PSIBLAST alignment of GI: 254780772 and protein with PDB id: 3mc8

>gi|294979844|pdb|3MC8|A Chain A, Potra1-3 Of The Periplasmic Domain Of Omp85 From Anabaena Length = 316
>gi|294979845|pdb|3MC9|A Chain A, Potra1-2 Of The Periplasmic Domain Of Omp85 From Anabaena Length = 316
>gi|294979846|pdb|3MC9|B Chain B, Potra1-2 Of The Periplasmic Domain Of Omp85 From Anabaena Length = 316
 Score = 48.6 bits (113), Expect = 0.004,   Method: Composition-based stats.
 Identities = 9/53 (16%), Positives = 21/53 (39%), Gaps = 2/53 (3%)

Query: 53  IRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSV 105
           IRG       +I   + +  GQ  +   +   ++ ++  G F +V + +    
Sbjct: 243 IRG--RTQDYIITREVELKPGQVFNRNTVQKDLQRVFGTGLFEDVNVSLDPGT 293