRIRFEGN 357

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           D S DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   
Sbjct: 358 DVSKDSVLRREMRQMEGGWLGNDLVQQGKERLNRLGYFESVDTETQRVPGTPDQVDVVYK 417

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVED 494
           VK+ + GS+     +  + G+  +  +  +N+ G G    ++    R+  Q Y   S+ D
Sbjct: 418 VKERNTGSLNFGVGFGTESGISFQAGVQQDNWLGTGNSVGISG--TRNDYQTYVELSMTD 475

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMI-----VPITESISTSFKYDLRFLQ 549
           PY     +S G  +   + +  + D+ D +     I      PI E  + S +  L ++ 
Sbjct: 476 PYLTVDGVSLGGRVFYNNFKALNADLADYTNQSYGIGSTLGFPINE--NNSLRLGLDYV- 532

Query: 550 YGAISEKEKIPSIYTTLIEHG-----------KFSSHS--ISQSIIYNTLDNPIVPRKGM 596
           + ++S+ +   +++  L + G            FS++   ++    YN LD    P  G 
Sbjct: 533 HNSLSDMKPQVAMWRYLNKAGVDPDPNSTSSASFSANDFFLTPGWTYNNLDRGYFPTAGN 592

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFD 654
            ++ S      G D++Y+++   ++ ++ LS+  + V     + GY   + S K +  +D
Sbjct: 593 RVNLSTKVTVPGSDNEYYKMTFDSASYFPLSESRNWVLMAKTKAGYADGL-SGKEVPFYD 651

Query: 655 QFSVSSNYYLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAVS 695
            F    +  +RGF    IGP+                    +   A+GG   + ASA + 
Sbjct: 652 NFFAGGSNTVRGFRSNTIGPKAAYYTAGSCSSSSVSSCSIANSTDAVGGNAMAVASAELI 711

Query: 696 FPMPLVPER--AGLRGAFFVDSATLYANHVALGADKLEGNDSFW------RVSTGVEIMW 747
            P P + ++  + +R +FFVD+ T++  H    A  L      +      R+S+G+ + W
Sbjct: 712 VPTPFISDKYASSVRTSFFVDAGTVWDTHWENTAQTLAAGIPDYSKPGNIRMSSGLAVQW 771

Query: 748 NSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            SPLG +   Y  P +  +GD+ +QF F IG
Sbjct: 772 VSPLGPLVFSYAQPFKKYDGDRSEQFQFNIG 802


>gi|75421431|sp|Q9S341|YAET_PHOLU RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|5689866|emb|CAB51929.1| outer membrane antigen [Photorhabdus luminescens]
          Length = 797

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 216/804 (26%), Positives = 363/804 (45%), Gaps = 62/804 (7%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG +A YG++  +V+ I   G   V     L  +PV VG ++SD D+   
Sbjct: 3   MKKLLIASLLFGSAAAYGADGFVVQDIHFEGLQRVAVGAALLNMPVRVGDTVSDEDIGRT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           +  ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IHALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASHVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D   ++     ++  Y S+G  N  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTMLSNIERGLEDFYYSVGKYNASVKAVVTPLPRNRVDLKLVFAEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK++S   L     +R    +++      Y K++++ D EA+R+FY DRGYA   + S
Sbjct: 183 VGNKSFSSDELLNRFQLRDDVPWWNLTADQKYQKQKLTGDLEALRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   + EG+ Y +  I +   +   Q + +  L  I  G+LYN  ++
Sbjct: 243 TQVSLTPDKKGIYVTINMTEGDQYKISGIDLNGNMAGYQSE-ITKLAAIEPGSLYNGTQV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +    I          + RV T+   +   + V +   ID G+  YV++I   GND + 
Sbjct: 302 TKMENDIKNLLGRYGYAYPRVMTQPEINDQDKTVKLHVNIDAGNRFYVRKIRFSGNDTTK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   E   +   ++E  K R+   GYF  V++         D V +   VK+ 
Sbjct: 362 DSVLRREMRQMERAWLGSDLVELGKERLNRLGYFETVDVETQRIPGSPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     +  + G+  +     +N+ G G    + A   ++    Y   S  DPYF 
Sbjct: 422 NTGSLNFGVGFGTESGVSFQIGAQQDNWLGTGNAVGINA--SKNDYSTYAELSFTDPYFT 479

Query: 499 GSPISAGFDL--QKTHLEDGSLD-INDESAAVRMIV--PITESISTSFKYDLRFLQYGAI 553
            + +S G  +       +D  L    ++S  +   +  PI E+ S +F      L Y   
Sbjct: 480 INGVSLGGRVFYNDFRADDAELSGYTNQSYGISGFLGFPINENNSLNFG-----LNYIHN 534

Query: 554 SEKEKIP--SIYTTLIEHG-----------KFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           S  + +P  +++  L   G           K    +++    YN LD    P  G+  + 
Sbjct: 535 SLSDMLPQVAMWRYLRSMGEKPDLESKAEFKADDFALTMGWTYNNLDRGFFPTSGVKSTL 594

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSV 658
           +      G D++++++    S +Y ++DD    I+G  R GYG  +   K L  ++ F  
Sbjct: 595 NGKVTIPGSDNEFYKVTLDTSAYYPINDDRTWVILGRSRLGYGDGL-GGKELPFYENFYA 653

Query: 659 SSNYYLRGFAYKGIGPRVDKKY-------------AIGGKIYSSASAAVSFPMPLVPER- 704
             +  +RGF    IGP+    Y             A+GG   + AS  +  P P +  + 
Sbjct: 654 GGSSTVRGFRSNNIGPKAIYLYKDGSPKKESPSRDAVGGNAMAVASLELITPTPFLDSKY 713

Query: 705 -AGLRGAFFVDSATLY---ANHVALGADK------LEGNDSFWRVSTGVEIMWNSPLGMM 754
              +R +FF+DS T++    N  A+   K        GN    RVS G+ + W SPLG +
Sbjct: 714 SNSVRTSFFIDSGTVWDTDWNDSAVMKSKGIPDYSKPGN---IRVSAGIALQWMSPLGPL 770

Query: 755 GVYYGIPLRHREGDKIQQFGFRIG 778
              Y  P++  EGD+ +QF F IG
Sbjct: 771 VFSYAKPIKDYEGDRSEQFQFNIG 794


>gi|317046990|ref|YP_004114638.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           At-9b]
 gi|316948607|gb|ADU68082.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           At-9b]
          Length = 803

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 210/804 (26%), Positives = 372/804 (46%), Gaps = 56/804 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDIRNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           +++++A G F +V++    + LI+ + ER  I  + FSGN  +K+DQLK  + +   R  
Sbjct: 63  IRSLFATGNFEDVQVLRDGTTLIVQVKERPTIASITFSGNKAVKEDQLKQNLEASGIRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G     VK     +    +++ +V +EGV A+I  I  
Sbjct: 123 EALDRTTLSSIEKGLEDFYYSVGKYTASVKAIATPLPRNRVDLKFVFQEGVSAQIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK +S   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + +  ++       +  L +I SG LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAG-HSAEIEHLTKIPSGELYNGTKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  + I K        + RV T+   + A + V +   +D G+  YV+++  EGND S 
Sbjct: 302 TQMEDDIKKLLGRYGYAYPRVVTQPEINDADKTVKLHINVDAGNRYYVRKVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D+V+RRE+   EG  +   ++E+ K R+  TGYF  V++         D V +   VK+ 
Sbjct: 362 DAVLRREMRQMEGAWLGSDLVEQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + G+      Y  + G+  +  +  +N+ G G    ++    ++  Q Y  FS+ DPYF 
Sbjct: 422 NTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISG--TKNDYQTYAEFSLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDIND---ESAAV--RMIVPITE--SISTSFKY---DLRFL 548
              +S G  +     +    D++D   +S  V   +  PI E  ++     Y   DL  +
Sbjct: 480 VDGVSLGGRIFYNDFKADDADLSDYTNKSYGVDGTLGFPINENNTLRVGLGYVHNDLSNM 539

Query: 549 QYGAISEKEKIPSI--YTTLIEHGKFSSH--SISQSIIYNTLDNPIVPRKGMLISSSYDY 604
           Q   ++    + S+  +  L + G FS++  + +    YNTLD    P  G   + +   
Sbjct: 540 Q-PQVAMWRYLDSVGRHQGLNDDGDFSANDFTFNYGWTYNTLDRGFFPTSGNRTNLNGKV 598

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNY 662
              G D+ +++       +  ++ D    ++G  R GYG  +   K +  ++ F    + 
Sbjct: 599 TIPGSDNSFYKATLDTQQYVPINRDRTWVLLGRGRVGYGDGL-GGKEMPFYENFYAGGSS 657

Query: 663 YLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
            +RGF    IGP+                        A+GG   + AS  +  P P + E
Sbjct: 658 TVRGFQSNTIGPKAAYLNDGSSTCTLSDPNGICKSDDAVGGNAMAVASLELITPTPFLSE 717

Query: 704 R--AGLRGAFFVDSATLY-------ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +    +R + F D+ T++       A   A G       ++  RVS+G+ + W SPLG +
Sbjct: 718 KYANSVRTSVFFDAGTVWDTKWQNTAETRAAGIPDYSDPNNI-RVSSGIALQWMSPLGPL 776

Query: 755 GVYYGIPLRHREGDKIQQFGFRIG 778
              Y  P++  EGDK +QF F IG
Sbjct: 777 VFSYAQPIKKVEGDKSEQFQFNIG 800


>gi|115352095|ref|YP_773934.1| surface antigen (D15) [Burkholderia ambifaria AMMD]
 gi|115282083|gb|ABI87600.1| surface antigen (D15) [Burkholderia ambifaria AMMD]
          Length = 768

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 197/769 (25%), Positives = 362/769 (47%), Gaps = 71/769 (9%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +V+
Sbjct: 31  VVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGNVV 90

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASI 163
           I+ + ER  I  + F+G      D L   +R+   A    YD+  V+     +K+ Y + 
Sbjct: 91  IVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYLTR 150

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G+    VK     +    ++I + + EG  AKI  I F+GNK +S ++L   + + T  +
Sbjct: 151 GFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSKLRDEMQLSTPNW 210

Query: 224 FS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGE 281
           FS + K D+YSKE+++ D EA+R++Y +RGY    + S+QV     K    L   + EGE
Sbjct: 211 FSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHEGE 270

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            YTV  I +   L + ++  L  LI+I+ G+ ++ ++++++++ I          F  V 
Sbjct: 271 PYTVSGIKLSGNLLD-REAELTKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATVN 329

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
            + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + + 
Sbjct: 330 AQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRLA 389

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
            +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +   
Sbjct: 390 LSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVTVKVDEKPTGAITLGAGFSSTDKVVLSAG 449

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDIN 521
           +  +N FG G    +     + + +  T +  DPYF                 DG   I 
Sbjct: 450 VSQDNVFGSGTSLSVNVNTAK-SYRTLTVTQVDPYF---------------TVDGIKRIT 493

Query: 522 DESAAVRMIVPITESISTSFKY-----DLRF---------LQYGAISEKEKI------PS 561
           D     R   P+  S S+SF+      +L+F         + +GA  E+ ++      P 
Sbjct: 494 D--VYYRTYQPLYYSTSSSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQ 551

Query: 562 IYTTLIEHGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR 619
            Y   +      S+++  ++ +  +  D+ ++P +G    ++ +Y    G  QY++   +
Sbjct: 552 SYQDYVNQFGRVSNTVPLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQ 611

Query: 620 ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY------LRGFAYKGIG 673
           A Y+Y  S    +  +L+ GYG  I         + + +  NYY      +RG+    +G
Sbjct: 612 AQYYYSFSRGFILGMNLQGGYGNGIG--------NPYPIFKNYYAGGIGSVRGYEPSSLG 663

Query: 674 PRVDKKY-AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADK 729
           PR  K    IGG      +  ++FP+P       LR   F+D   ++ N     + GA+ 
Sbjct: 664 PRDTKTNDPIGGSKMLVGNIELTFPLPGTGYDRTLRVFTFLDGGNVWGNAPGGTSTGANG 723

Query: 730 LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           L       R   GV + W SP+G + +  G PL+  EGD+ Q+F F+IG
Sbjct: 724 L-------RYGYGVGLAWISPIGPLKLSLGFPLQKHEGDQYQKFQFQIG 765


>gi|260596597|ref|YP_003209168.1| outer membrane protein assembly factor YaeT [Cronobacter turicensis
           z3032]
 gi|260215774|emb|CBA28194.1| Outer membrane protein assembly factor yaeT [Cronobacter turicensis
           z3032]
          Length = 804

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 209/809 (25%), Positives = 375/809 (46%), Gaps = 65/809 (8%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVSDEDISNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFASGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I  
Sbjct: 123 ESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN+ +S   L     +R    +++      Y K+++  D E +R++Y DRGYA   + S
Sbjct: 183 VGNRAFSTEELISNFQLRDEVPWWNVVGDRKYQKQKLQGDLETLRSYYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   + EG+ Y +  + +   L       + SL +++ G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYVTINVTEGDQYKIAGVEVSGNLAG-HSAEIESLTKMQPGELYNGTKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               + I K        + RV+T+   + A + V +   +D G+  YV++I  EGND S 
Sbjct: 302 TRMEDDIKKLLGRYGYAYPRVQTQPEINDADKTVKLHVNVDSGNRFYVRKIRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D+V+RRE+   EG  +   ++++ K R+   GYF  V+      +   D V +   VK+ 
Sbjct: 362 DAVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDADTQRVSGSPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS      Y  + G+  +  +  +N+ G GY   +     ++  Q Y+ FSV +PYF 
Sbjct: 422 NTGSFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGING--TKNDYQTYSEFSVTNPYFT 479

Query: 499 GSPISAG------------FDL----QKTHLEDGSLDIN-DESAAVRMIVPITESISTSF 541
              +S G             DL     K++  DG+L    +E   +R+ +    +  ++ 
Sbjct: 480 VDGVSLGGRIFYNDFKADDADLSSYTNKSYGVDGTLGFPINEYNTLRLGLGYVHNDLSNM 539

Query: 542 KYDLRFLQY-GAISEKEKIPSIYTTLIEHGKFSSH--SISQSIIYNTLDNPIVPRKGMLI 598
           +  +   +Y  ++ +  K     TT  ++G FS+   +++    YN LD    P  G  +
Sbjct: 540 EPQVAMWRYLDSLGQSAK-----TTSDDNG-FSADDFTLNYGWTYNHLDRGFFPTSGSRV 593

Query: 599 SSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQF 656
           + +      G D++++++    + +  + +D    ++G  R+GYG  + S K +  ++ F
Sbjct: 594 NLNGKVTIPGSDNEFYKLTLDTATYVPIDEDHKWVVLGRTRWGYGDGL-SGKEMPFYENF 652

Query: 657 SVSSNYYLRGFAYKGIGPR-----------VDKKY--------AIGGKIYSSASAAVSFP 697
               +  +RGF    IGP+            DK          A+GG     AS     P
Sbjct: 653 YAGGSSTVRGFQSNNIGPKAVYYSGPGLDNCDKAVGGYCSSDDAVGGNAMGVASLEFITP 712

Query: 698 MPLVPER--AGLRGAFFVDSATL----YANHVALGADKLE--GNDSFWRVSTGVEIMWNS 749
            P + E+    +R + F D+ T+    + N  A+ A  +    + S  R+S G+ + W S
Sbjct: 713 TPFLSEKYANSVRTSLFADAGTVWDTNWKNTAAMRAAGVPDYSDPSNIRMSAGIALQWMS 772

Query: 750 PLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           PLG +   Y  P +  EGDK +QF F IG
Sbjct: 773 PLGPLVFSYAQPFKKYEGDKAEQFQFNIG 801


>gi|90407922|ref|ZP_01216097.1| (3R)-hydroxymyristoyl ACP dehydratase [Psychromonas sp. CNPT3]
 gi|90311013|gb|EAS39123.1| (3R)-hydroxymyristoyl ACP dehydratase [Psychromonas sp. CNPT3]
          Length = 781

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 209/784 (26%), Positives = 362/784 (46%), Gaps = 59/784 (7%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           +  ++  G   +     L  +P+  G  + D  L  A+K +YA  YF++++++   ++LI
Sbjct: 3   ISDLQFNGLQRITLGAALLSLPIREGDEVDDYQLSLALKKLYASKYFASIELERSGNILI 62

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSAAAYDEDTVNADVHNIKQAYASIG 164
            ++ ER  I+++  +GN+ L D+Q+   ++S   +     D  T+++   +++  Y SIG
Sbjct: 63  FNVKERPSISNVALTGNDKLSDEQIFDSLKSSGIKEGEPLDRTTLSSIEKSLEDFYHSIG 122

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSG-Y 223
             +  V+    ++    + I ++  EG+ AKI  I  VGN  YS  +L + +S+R SG +
Sbjct: 123 KYSAKVETVVTTLPRNRVAIQFIFREGLTAKILQINIVGNSVYSDEKLLKRLSLRDSGGW 182

Query: 224 FSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEI 282
           +     D Y K++++ D E I+++Y DRGY    +  +QV     K G  +   +DEGEI
Sbjct: 183 WDVFADDNYQKQKLAGDLEVIKSYYLDRGYIRFNIDETQVALTPNKKGVYVTVNVDEGEI 242

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
           Y V ++     L   +++T+ +LI     ++Y   E+  + + I KYF      +  +KT
Sbjct: 243 YKVSDVKFIGNLLG-KEETIRALISFGKDDIYAASEVAFAEQNIRKYFGRLGYAYPEIKT 301

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
               D     V + + I+ G   YV+ I I GN  + D V+RRE+   EG  ++   IE+
Sbjct: 302 YPEIDDEAHQVIVNFSIEPGQRGYVRNINISGNSTTKDIVLRREMRQMEGSWLSSEKIEQ 361

Query: 403 AKRRIMATGYFSEVNI-SQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
           +K R+   G+F++V+I +   +ND+ D   + V V++ S+GS      Y  + GM +   
Sbjct: 362 SKARLNRLGFFAKVDIETSRVSNDLVD---INVKVEEQSSGSFNAGIGYGTESGMSLSAG 418

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS---L 518
           I  NNF G G +    A F  ++  N + +   PY     +S G  +     E G    +
Sbjct: 419 IQQNNFLGSGDKVGFEAKFNDYST-NASINYTTPYLTKDAVSGGVRIFYDKFEAGDANII 477

Query: 519 DINDESAAVRMIV--PITESISTSFKYDLR---FLQYGAISEKEKIPSIYTTLIEHGK-- 571
           D  +++  VR  +  P+ E     F          Q  + ++ +    IY +L+      
Sbjct: 478 DYTNKTYGVRFNLGFPVNEINRLGFGVGWESNGISQLNSYAQLQTFWDIYGSLLNDDSSV 537

Query: 572 -FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDS 630
            F +  ++     N LD   +P +GM  S        G D QY +I    S +  +SDD 
Sbjct: 538 DFQNFDVTARWTRNNLDKGQLPTQGMKHSLWAKMTVPGSDLQYFKINFEISNYQRISDDG 597

Query: 631 DIVGSLRF------GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR--------- 675
           D    LR       GYG    S++ L  F+ + V     LRGF+   +GPR         
Sbjct: 598 DWTTLLRASAGYGNGYGKFEGSDQILPFFENYYVGGYRTLRGFSSNTVGPRAIYLSEING 657

Query: 676 ------VDKKYAIGGKIYSSASAAVSFPMPLVPE--RAGLRGAFFVDSATLYA---NHVA 724
                  DK  A+GG    + SA + FP+PL+ E     +R + F+D+  ++    N+  
Sbjct: 658 NNSGEITDK--ALGGNAKYTLSAELIFPVPLLDEAYTRQVRSSLFIDAGEVWDTEFNYAQ 715

Query: 725 LGADKLEGNDSFW---------RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGF 775
                   N  ++         R S G ++ W SP+G +      P++  EGD  + F F
Sbjct: 716 YSQASCSYNCDYFGDYSKPGRIRASIGTQLTWISPMGPLVFTLAWPVKKYEGDDTEIFSF 775

Query: 776 RIGN 779
            IGN
Sbjct: 776 NIGN 779


>gi|170699881|ref|ZP_02890911.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria IOP40-10]
 gi|170135203|gb|EDT03501.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria IOP40-10]
          Length = 768

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 197/769 (25%), Positives = 362/769 (47%), Gaps = 71/769 (9%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +V+
Sbjct: 31  VVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGNVV 90

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASI 163
           I+ + ER  I  + F+G      D L   +R+   A    YD+  V+     +K+ Y + 
Sbjct: 91  IVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYLTR 150

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G+    VK     +    ++I + + EG  AKI  I F+GNK +S ++L   + + T  +
Sbjct: 151 GFYAAEVKTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSKLRDEMQLSTPNW 210

Query: 224 FS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGE 281
           FS + K D+YSKE+++ D EA+R++Y +RGY    + S+QV     K    L   + EGE
Sbjct: 211 FSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHEGE 270

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            YTV  I +   L + ++  L  LI+I+ G+ ++ ++++++++ I          F  V 
Sbjct: 271 PYTVSGIKLSGNLLD-REAELTKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATVN 329

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
            + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + + 
Sbjct: 330 AQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRLA 389

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
            +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +   
Sbjct: 390 LSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVTVKVDEKPTGAITLGAGFSSTDKVVLSAG 449

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDIN 521
           +  +N FG G    +     + + +  T +  DPYF                 DG   I 
Sbjct: 450 VSQDNVFGSGTSLSVNVNTAK-SYRTLTVTQVDPYF---------------TVDGIKRIT 493

Query: 522 DESAAVRMIVPITESISTSFKY-----DLRF---------LQYGAISEKEKI------PS 561
           D     R   P+  S S+SF+      +L+F         + +GA  E+ ++      P 
Sbjct: 494 D--VYYRTYQPLYYSTSSSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQ 551

Query: 562 IYTTLIEHGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR 619
            Y   +      S+++  ++ +  +  D+ ++P +G    ++ +Y    G  QY++   +
Sbjct: 552 SYQDYVNQFGRVSNTVPLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQ 611

Query: 620 ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY------LRGFAYKGIG 673
           A Y+Y  S    +  +L+ GYG  I         + + +  NYY      +RG+    +G
Sbjct: 612 AQYYYSFSRGFILGMNLQGGYGNGIG--------NPYPIFKNYYAGGIGSVRGYEPSSLG 663

Query: 674 PRVDKKY-AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADK 729
           PR  K    IGG      +  ++FP+P       LR   F+D   ++ N     + GA+ 
Sbjct: 664 PRDTKTNDPIGGSKMLVGNIELTFPLPGTGYDRTLRVFTFLDGGNVWGNAPGGTSTGANG 723

Query: 730 LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           L       R   GV + W SP+G + +  G PL+  EGD+ Q+F F+IG
Sbjct: 724 L-------RYGYGVGLAWISPIGPLKLSLGFPLQKHEGDQYQKFQFQIG 765


>gi|238787227|ref|ZP_04631026.1| Outer membrane protein assembly factor yaeT [Yersinia frederiksenii
           ATCC 33641]
 gi|238724489|gb|EEQ16130.1| Outer membrane protein assembly factor yaeT [Yersinia frederiksenii
           ATCC 33641]
          Length = 795

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 209/796 (26%), Positives = 364/796 (45%), Gaps = 48/796 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ + 
Sbjct: 3   MKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIGNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN +++   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG  Y + ++ +   L   Q      L++I  G L+N  ++
Sbjct: 243 TQVSLTPDKKGIYITINITEGNQYKLNSVVVSGNLAGHQSAAD-KLVQIEPGELFNGSKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S 
Sbjct: 302 TRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS+     Y  + G+  +  +  +N+ G G    L     ++  Q Y  F++ DPYF 
Sbjct: 422 NTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGLNG--TKNDYQTYAEFTLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDIN---DESAAV--RMIVPITESISTSFKYDLRFLQYGAI 553
              +S G  +     +  + D++   + S  V   +  PI E  + S +  L ++ +  +
Sbjct: 480 VDGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINE--NNSLRVGLGYV-HNDL 536

Query: 554 SEKEKIPSIYTTLIEHGK---------FSSHSISQSI--IYNTLDNPIVPRKGMLISSSY 602
           S+ E   +++  L   G+         F++   + ++   YN LD    P  G+  S + 
Sbjct: 537 SDMEPQVAMWRYLDSVGQRPGYTGREGFTTDDFTLNLGWTYNNLDRGFFPTSGVKSSVNT 596

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDD-SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSN 661
                G D++++++    S +  L +D S ++             +K +  ++ F    +
Sbjct: 597 KVTVPGSDNEFYKVTFDTSAYRPLDEDRSWVLLGRGRLGYGGGIGSKEMPFYENFYAGGS 656

Query: 662 YYLRGFAYKGIGPRV-----------DKKYAIGGKIYSSASAAVSFPMPLVPER--AGLR 708
             +RGF    IGP+            +   A+GG   + AS  +  P P + E+    +R
Sbjct: 657 SSVRGFRSNNIGPKAAYYANNGATVNNSTDAVGGNAMAVASLELITPTPFISEKYSNSVR 716

Query: 709 GAFFVDSATLYANHVALGADKLEG------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPL 762
            +FF+DS T++  +    A+            S  RVS GV + W SPLG +   Y  P+
Sbjct: 717 TSFFIDSGTVWDTNWENTAETRAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYAKPV 776

Query: 763 RHREGDKIQQFGFRIG 778
           +  EGDK +QF F IG
Sbjct: 777 KDYEGDKSEQFQFNIG 792


>gi|168230532|ref|ZP_02655590.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|194469303|ref|ZP_03075287.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194455667|gb|EDX44506.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|205335046|gb|EDZ21810.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
          Length = 810

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 208/818 (25%), Positives = 369/818 (45%), Gaps = 77/818 (9%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I  
Sbjct: 123 ESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +S   L     +R    +++      Y K++++ D E +R++Y DRGYA   + S
Sbjct: 183 VGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQ----EIQKKTLLSLIRIRSGNLYN 315
           +QV     K G  +   I EG+ Y +  + +   L     EI+K     L +I  G LYN
Sbjct: 243 TQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEK-----LTKIEPGELYN 297

Query: 316 PQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
             ++ +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGN
Sbjct: 298 GTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGN 357

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           D S DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   
Sbjct: 358 DTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYK 417

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVED 494
           VK+ + GS      Y  + G+  +  +  +N+ G GY   +     ++  Q Y+  SV +
Sbjct: 418 VKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGING--TKNDYQTYSELSVTN 475

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQ 549
           PYF    +S G  +     E    D++D +       V +  PI E    + +  L ++ 
Sbjct: 476 PYFTVDGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGFPINE--YNTLRAGLGYV- 532

Query: 550 YGAISEKEKIPSIYTTLIEHGKFSSH------------SISQSIIYNTLDNPIVPRKGML 597
           + ++S  E   +++  L   G++ S             + +    YN LD    P +G  
Sbjct: 533 HNSLSNMEPQVAMWRYLASMGQYPSTNDQDNSFSTDDFTFNYGWTYNKLDRGYFPTEGTR 592

Query: 598 ISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQ 655
           I+ +      G D++Y++     + +  + +D    I+G  RFGYG  +   K +  ++ 
Sbjct: 593 INLTGKVTIPGSDNEYYKATLDTATYVPIDNDHKWVILGRTRFGYGDGL-GGKEMPFYEN 651

Query: 656 FSVSSNYYLRGFAYKGIGPR------------VDKKY----------------AIGGKIY 687
           F    +  +RGF    IGP+             D+ Y                A+GG   
Sbjct: 652 FYAGGSSTVRGFQSNTIGPKAVYYPYNPKNYDADEDYDCATQDGAKDMCKSDDAVGGNAM 711

Query: 688 SSASAAVSFPMPLVPER--AGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVS 740
           + AS     P P + E+    +R +FF D  T++  +    + +  G     + S  R+S
Sbjct: 712 AVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTN--WDSSQYSGYPDYSDPSNIRMS 769

Query: 741 TGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            G+ + W SPLG +   Y  P +  +GDK +QF F IG
Sbjct: 770 AGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|156935308|ref|YP_001439224.1| outer membrane protein assembly factor YaeT [Cronobacter sakazakii
           ATCC BAA-894]
 gi|166227558|sp|A7MGT7|YAET_ENTS8 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|156533562|gb|ABU78388.1| hypothetical protein ESA_03165 [Cronobacter sakazakii ATCC BAA-894]
          Length = 804

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 207/809 (25%), Positives = 375/809 (46%), Gaps = 65/809 (8%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDEDISNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFASGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I  
Sbjct: 123 ESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN+ +S   L     +R    +++      Y K+++  D E +R++Y DRGYA   + S
Sbjct: 183 VGNRAFSTEELISNFQLRDEVPWWNVVGDRKYQKQKLQGDLETLRSYYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   + EG+ Y +  + +   L       + SL +++ G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYVTINVTEGDQYKIAGVEVSGNLAG-HSAEIESLTKMQPGELYNGTKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
               + I K        + RV+T+   + A + V +   +D G+  YV++I  EGND S 
Sbjct: 302 TRMEDDIKKLLGRYGYAYPRVQTQPEINDADKTVKLHVNVDSGNRFYVRKIRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D+V+RRE+   EG  +   ++++ K R+   GYF  V++     +   D V +   VK+ 
Sbjct: 362 DAVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDVDTQRVSGSPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + GS      Y  + G+  +  +  +N+ G GY   +     ++  Q Y+ FSV +PYF 
Sbjct: 422 NTGSFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGING--TKNDYQTYSEFSVTNPYFT 479

Query: 499 GSPISAG------------FDL----QKTHLEDGSLDIN-DESAAVRMIVPITESISTSF 541
              +S G             DL     K++  DG+L    +E   +R+ +    +  ++ 
Sbjct: 480 VDGVSLGGRIFYNDFKADDADLSSYTNKSYGVDGTLGFPVNEYNTLRLGLGYVHNDLSNM 539

Query: 542 KYDLRFLQY-GAISEKEKIPSIYTTLIEHGKFSSH--SISQSIIYNTLDNPIVPRKGMLI 598
           +  +   +Y  ++ +  K     TT  ++G FS+   +++    YN LD    P  G  +
Sbjct: 540 EPQVAMWRYLDSLGQSAK-----TTSDDNG-FSADDFTLNYGWTYNHLDRGFFPTSGSRV 593

Query: 599 SSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQF 656
           + +      G D++++++    + +  + DD    ++G  R+GYG  +   K +  ++ F
Sbjct: 594 NLNGKVTIPGSDNEFYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGL-GGKEMPFYENF 652

Query: 657 SVSSNYYLRGFAYKGIGPR-----------VDKKY--------AIGGKIYSSASAAVSFP 697
               +  +RGF    IGP+            DK          A+GG     AS     P
Sbjct: 653 YAGGSSTVRGFQSNNIGPKAVYYSGPGLDNCDKAVGGYCSSDDAVGGNAMGVASLEFITP 712

Query: 698 MPLVPER--AGLRGAFFVDSATL----YANHVALGADKLE--GNDSFWRVSTGVEIMWNS 749
            P + E+    +R + F D+ ++    + N  A+ A  +    + S  R+S G+ + W S
Sbjct: 713 TPFLSEKYANSVRTSLFADAGSVWDTNWKNTAAMRAAGVPDYSDPSNIRMSAGIALQWMS 772

Query: 750 PLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           PLG +   Y  P +  EGDK +QF F IG
Sbjct: 773 PLGPLVFSYAQPFKKYEGDKAEQFQFNIG 801


>gi|308185748|ref|YP_003929879.1| Outer membrane protein assembly factor yaeT precursor [Pantoea
           vagans C9-1]
 gi|308056258|gb|ADO08430.1| Outer membrane protein assembly factor yaeT precursor [Pantoea
           vagans C9-1]
          Length = 803

 Score =  261 bits (666), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 208/803 (25%), Positives = 367/803 (45%), Gaps = 54/803 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDVRNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           +++++A G F +V++    + LI+ + ER  I  + F+GN  +K+DQLK  + +   R  
Sbjct: 63  IRSLFATGNFEDVQVLRDGTTLIVQVKERPTIASITFTGNKAVKEDQLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G     VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYTANVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK +S   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + +  ++       +  L +I +G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAG-HSAEIEHLTKIPAGELYNGAKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  + I K        + RV T+   + A + V +   +D G+  YV+ +  EGND S 
Sbjct: 302 TKMEDDIKKLLGRYGYAYPRVATQPEINDADKTVKLHINVDAGNRYYVRNVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +   ++E+ K R+  TGYF  V++         D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGSDLVEQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + G+      Y  + G+  +  +  +N+ G G    ++    ++  Q Y  FS+ DPYF 
Sbjct: 422 NTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISG--TKNDYQTYAEFSLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAV-----RMIVPITE--SISTSFKY---DLRFL 548
              +S G  L     +  + D++D +         +  P+ E  ++     Y   DL  +
Sbjct: 480 VDGVSLGGRLFYNDFKADNADLSDYTNRSYGLDGTLGFPVNENNTLRVGLGYVHNDLSNM 539

Query: 549 QYGAISEKEKIPSI--YTTLIEHGKFSSH--SISQSIIYNTLDNPIVPRKGMLISSSYDY 604
           Q   ++    + S+     L + G+FS+   + +    YNTLD    P  G   + +   
Sbjct: 540 Q-PQVAMWRYLDSVGKPQQLNDKGEFSADDFTFNYGWTYNTLDRGFFPTSGNRTNLNGKV 598

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNY 662
              G D+ +++       +  ++ D    ++G  R GYG  +   K +  ++ F    + 
Sbjct: 599 TIPGSDNSFYKATLDTQQYVPINQDRTWVLLGRGRVGYGDGL-GGKEMPFYENFYAGGSS 657

Query: 663 YLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
            +RGF    IGP+                        A+GG   + AS  +  P P + E
Sbjct: 658 TVRGFQSNTIGPKAAYYNNNSSNCRIADPNGVCKSDDAVGGNAMAIASLELITPTPFLSE 717

Query: 704 R--AGLRGAFFVDSATLYANHVALGADKLEG------NDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R + FVD+ T +  H    A+          + +  RVS+GV + W SPLG + 
Sbjct: 718 KYANSVRTSVFVDTGTAWDTHWENTAETRAAGIPDYSDPNNIRVSSGVALQWMSPLGPLV 777

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P++  +GDK +QF F IG
Sbjct: 778 FSYAQPIKKVDGDKSEQFQFNIG 800


>gi|304396652|ref|ZP_07378533.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           aB]
 gi|304356161|gb|EFM20527.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           aB]
          Length = 803

 Score =  261 bits (666), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 208/803 (25%), Positives = 367/803 (45%), Gaps = 54/803 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDVRNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           +++++A G F +V++    + LI+ + ER  I  + F+GN  +K+DQLK  + +   R  
Sbjct: 63  IRSLFATGNFEDVQVLRDGTTLIVQVKERPTIASITFTGNKAVKEDQLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            A D  T+++    ++  Y S+G     VK     +    +++  V  EGV AKI  I  
Sbjct: 123 EALDRTTISSIEKGLEDFYYSVGKYTANVKAVVTPLPRNRVDLKLVFTEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGNK +S   L     +R    +++      Y K++++ D E +R+FY DRGYA   + S
Sbjct: 183 VGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           +QV     K G  +   I EG+ Y +  + +  ++       +  L +I +G LYN  ++
Sbjct: 243 TQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAG-HSAEIEHLTKIPAGELYNGAKV 301

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            +  + I K        + RV T+   + A + V +   +D G+  YV+ +  EGND S 
Sbjct: 302 TKMEDDIKKLLGRYGYAYPRVVTQPEINDADKTVKLHINVDAGNRYYVRNVRFEGNDTSK 361

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           DSV+RRE+   EG  +   ++E+ K R+  TGYF  V++         D V +   VK+ 
Sbjct: 362 DSVLRREMRQMEGAWLGSDLVEQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKER 421

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVEDPYFL 498
           + G+      Y  + G+  +  +  +N+ G G    ++    ++  Q Y  FS+ DPYF 
Sbjct: 422 NTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISG--TKNDYQTYAEFSLTDPYFT 479

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAV-----RMIVPITE--SISTSFKY---DLRFL 548
              +S G  L     +  + D++D +         +  P+ E  ++     Y   DL  +
Sbjct: 480 VDGVSLGGRLFYNDFKADNADLSDYTNKSYGLDGTLGFPVNENNTLRVGLGYVHNDLSNM 539

Query: 549 QYGAISEKEKIPSI--YTTLIEHGKFSSH--SISQSIIYNTLDNPIVPRKGMLISSSYDY 604
           Q   ++    + S+     L + G+FS+   + +    YNTLD    P  G   + +   
Sbjct: 540 Q-PQVAMWRYLDSVGKPQQLNDKGEFSADDFTFNYGWTYNTLDRGFFPTSGNRTNLNGKV 598

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQFSVSSNY 662
              G D+ +++    +  +  ++ D    ++G  R GYG  +   K +  ++ F    + 
Sbjct: 599 TIPGSDNSFYKATLDSQQYVPINQDRTWVLLGRGRIGYGDGL-GGKEMPFYENFYAGGSS 657

Query: 663 YLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
            +RGF    IGP+                        A+GG   + AS  +  P P + E
Sbjct: 658 TVRGFQSNTIGPKAAYFNNNSSNCRIADPNGVCKSDDAVGGNAMAIASLELITPTPFLSE 717

Query: 704 R--AGLRGAFFVDSATLYANHVALGADKLEG------NDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R + FVD+ T +  H    A+          + +  RVS+GV + W SPLG + 
Sbjct: 718 KYANSVRTSVFVDAGTAWDTHWENTAETRAAGIPDYSDPNNIRVSSGVALQWMSPLGPLV 777

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GDK +QF F IG
Sbjct: 778 FSYAQPFKKVDGDKSEQFQFNIG 800


>gi|330817431|ref|YP_004361136.1| Outer membrane protein, OMP85 family protein [Burkholderia gladioli
           BSR3]
 gi|327369824|gb|AEA61180.1| Outer membrane protein, OMP85 family protein [Burkholderia gladioli
           BSR3]
          Length = 768

 Score =  260 bits (665), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 198/770 (25%), Positives = 365/770 (47%), Gaps = 44/770 (5%)

Query: 33  AIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMG 92
           A+ GL+A + ++  +V+ I+I G   V    + + +P+  G + +D     A++ +YA G
Sbjct: 18  AVHGLAA-HATSPFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATG 76

Query: 93  YFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTV 149
           +F++VKI    +V+I+ + ER  I+ + F+G      D L   +R+   +    YD+  V
Sbjct: 77  FFNDVKIATEGNVVIVQVQERPAISSIDFTGIKEFDKDNLTKALRAVGLSQGRYYDKSLV 136

Query: 150 NADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSH 209
           +     +K+ Y + GY    V      +    ++I + + EG  AKI  I F+GNK +S 
Sbjct: 137 DKAEQELKRQYLTRGYYAAEVTTTVTPVDANRVSILFSVAEGPSAKIRQINFIGNKTFST 196

Query: 210 ARLERVISIRTSGYFS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQ 267
           + L   + + T  +FS + K D+YSKE+++ D E +R++Y +RGY    + S+QV     
Sbjct: 197 STLRNEMQLSTPNWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIDSTQVSISPD 256

Query: 268 KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKIS 327
           K    L   + EGE YT+ +I +   L + Q + L  L++I++G  ++ ++++ +++ I 
Sbjct: 257 KKDMYLTLTLHEGEPYTISSIQLSGNLLDRQAE-LQKLVKIKAGERFSAEKLQATTKAIV 315

Query: 328 KYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRREL 387
                    F  V  + N D A   V +  ++D    +YV+RI + GN ++ D V+RRE+
Sbjct: 316 DKLGEYGYAFATVNAQPNIDQASHKVALTLVVDPSRRVYVRRINVVGNTRTRDEVVRREM 375

Query: 388 ELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIA 447
              E    +   +  +K R+   GYF++V+++ +P    SD V + V V +   G++ + 
Sbjct: 376 RQLESSWFDSGRLALSKDRVNRLGYFTDVDVTTVPVEGTSDQVDVNVKVTEKPTGAITLG 435

Query: 448 TNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFD 507
             +     + +   I  +N FG G    +     R + +  T +  DPYF    I    D
Sbjct: 436 AGFSSTDKVVLSAGISQDNVFGSGTSLSVNVNTAR-SYRTLTVTQVDPYFTVDGIKRITD 494

Query: 508 L-QKTHLE-----DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPS 561
           +  +T+       + S  I      ++  +P +E + T F + + F Q   +      P 
Sbjct: 495 VFYRTYQPLYYSTNSSFRIITAGGDMKFGIPFSE-VDTVF-FGVGFEQ-NRLDVDADTPQ 551

Query: 562 IYTTLIEHGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR 619
            Y   ++     S+S+  +I +  +  D+ ++P +G    ++ +Y       QY+++  +
Sbjct: 552 SYQDYVQQFGRVSNSVPLTIGWSRDARDSALIPSRGYFTQANAEYGAPVDKIQYYKMDVQ 611

Query: 620 ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY------LRGFAYKGIG 673
           A Y+Y  +    +  + + GYG  I         + + +  NYY      +RG+    +G
Sbjct: 612 AQYYYSFARGFILGLNFQGGYGNGIG--------NAYPIFKNYYAGGIGSVRGYEPSSLG 663

Query: 674 PRVDKKY-AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADK 729
           PR  K    IGG      +  ++FP+P       LR   F D   ++ N     + GA+ 
Sbjct: 664 PRDSKTNDPIGGSKMVVGNIELTFPLPGTGYDRTLRVFTFFDGGNVWGNAPGGTSTGANG 723

Query: 730 LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
           L       R   GV + W SP+G + +  G PL+  EGD+ Q+F F+IG 
Sbjct: 724 L-------RYGYGVGLAWISPIGPLKLSLGFPLQKHEGDQYQKFQFQIGT 766


>gi|291278537|ref|YP_003495372.1| hypothetical protein DEFDS_0104 [Deferribacter desulfuricans SSM1]
 gi|290753239|dbj|BAI79616.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 746

 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 198/754 (26%), Positives = 358/754 (47%), Gaps = 51/754 (6%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIK--IV 102
           T  +  ++++G   +  E I +   V  G+      +D +VK +Y  G F +VK+   I 
Sbjct: 21  TVKIDEVKVKGNHRIPVETIFN-YAVKSGEPFDLKKIDESVKKLYKTGLFLDVKVDLSIE 79

Query: 103 DSVLIIDLI--ERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAY 160
           D  +++  I  E+  IN ++  GN+ +K+D LK ++       +D+  +   +  I++ Y
Sbjct: 80  DEKVVLTYIVKEKPFINKIYIEGNDEIKEDTLKEVLLIHEGDPFDKAKIEQSIAEIRKKY 139

Query: 161 ASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRT 220
               + N  +          ++++ + I+EG +AK+  I F GN  Y    L++++    
Sbjct: 140 EDENFYNAKITYDIEERKDNSVDLIFTIDEGKEAKVVKINFYGNNVYKDKELKKIVETDE 199

Query: 221 SGYFSF----GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSS-QVLFDKQKSGYVLIF 275
            G++S+    GK     ++ ++ D E IRA Y + GY  VKV+  +V  ++ K+   + F
Sbjct: 200 KGFWSWLTGSGKL---KRDELALDRERIRAKYLNNGYMRVKVAEPEVKLNEDKTKITITF 256

Query: 276 QIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGER 335
           +I+EG+ Y V  I  +  +     K L   + ++ G++++ ++ ++  + ++  F     
Sbjct: 257 RIEEGKQYKVRKIRFKGNVHR-SDKELRKRLSLKEGDIFSSEKFRKDIDSLTDAFTEIGY 315

Query: 336 PFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPI 395
            F  +    + +  K+ VDI Y +++   +++  I I GN ++ D VIRRE ++ EG+  
Sbjct: 316 AFANIDPDTSINDEKQYVDIVYNVEENVLVHINEIIIGGNTKTRDRVIRREFDIHEGEIY 375

Query: 396 NYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKG 455
           N   I+ +KR I  TGYF EVN+ + P +   D + L++ VK+   G   +   Y    G
Sbjct: 376 NSKKIKASKRHIENTGYFEEVNLVEDPVD--KDKIDLKLDVKEKPTGMFSLGAGYSTLDG 433

Query: 456 MGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLED 515
                 +  NN FG GY+  L + F      +YT S  +P+    PI+ GFDL       
Sbjct: 434 FVGTIQLSQNNLFGLGYKLSLKSEFSSKRT-DYTLSFTNPWLFDRPITFGFDLYNLKRSY 492

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH-----G 570
                  +  A+R+   I +    ++        Y    +K KI +I  T  ++     G
Sbjct: 493 YEYTKKSKGGALRLGHAIIKRKLYAY--------YRFAYDKIKIYNIDDTASDYIKDQEG 544

Query: 571 KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG--FGGDSQYHRIGSRASYFYLLSD 628
           + ++ S + S++++TLD+PI P +G        YAG   GGD+ + ++G  +S ++ L  
Sbjct: 545 ETTTISFTPSLVWSTLDSPIDPSRGNRSKIFVKYAGGILGGDNDFVKLGLESSQYFPLF- 603

Query: 629 DSDIVGSLRFGYGCVIPSNKN-LQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIY 687
               VG L    G +   + + L + +++ +   Y +RGF Y  I P+ +  Y  GG  Y
Sbjct: 604 -WKFVGMLHGEIGYLKSLDDDPLPVDERYRLGGMYSVRGFKYGDISPKDETGYDYGGDKY 662

Query: 688 SSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSF---WRVSTGVE 744
              +A V+FP   + E A L+G  F D+  +Y N          G D F    R S G  
Sbjct: 663 VLFNAEVTFP---ISESAKLKGVVFFDAGQVYDN----------GEDYFSYDLRKSAGFG 709

Query: 745 IMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
             W SP+G + + YG  L  + G+   ++ F IG
Sbjct: 710 FRWFSPIGPLRLEYGKKLDRKSGESPDRWDFSIG 743


>gi|168235003|ref|ZP_02660061.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|194443720|ref|YP_002039464.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194734363|ref|YP_002113247.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|205351561|ref|YP_002225362.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|226708915|sp|B5RHG2|YAET_SALG2 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708917|sp|B4SV06|YAET_SALNS RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708919|sp|B4TYD7|YAET_SALSV RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|194402383|gb|ACF62605.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194709865|gb|ACF89086.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197291808|gb|EDY31158.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|205271342|emb|CAR36135.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326626588|gb|EGE32931.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 810

 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 207/818 (25%), Positives = 369/818 (45%), Gaps = 77/818 (9%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ + 
Sbjct: 3   MKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNT 62

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS---RSA 141
           ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  + +   R  
Sbjct: 63  IRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 122

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I  
Sbjct: 123 ESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQINI 182

Query: 202 VGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-S 259
           VGN  +S   L     +R    +++      Y K++++ D E +R++Y DRGYA   + S
Sbjct: 183 VGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDS 242

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQ----EIQKKTLLSLIRIRSGNLYN 315
           +QV     K G  +   I EG+ Y +  + +   L     EI+K     L +I  G LYN
Sbjct: 243 TQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEK-----LTKIEPGELYN 297

Query: 316 PQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
             ++ +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGN
Sbjct: 298 GTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGN 357

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           D S DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   
Sbjct: 358 DTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYK 417

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT-FSVED 494
           VK+ + GS      Y  + G+  +  +  +N+ G GY   +     ++  Q Y+  SV +
Sbjct: 418 VKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGING--TKNDYQTYSELSVTN 475

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES-----AAVRMIVPITESISTSFKYDLRFLQ 549
           PYF    +S G  +     +    D++D +       V +  PI E    + +  L ++ 
Sbjct: 476 PYFTVDGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINE--YNTLRAGLGYV- 532

Query: 550 YGAISEKEKIPSIYTTLIEHGKFSSH------------SISQSIIYNTLDNPIVPRKGML 597
           + ++S  E   +++  L   G++ S             + +    YN LD    P +G  
Sbjct: 533 HNSLSNMEPQVAMWRYLASMGQYPSTNDQDNSFSTDDFTFNYGWTYNKLDRGYFPTEGTR 592

Query: 598 ISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSD--IVGSLRFGYGCVIPSNKNLQLFDQ 655
           I+ +      G D++Y++     + +  + +D    I+G  RFGYG  +   K +  ++ 
Sbjct: 593 INLTGKVTIPGSDNEYYKATLDTATYVPIDNDHKWVILGRTRFGYGDGL-GGKEMPFYEN 651

Query: 656 FSVSSNYYLRGFAYKGIGPR------------VDKKY----------------AIGGKIY 687
           F    +  +RGF    IGP+             D+ Y                A+GG   
Sbjct: 652 FYAGGSSTVRGFQSNTIGPKAVYYPYNPKNYDADEDYDCATQDGAKDMCKSDDAVGGNAM 711

Query: 688 SSASAAVSFPMPLVPER--AGLRGAFFVDSATLYANHVALGADKLEG-----NDSFWRVS 740
           + AS     P P + E+    +R +FF D  T++  +    + +  G     + S  R+S
Sbjct: 712 AVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTN--WDSSQYSGYPDYSDPSNIRMS 769

Query: 741 TGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            G+ + W SPLG +   Y  P +  +GDK +QF F IG
Sbjct: 770 AGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|206560445|ref|YP_002231209.1| outer membrane protein assembly factor YaeT [Burkholderia
           cenocepacia J2315]
 gi|198036486|emb|CAR52383.1| Outer membrane protein assembly factor YaeT [Burkholderia
           cenocepacia J2315]
          Length = 769

 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 197/769 (25%), Positives = 362/769 (47%), Gaps = 71/769 (9%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +V+
Sbjct: 32  VVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGNVV 91

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASI 163
           I+ + ER  I  + F+G      D L   +R+   A    YD+  V+     +K+ Y + 
Sbjct: 92  IVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYLTR 151

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G+    VK     +    ++I + + EG  AKI  I F+GNK +S + L   + + T  +
Sbjct: 152 GFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSTLRDEMQLSTPNW 211

Query: 224 FS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGE 281
           FS + K D+YSKE+++ D EA+R++Y +RGY    + S+QV     K    L   + EGE
Sbjct: 212 FSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHEGE 271

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            YTV  I +   L + ++  L  LI+I+ G+ ++ ++++++++ I          F  V 
Sbjct: 272 PYTVSGIKLSGNLLD-REAELNKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATVN 330

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
            + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + + 
Sbjct: 331 AQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRLA 390

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
            +K R+   GYF+ V+++ +P +  +D V + V V +   G++ +   +     + +   
Sbjct: 391 LSKDRVNRLGYFTNVDVTTVPVDGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSAG 450

Query: 462 IDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDIN 521
           +  +N FG G    +     + + +  T +  DPYF                 DG   I 
Sbjct: 451 VSQDNVFGSGTSLSVNVNTAK-SYRTLTVTQVDPYF---------------TVDGIKRIT 494

Query: 522 DESAAVRMIVPITESISTSFKY-----DLRF---------LQYGAISEKEKI------PS 561
           D     R   P+  S S+SF+      +L+F         + +GA  E+ ++      P 
Sbjct: 495 D--VYYRTYQPLYYSTSSSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQ 552

Query: 562 IYTTLIEHGKFSSHSISQSIIY--NTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR 619
            Y   +      S+++  ++ +  +  D+ ++P +G    ++ +Y    G  QY++   +
Sbjct: 553 SYQDYVNEFGRVSNTVPLTVAWSRDARDSALIPSRGYFTQANIEYGVPVGKIQYYKADLQ 612

Query: 620 ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY------LRGFAYKGIG 673
           A Y+Y  S    +  +L+ GYG  I         + + +  NYY      +RG+    +G
Sbjct: 613 AQYYYSFSRGFILGLNLQGGYGNGIG--------NPYPIFKNYYAGGIGSVRGYEPSSLG 664

Query: 674 PRVDKKY-AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH---VALGADK 729
           PR  K    IGG      +  ++FP+P       LR   F+D   ++ N     + GA+ 
Sbjct: 665 PRDTKTNDPIGGSKMLVGNIELTFPLPGTGYDRTLRVFTFLDGGNVWGNAPGGTSTGANG 724

Query: 730 LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           L       R   GV + W SP+G + +  G PL+  EGD+ Q+F F+IG
Sbjct: 725 L-------RYGYGVGLAWISPIGPLKLSLGFPLQKHEGDQYQKFQFQIG 766


>gi|171318098|ref|ZP_02907267.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria MEX-5]
 gi|171096722|gb|EDT41607.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria MEX-5]
          Length = 768

 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 196/769 (25%), Positives = 362/769 (47%), Gaps = 71/769 (9%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +V+
Sbjct: 31  VVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGNVV 90

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQAYASI 163
           I+ + ER  I  + F+G      D L   +R+   A    YD+  V+     +K+ Y + 
Sbjct: 91  IVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYLTR 150

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY 223
           G+    VK     +    ++I + + EG  AKI  I F+GNK +S ++L   + + T  +
Sbjct: 151 GFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSKLRDEMQLSTPNW 210

Query: 224 FS-FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGE 281
           FS + K D+YSKE+++ D EA+R++Y +RGY    + S+QV     K    L   + EGE
Sbjct: 211 FSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHEGE 270

Query: 282 IYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVK 341
            YTV  I +   L + ++  L  LI+I+ G+ ++ ++++++++ I          F  V 
Sbjct: 271 PYTVSGIKLSGNLLD-REAELNKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATVN 329

Query: 342 TRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIE 401
            + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + + 
Sbjct: 330 AQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRLA 389

Query: 402 RAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGH 461
            +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +   
Sbjct: 390 LSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVTVKVDEKPTGAITLGAGFSSTDKVVLSAG 449

Query: