PSIBLAST alignment of GI: 254780772 and protein with PDB id: 3og5

>gi|312208014|pdb|3OG5|A Chain A, Crystal Structure Of Bama Potra45 Tandem Length = 166
>gi|312208015|pdb|3OG5|B Chain B, Crystal Structure Of Bama Potra45 Tandem Length = 166
 Score = 50.1 bits (117), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/165 (13%), Positives = 52/165 (31%), Gaps = 18/165 (10%)

Query: 42  GSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD---HAVKNIY-AMGY-FSN 96
             +   +  +E+ G        I     +  G+  +   +      +K +    GY +  
Sbjct: 2   AXDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKXEDDIKKLLGRYGYAYPR 61

Query: 97  VKIKIVDS------VLIIDLIE--RKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDT 148
           V+     +       L +++    R  +  + F GN+  KD  L+   R    A    D 
Sbjct: 62  VQSXPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREXRQXEGAWLGSDL 121

Query: 149 VNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVK 193
           V+     + +     G+    V      +  +   +  V +   +
Sbjct: 122 VDQGKERLNRL----GFFE-TVDTDTQRVPGSPDQVDVVYKVKER 161