BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780772|ref|YP_003065185.1| surface antigen (D15)
[Candidatus Liberibacter asiaticus str. psy62]
         (781 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|255957541|dbj|BAH96605.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957721|dbj|BAH96725.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957725|dbj|BAH96728.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957729|dbj|BAH96731.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957737|dbj|BAH96737.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957741|dbj|BAH96740.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957745|dbj|BAH96743.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957749|dbj|BAH96746.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957753|dbj|BAH96749.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957757|dbj|BAH96752.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957761|dbj|BAH96755.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957769|dbj|BAH96761.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957773|dbj|BAH96764.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957777|dbj|BAH96767.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957781|dbj|BAH96770.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957785|dbj|BAH96773.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957789|dbj|BAH96776.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957793|dbj|BAH96779.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957797|dbj|BAH96782.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957801|dbj|BAH96785.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957805|dbj|BAH96788.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957809|dbj|BAH96791.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957813|dbj|BAH96794.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957817|dbj|BAH96797.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957821|dbj|BAH96800.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957825|dbj|BAH96803.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957829|dbj|BAH96806.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957833|dbj|BAH96809.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|255957837|dbj|BAH96812.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
          Length = 781

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 778/780 (99%), Positives = 779/780 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSA LYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSANLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780


>gi|55380591|gb|AAV50034.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
          Length = 781

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 773/780 (99%), Positives = 777/780 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNI+QAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIEQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYF SGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFLSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEV+ISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVSISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NY LRGFAY+GIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYCLRGFAYEGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLG MGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGTMGVYYGIPLRHREGDKIQQFGFRIGNR 780


>gi|61619810|gb|AAX47431.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|255957765|dbj|BAH96758.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743941|dbj|BAJ23899.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743945|dbj|BAJ23902.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743953|dbj|BAJ23908.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
          Length = 781

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 779/780 (99%), Positives = 780/780 (100%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780


>gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|61619822|gb|AAX47433.1| outer membrane protein [Candidatus Liberibacter asiaticus]
 gi|254040449|gb|ACT57245.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|255957733|dbj|BAH96734.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743937|dbj|BAJ23896.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
 gi|310743949|dbj|BAJ23905.1| putative group 1 outer membrane protein [Candidatus Liberibacter
           asiaticus]
          Length = 781

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 780/780 (100%), Positives = 780/780 (100%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780


>gi|61619816|gb|AAX47432.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 781

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 779/780 (99%), Positives = 779/780 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRA LAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRACLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780


>gi|61619801|gb|AAX47430.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 781

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 778/780 (99%), Positives = 779/780 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISE+EKI SIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEREKILSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780


>gi|158906315|gb|ABW82728.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 781

 Score =  431 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 775/780 (99%), Positives = 777/780 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI+DLIE+K INHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLILDLIEKKNINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAK NSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKKNSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT INRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTGINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780


>gi|224825021|ref|ZP_03698127.1| outer membrane protein assembly complex, YaeT protein [Lutiella
           nitroferrum 2002]
 gi|224602692|gb|EEG08869.1| outer membrane protein assembly complex, YaeT protein [Lutiella
           nitroferrum 2002]
          Length = 762

 Score =  424 bits (1089), Expect = e-116,   Method: Composition-based stats.
 Identities = 180/768 (23%), Positives = 323/768 (42%), Gaps = 15/768 (1%)

Query: 23  FQMGFIILFYA-IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
            ++  +    A +F +SA   +   +V+ I + G        + + +P+ VG + +D   
Sbjct: 1   MRIKLVAAAIAGLFSMSAAMAAEPFVVKDIRVEGLQRTEPGTVFNYMPLKVGDTFTDEKA 60

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---S 138
             A+K ++A G+F++V+++    VLI+ +IER +I  L  SG      DQLK  ++    
Sbjct: 61  KEAIKALFATGFFNDVRMEAQGDVLIVSVIERPVITQLNISGAKEFDKDQLKKALKENGL 120

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
             +  +D+  ++  V  +K+ Y S G  +V +      +    + +T  I EGV AKI  
Sbjct: 121 AESRVFDQGLLDGAVQELKRQYYSRGKYSVEITPSVTKLERNRVAVTLDIVEGVTAKIKE 180

Query: 199 IRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           IR VG K +    L    S           K + YSK+++S D E ++AFY ++GY    
Sbjct: 181 IRIVGAKAFDQDTLLGQFSLTTGDWLSWITKDNQYSKQKLSGDLEKLKAFYQNQGYLEFN 240

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           + S  +        + +            +    +   ++ +  L  LI+ ++G++++ +
Sbjct: 241 IDSTQVSISADKEDMFLTININEGQRYTISDVKLAGDLKVPEAELRKLIQFKAGDVFSRE 300

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +S   IS    +    F  V      D  KR V     +D G   YV+R+ I GN +
Sbjct: 301 KVNDSVTAISDRLGNDGYAFANVNALPEIDREKRQVAFTLFLDPGRKTYVRRVNIAGNTK 360

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   EG P     I+R+K R+   GYF +VN+      D  D V + +++K
Sbjct: 361 TRDEVVRRELRQLEGAPYASDKIKRSKERVELLGYFEDVNVETPAVADTPDQVDMNINLK 420

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHA----VQNYTFSVE 493
           +   GS+     +   +G+   G +  +N FG G         G+      +        
Sbjct: 421 ERPTGSISAGIGFVQGQGLVFSGSVSQSNIFGSGKSLSAGISTGKVNKSASIAFNDPYFT 480

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                                          AA +  VPITE    +    +        
Sbjct: 481 VDGVSLGYNLYTRTYDAQEDNVSKYKTRTTGAAAKFGVPITEFDRINLSLGVEQTAITTF 540

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           S+  +    +         +  S + S   +T D+ + P +G ++ +  D    G D QY
Sbjct: 541 SDSPQRYLDFVDKYGKSANTLLS-TISWSRDTRDSALWPTRGAVLRAGVDIGLPGLDLQY 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +R+  + ++++ LS    ++ +   GY      +  L  F  F +     +RG+    IG
Sbjct: 600 YRLSHQQTWYFPLSKTFTLMLNGEVGYADGYGKSATLPFFQNFYMGGLGSVRGYETGSIG 659

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           P+      +GG      +  + FP P + +   +R + F D  +L+ ++V+         
Sbjct: 660 PKDTNGDFLGGTTKVVGNVELLFPFPGMRDNKSVRTSVFFDVGSLWDSNVSGSTP----- 714

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R STG  + W SP+G M   Y +PL+  EGDK Q F F++G   
Sbjct: 715 SDGLRYSTGAALTWLSPMGPMKFSYAVPLKKEEGDKKQSFQFQLGTVF 762


>gi|165882007|gb|ABY71267.1| outer membrane protein [Candidatus Liberibacter asiaticus]
          Length = 781

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 771/780 (98%), Positives = 773/780 (99%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIE RGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIETRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVIL RIPVVV QS SDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILFRIPVVVRQSFSDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSI PT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSIFPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGY+LIFQIDEGEIYTVGNI IQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYLLIFQIDEGEIYTVGNIFIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT INRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTGINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLIS+
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLIST 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780


>gi|74316811|ref|YP_314551.1| surface antigen (D15) [Thiobacillus denitrificans ATCC 25259]
 gi|74056306|gb|AAZ96746.1| surface antigen (D15) [Thiobacillus denitrificans ATCC 25259]
          Length = 770

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 177/766 (23%), Positives = 312/766 (40%), Gaps = 10/766 (1%)

Query: 24  QMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
                +   A+F   A       +V+ I + G        + S +PV VG +++D     
Sbjct: 7   LTRLTLALAAVFVTHAASAEAPFVVKDIRVEGIQRTEAGTVFSYLPVKVGDTMTDEKTAA 66

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLK---MIVRSRS 140
           A+K +YA G+F +V+++  D V+I+ + ER  I  +  SG     +D LK          
Sbjct: 67  AIKALYATGFFKDVRLEARDGVVIVTVQERPSIAKITLSGIKEFSEDDLKAGLKQTGLAE 126

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
               D   V      +++ Y + G   V +K     +    + + + + EG  AKI  I 
Sbjct: 127 GRVLDRSLVEKAEQELQRQYFNRGKYAVEIKSTLTPLERNRVAVQFDVVEGDSAKIRQIN 186

Query: 201 FVGNKNYSHAR-LERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGNK +     L ++ S   +    + K D YSK R++ D EA+R+FY +RGY    V 
Sbjct: 187 IVGNKAFKEKELLNQLTSTTPNWLTWYTKNDQYSKTRLAGDLEALRSFYLNRGYLEFNVD 246

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        + I            +    +    + +  L  LI +  G ++    +
Sbjct: 247 STQVSISPDKQGIYITVNVTEGPQYRVSDVKLAGQMLVPEAELRKLITLEPGEVFERDRL 306

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
            ES++KI     +    F  V      D  K  V     +D G  +YV RI + GN ++ 
Sbjct: 307 TESTKKIGDRLGNDGYAFANVNAVPELDKEKSTVAFTLFVDPGRRVYVNRINVAGNTRTR 366

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +   I R++ R+   GYF+EVNI        +D V + VSV + 
Sbjct: 367 DEVVRREIRQMEGAYYDAEKINRSRDRLNRLGYFNEVNIETPSVAGTTDQVDVNVSVAEK 426

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVEDPY 496
           S G++ +   +   +G+ + G +  +N FG G R                +YT       
Sbjct: 427 STGNIMLGAGFSSSEGLVLSGSVSQSNVFGTGNRLSAQINSGSVNTVYSLSYTNPYYTID 486

Query: 497 FLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
            +                DG  D    +    +   +  +      + L + Q    ++ 
Sbjct: 487 GISLGYDIYRRDVDASELDGVGDYETSTYGAGVRFGLPINERDFISFGLTYEQTSITTDA 546

Query: 557 EKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
           +   +      E G    +  +  S   +T ++ + P +G+    + +     G  +Y++
Sbjct: 547 DSPTNYQKFEEEFGSDNDTVRVDTSWARDTRNSHLFPTRGLFQRVAAEVGTPLGSLEYYK 606

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           +  +   ++ LS    ++ +   G G  + S+K L  F  F       +RGF    +GP+
Sbjct: 607 LSFQHQQYFPLSKRFTLMLNGEVGVGGGL-SDKPLPFFKNFYAGGTSSVRGFENGTLGPK 665

Query: 676 VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS 735
            D+  A+GG      +A + FP+P + +   LR + FVD+   +  +      +      
Sbjct: 666 DDENNALGGDKRVVGNAELFFPLPGLKDDQSLRMSAFVDAGATFGPNDDQHRYE-NFAFG 724

Query: 736 FWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             R S GV ++W SPLG +      PL  +E D+ + F F +GN  
Sbjct: 725 DLRYSAGVAVLWVSPLGPLKFSLAQPLSSKEDDEEEMFQFTLGNVF 770


>gi|300715404|ref|YP_003740207.1| outer membrane protein assembly factor YaeT [Erwinia billingiae
           Eb661]
 gi|299061240|emb|CAX58349.1| Outer membrane protein assembly factor YaeT [Erwinia billingiae
           Eb661]
          Length = 800

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 179/798 (22%), Positives = 321/798 (40%), Gaps = 43/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VY ++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYAADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVSDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVQVLRDGTTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L    S      +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NVVGNKAFSSDELISRFSLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  + +         +  L +++ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLSGVVVNGSMAGHSAEVEQLSKVKPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV T+   + A + V +   +D G+   V+++  EGND S
Sbjct: 301 VTKMEDDIKKMLGRYGYAYPRVSTQPEINDADKTVKLHVNVDAGNRYSVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E+ K R+  TGYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVEQGKERLNRTGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      Y  + G+  +  +   N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQVGVTQENWLGTGNTVGISGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +              +  P+ E+ +              + 
Sbjct: 481 DGVSLGGRVFYNDFKADDADLSDYTNKSYGLDGTLGFPVNENNTLRVGLGYVHNDLSNMQ 540

Query: 555 EKEKIPSIYTTLIE--------HGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +               + +    YN LD    P  G   + +     
Sbjct: 541 PQVSMFRYLRSVGQDPSLSEDADYAADDFTFNYGWTYNNLDRGFFPTSGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+ +++       +  L+ D   V     + GYG  + S K L  ++ F    +  +
Sbjct: 601 PGSDNAFYKATLDTQQYVPLNQDRTWVLLGRGKVGYGDGL-SGKELPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLVPERA--G 706
           RGF    IGP+                 D   A+GG   ++ASA +  P P + E+    
Sbjct: 660 RGFRSNTIGPKAAYYNNGSDTCSTGTLCDSSDAVGGNALATASAELITPTPFLSEKYANS 719

Query: 707 LRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
           +R + FVD+ T++  +    A+          +    R+S G+ + W SPLG +   Y  
Sbjct: 720 VRTSLFVDAGTVWDTNWENTAETRAAGIPDYSDPGNIRMSAGLALQWMSPLGPLVFSYAQ 779

Query: 761 PLRHREGDKIQQFGFRIG 778
           P +  +GDK +QF F IG
Sbjct: 780 PFKKYDGDKAEQFQFNIG 797


>gi|302136428|gb|ADK94171.1| putative surface antigen [Edwardsiella tarda]
          Length = 795

 Score =  412 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 183/794 (23%), Positives = 322/794 (40%), Gaps = 40/794 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  ++L   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ +YA G F +V++    + LI+ + ER  I  + FSGN ++KD+ LK  +     R
Sbjct: 61  NTIRALYATGNFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  N  VK     +    +++  V  EG  A+I  I
Sbjct: 121 VGEALDRTTLSSIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRG--YAAVK 257
             VGN  +S A L     +R    +     D   +++    +      Y+          
Sbjct: 181 NIVGNHAFSSAELLGHFQLRDDVPWWNLMADRKYQKQKLAGDLEALRSYYLDRGYARFAI 240

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S+QV     K G  +   I E E Y +  + +   +       +  L ++  G LYN  
Sbjct: 241 NSTQVSLTPDKKGIYITINITESEQYKLEGVDVTGNMAGYS-AEITRLTKVEPGELYNGA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +  ++I +        +  V+T+   +   + V +   ID G+  YV++I   GND 
Sbjct: 300 KVTKMEDEIKQLLGRYGYAYPCVQTQPEINDKDKTVVLHMNIDAGNRYYVRQIRFVGNDT 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S D+V+RRE+   EG  +    +E+ K R+  TGYF  V++         D V +   VK
Sbjct: 360 SKDAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVE 493
           + + GS      Y  + G+  +  +  +N+ G G    +      +              
Sbjct: 420 ERNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGNVVAINGTKNDYQTYAELSLTDPYFT 479

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        D +    +      +       +  PI E+ S              +
Sbjct: 480 VNGVSLGGRLFYNDFKANDADLSDYTNSSYGFDGTLGFPINENNSLRTGLGYVHNDLSDM 539

Query: 554 SEKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
             +  +     ++ ++         K   ++ +    YN LD    P  G   S +    
Sbjct: 540 QPQVAMWRYLRSVGQNPSDSQRASYKADDYTWTAGWAYNNLDRGFFPTAGSKASLNGKIT 599

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++   +  ++ ++ D   V  G  R GYG      K +  ++ F    +  
Sbjct: 600 LPGSDNEYYKLTFDSQSYFPINQDRTWVVLGRTRLGYGNGFG-GKEMPFYENFYAGGSGT 658

Query: 664 LRGFAYKGIGP--------------RVDKKYAIGGKIYSSASAAVSFPMPLVPERA--GL 707
           +RGF    IGP              +     A+GG   + AS  +  P P V E+    L
Sbjct: 659 VRGFQSNNIGPKAVYLNGDGSVDQSKTGDNDAVGGNAMAVASLELITPTPFVSEQYANSL 718

Query: 708 RGAFFVDSATLYANHVALGADKLEGNDS---FWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
           R + F+D+ T++  +    A     + S     R+S G+ + W SPLG +   Y  P++ 
Sbjct: 719 RTSVFMDAGTVWDTNWDQAAYPTLPDYSKATNVRLSAGIALQWMSPLGPLVFSYAQPVKK 778

Query: 765 REGDKIQQFGFRIG 778
            EGDK +QF F IG
Sbjct: 779 YEGDKAEQFQFNIG 792


>gi|269138101|ref|YP_003294801.1| conserved outer membrane protein [Edwardsiella tarda EIB202]
 gi|267983761|gb|ACY83590.1| conserved outer membrane protein [Edwardsiella tarda EIB202]
 gi|304558145|gb|ADM40809.1| Outer membrane protein assembly factor YaeT precursor [Edwardsiella
           tarda FL6-60]
          Length = 795

 Score =  410 bits (1052), Expect = e-112,   Method: Composition-based stats.
 Identities = 185/794 (23%), Positives = 324/794 (40%), Gaps = 40/794 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  ++L   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ +YA G F +V++    + LI+ + ER  I  + FSGN ++KD+ LK  +     R
Sbjct: 61  NTIRALYATGNFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  N  VK     +    +++  V  EG  A+I  I
Sbjct: 121 VGEALDRTTLSSIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRG--YAAVK 257
             VGN  +S A L     +R    +     D   +++    +      Y+          
Sbjct: 181 NIVGNHAFSSAELLGHFQLRDDVPWWNLMADRKYQKQKLAGDLEALRSYYLDRGYARFAI 240

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S+QV     K G  +   I EGE Y +  + +   +       +  L ++  G LYN  
Sbjct: 241 NSTQVSLTPDKKGIYITINITEGEQYKLEGVDVTGNMAGYS-AEITRLTKVEPGELYNGA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +  ++I +        + RV+T+   +   + V +   ID G+  YV++I   GND 
Sbjct: 300 KVTKMEDEIKQLLGRYGYAYPRVQTQPEINDKDKTVVLHMNIDAGNRYYVRQIRFVGNDT 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S D+V+RRE+   EG  +    +E+ K R+  TGYF  V++         D V +   VK
Sbjct: 360 SKDAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVE 493
           + + GS      Y  + G+  +  +  +N+ G G    +      +              
Sbjct: 420 ERNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGNVVAINGTKNDYQTYAELSLTDPYFT 479

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        D +    +      +       +  PI E+ S              +
Sbjct: 480 VNGVSLGGRLFYNDFKANDADLSDYTNSSYGFDGTLGFPINENNSLRTGLGYVHNDLSDM 539

Query: 554 SEKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
             +  +     ++ ++         K   ++ +    YN LD    P  G   S +    
Sbjct: 540 QPQVAMWRYLRSVGQNPSDSQRASYKADDYTWTAGWAYNNLDRGFFPTAGSKASLNGKIT 599

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++   +  ++ ++ D   V  G  R GYG      K +  ++ F    +  
Sbjct: 600 LPGSDNEYYKLTFDSQSYFPINQDRTWVVLGRTRLGYGNGFG-GKEMPFYENFYAGGSGT 658

Query: 664 LRGFAYKGIGP--------------RVDKKYAIGGKIYSSASAAVSFPMPLVPERA--GL 707
           +RGF    IGP              +     A+GG   + AS  +  P P V E+    L
Sbjct: 659 VRGFQSNNIGPKAVYLNGDGSVDQSKTGDNDAVGGNAMAVASLELITPTPFVSEQYANSL 718

Query: 708 RGAFFVDSATLYANHVALGADKLEGNDS---FWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
           R + F+D+ T++  +    A     + S     R+S G+ + W SPLG +   Y  P++ 
Sbjct: 719 RTSVFMDAGTVWDTNWDQAAYPTLPDYSKATNVRLSAGIALQWMSPLGPLVFSYAQPVKK 778

Query: 765 REGDKIQQFGFRIG 778
            EGDK +QF F IG
Sbjct: 779 YEGDKAEQFQFNIG 792


>gi|293394711|ref|ZP_06639003.1| protective surface antigen D15 [Serratia odorifera DSM 4582]
 gi|291422837|gb|EFE96074.1| protective surface antigen D15 [Serratia odorifera DSM 4582]
          Length = 800

 Score =  409 bits (1050), Expect = e-111,   Method: Composition-based stats.
 Identities = 184/798 (23%), Positives = 327/798 (40%), Gaps = 43/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVTDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +++  L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHAFTNDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  + +         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSDVVVNGNLAGHSAEVAQLTKIEPGELYNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+T+   + A + V +   ID G+  YV+RI+ EGND S
Sbjct: 301 VTKMEDNIKKMLGRYGYAYPRVQTQPEINDADKTVKLHVNIDAGNRFYVRRIKFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E+ K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEQGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + G+      Y  + G+  +  +  +N+ G GY   ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGVSGTKNDYQTYAELSATNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSDYTNSSYGVDGTLGFPINENNSLRAGLGYVHNSLSDMQ 540

Query: 555 EKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +          K    +++    YN LD    P  G   + +     
Sbjct: 541 PQIAMWRYLESMGQDPNTTDRASYKADDFTLNLGWTYNNLDRGYFPTSGNRTTLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++Y+++   +  +  ++DD   V     R GY   +   K +  ++ F    +  +
Sbjct: 601 PGSDNEYYKVTLDSVQYVPINDDRTWVLLGRGRLGYADGLG-GKEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV-----------------DKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           RGF    IGP+                      A+GG   + AS  +  P P + E+   
Sbjct: 660 RGFQSNTIGPKAVYYNSNSYSCSNGTKICGSDDAVGGNAMAVASMELITPTPFISEKYAN 719

Query: 706 GLRGAFFVDSATLYANHVALGAD-----KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
            +R + FVD+ T++  +                    RVS G+ + W SPLG +   Y  
Sbjct: 720 SVRTSLFVDAGTVWDTNWDSSQTTGYDIPDYSKPGNIRVSAGIALQWMSPLGPLVFSYAN 779

Query: 761 PLRHREGDKIQQFGFRIG 778
           PL+  EGDK +QF F IG
Sbjct: 780 PLKDYEGDKSEQFQFNIG 797


>gi|294635128|ref|ZP_06713639.1| outer membrane protein assembly complex, YaeT protein [Edwardsiella
           tarda ATCC 23685]
 gi|291091505|gb|EFE24066.1| outer membrane protein assembly complex, YaeT protein [Edwardsiella
           tarda ATCC 23685]
          Length = 795

 Score =  409 bits (1050), Expect = e-111,   Method: Composition-based stats.
 Identities = 186/794 (23%), Positives = 325/794 (40%), Gaps = 40/794 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  ++L   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ +YA G F +V++    + LI+ + ER  I  + FSGN ++KD+ LK  +     R
Sbjct: 61  NTIRALYATGNFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  N  VK     +    +++  V  EG  A+I  I
Sbjct: 121 VGEALDRTTLSSIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRG--YAAVK 257
             VGN  +S A L     +R    +     D   +++    +      Y+          
Sbjct: 181 NIVGNHAFSSADLLGHFQLRDDVPWWNLMADRKYQKQKLAGDLEALRSYYLDRGYARFAI 240

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S+QV     K G  +   I EG+ Y +  + +   +       +  L ++  G LYN  
Sbjct: 241 NSTQVSLTPDKKGIYITINITEGDQYKLQGVDVTGNMAGYS-AEIGRLTKVEPGELYNGA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +  ++I +        + RV+T+   +   + V +   ID G+  YV++I   GND 
Sbjct: 300 KVTKMEDEIKQLLGRYGYAYPRVQTQPEINDKDKTVILHMNIDAGNRYYVRQIRFVGNDT 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S DSV+RRE+   EG  +    +E+ K R+  TGYF  V++         D V +   VK
Sbjct: 360 SKDSVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVIYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVE 493
           + + GS      Y  + G+  +  +  +N+ G G    +      +              
Sbjct: 420 ERNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGNVVAINGTKNDYQTYAELSLTDPYFT 479

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        D +    +      +       +  PI E+ S              +
Sbjct: 480 VNGVSLGGRLFYNDFKANDADLSDYTNSSYGFDGTLGFPINENNSLRTGLGYVHNDLSDM 539

Query: 554 SEKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
             +  +     ++ ++         K + ++ +    YN LD    P  G   S +    
Sbjct: 540 QPQVSMWRYLRSVGQNPSDSNSASYKANDYTWTAGWAYNNLDRGFFPTAGNKASLNGKIT 599

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++   +  ++ ++ D   V  G  R GYG      K +  ++ F    +  
Sbjct: 600 LPGSDNEYYKLTFDSQSYFPINQDRTWVVLGRTRLGYGNGFG-GKEMPFYENFYAGGSGT 658

Query: 664 LRGFAYKGIGP--------------RVDKKYAIGGKIYSSASAAVSFPMPLVPERA--GL 707
           +RGF    IGP              +     A+GG   + AS  +  P P V E+    L
Sbjct: 659 VRGFQSNNIGPKAVYLNSNGSVDTSKTSDNDAVGGNAMAVASLELITPTPFVSEQYANSL 718

Query: 708 RGAFFVDSATLYANHVALGADKLEGNDS---FWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
           R + F+D+ T++  +    A     + S     R+S GV + W SPLG +   Y  P++ 
Sbjct: 719 RTSVFMDAGTVWDTNWDHAAYPALPDYSKATNVRMSAGVALQWMSPLGPLVFSYAQPVKK 778

Query: 765 REGDKIQQFGFRIG 778
            EGDK +QF F IG
Sbjct: 779 YEGDKSEQFQFNIG 792


>gi|238918782|ref|YP_002932296.1| outer membrane protein assembly factor YaeT [Edwardsiella ictaluri
           93-146]
 gi|259710199|sp|C5B7R5|YAET_EDWI9 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|238868350|gb|ACR68061.1| outer membrane protein assembly complex, YaeT protein, putative
           [Edwardsiella ictaluri 93-146]
          Length = 795

 Score =  409 bits (1049), Expect = e-111,   Method: Composition-based stats.
 Identities = 183/794 (23%), Positives = 324/794 (40%), Gaps = 40/794 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  ++L   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLLASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ +YA G F +V++    + LI+ + ER  I  + FSGN ++KD+ LK  +     R
Sbjct: 61  NTIRALYATGNFEDVRVLRDGNNLIVQVKERPTIASITFSGNKSVKDEMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  N  VK     +    +++  V  EG  A+I  I
Sbjct: 121 VGEALDRTTLSSIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKLVFTEGKSAQIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRG--YAAVK 257
             VGN  +S A L     +R    +     D   +++    +      Y+          
Sbjct: 181 NIVGNHAFSSAELLGHFQLRDDVPWWNLMADRKYQKQKLAGDLEALRSYYLDRGYARFTI 240

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S+QV     K G  +   I EG+ Y +  + +   +       +  L ++  G LYN  
Sbjct: 241 NSTQVSLTPDKKGIYITINITEGDQYKLEGVDVTGNMAGYS-AEITRLTKVEPGELYNGA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +  ++I +        + RV+T+   +   + V +   ID G+  YV++I   GND 
Sbjct: 300 KVTKMEDEIKQLLGRYGYAYPRVQTQPEINDKDKTVILHMNIDAGNRYYVRQIRFVGNDT 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S D+V+RRE+   EG  +    +E+ K R+  TGYF  V++         D V +   VK
Sbjct: 360 SKDAVLRREMRQMEGSWLGSDQVEQGKERLNRTGYFENVDVETQRVPGTPDQVDVVYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVE 493
           + + GS      Y  + G+  +  +  +N+ G G    +      +              
Sbjct: 420 ERNTGSFNFGIGYGTESGISFQVGVQQDNWLGTGNVVAINGTKNDYQTYAELSLTDPYFT 479

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        D +  + +      +       +  PI E+ S              +
Sbjct: 480 VNGVSLGGRLFYNDFKANNADLSDYTNSSYGFDGTLGFPINENNSLRTGLGYVHNDLSDM 539

Query: 554 SEKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
             +  +     ++ ++         K   ++ +    YN LD    P  G   S +    
Sbjct: 540 QPQVAMWRYLRSVGQNPSDSERASYKADDYTWTAGWAYNNLDRGFFPTAGSKASLNGKIT 599

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++   +  ++ ++ D   V  G  R GYG      K +  ++ F    +  
Sbjct: 600 LPGSDNEYYKLTFDSQSYFPINQDRTWVVLGRTRLGYGNGFG-GKEMPFYENFYAGGSGS 658

Query: 664 LRGFAYKGIGP--------------RVDKKYAIGGKIYSSASAAVSFPMPLVPERA--GL 707
           +RGF    IGP              +     A+GG   + AS  +  P P V E+    L
Sbjct: 659 VRGFQSNNIGPKAVYLNSDGSVDQNKTGGNDAVGGNAMAVASLELITPTPFVSEQYANSL 718

Query: 708 RGAFFVDSATLYANHVALGADKLEGNDS---FWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
           R + F+D+ T++  +          + S     R+S G+ + W SPLG +   Y  P++ 
Sbjct: 719 RTSVFMDAGTVWDTNWDQTTYPTLPDYSKATNVRLSAGIALQWMSPLGPLVFSYAQPVKK 778

Query: 765 REGDKIQQFGFRIG 778
            EGDK +QF F IG
Sbjct: 779 YEGDKSEQFQFNIG 792


>gi|238026911|ref|YP_002911142.1| outer membrane protein, OMP85 family protein [Burkholderia glumae
           BGR1]
 gi|237876105|gb|ACR28438.1| Outer membrane protein, OMP85 family protein [Burkholderia glumae
           BGR1]
          Length = 768

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 163/774 (21%), Positives = 328/774 (42%), Gaps = 17/774 (2%)

Query: 18  YFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSIS 77
           + P  F    +          A + +   +V+ I+I G   V    + + +P+  G + +
Sbjct: 2   FKPHRFVPKTVAAAALAVHGLAAHATTPFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFT 61

Query: 78  DADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR 137
           D     A++ +YA G+F++VKI    +V+I+ + ER  I+ + F+G      D L   ++
Sbjct: 62  DDKASEAIRALYATGFFNDVKIATQGNVVIVQVQERPAISSIDFTGIKEFDKDNLLKALK 121

Query: 138 ---SRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
                    YD+  V+     +K+ Y + GY    V      +    ++I + + EG  A
Sbjct: 122 AVGLSQGRYYDKSLVDKAEQELKRQYLTRGYYAAEVTTTVTPVDANRVSILFSVAEGPSA 181

Query: 195 KINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGY 253
           KI  I F+GNK +S + L   +     + +  + K D+YSKE+++ D E +R++Y +RGY
Sbjct: 182 KIRQINFIGNKTFSSSTLRNEMQLSTPNWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGY 241

Query: 254 AAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
               + S  +        + +            +    +     ++  L  L++I++G+ 
Sbjct: 242 LEFNIDSTQVSISPDKKDMYLTVTLHEGEPYTISSVKLAGNLLDREAELQKLVKIKAGDR 301

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           ++ ++++++++ I          F  V  + N D +   V +  ++D G  +YV+RI + 
Sbjct: 302 FSAEKLQQTTKAIVDKLGEYGYAFATVNAQPNIDQSTHKVGLTLMVDPGRRVYVRRINVV 361

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE+   E    +   +  +K RI   GYF++V+++ +P    SD V + 
Sbjct: 362 GNSRTRDEVVRREMRQLESSWFDSGRLALSKDRINRLGYFTDVDVTTVPVEGTSDEVDVN 421

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V +   G++ +   +     + +   I  +N FG G    +     R         V+
Sbjct: 422 VKVTEKPTGAITLGAGFSSTDKVVLSAGISQDNVFGSGTSLSVNVNTARSYRTLTVTQVD 481

Query: 494 DPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
             + +      + +         +  + S  I      ++  +P +E+ +  F       
Sbjct: 482 PYFTVDGIKRITDVFYRTYQPLYYSTNSSFRIITAGGDLKFGIPFSETDTVFFGAGFEQN 541

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
           +             Y         ++  ++     +  D+ ++P +G    ++ +Y    
Sbjct: 542 RLDIDDNTPASYKAYVQQFGR-VSNTVPLTIGWSRDARDSALIPSRGYFTQANAEYGAPV 600

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
              QY+++  +A Y+Y  +    +  +L+ GYG  I ++    +F  +       +RG+ 
Sbjct: 601 DKIQYYKMDVQAQYYYSFARGFILGLNLQGGYGNGIGNS--YPIFKNYYAGGIGSVRGYE 658

Query: 669 YKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
              +GPR       IGG      +  ++FP+P       LR   F+D   ++ N      
Sbjct: 659 PSSLGPRDATTNDPIGGSKMVVGNIELTFPLPGTGYDRTLRVFTFLDGGNVWGNV----P 714

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                  +  R   GV + W SP+G + +  G PL+  EGD+ Q+F F+IG   
Sbjct: 715 GGNSTGANGLRYGYGVGLAWISPIGPLKLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|330817431|ref|YP_004361136.1| Outer membrane protein, OMP85 family protein [Burkholderia gladioli
           BSR3]
 gi|327369824|gb|AEA61180.1| Outer membrane protein, OMP85 family protein [Burkholderia gladioli
           BSR3]
          Length = 768

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 164/775 (21%), Positives = 327/775 (42%), Gaps = 19/775 (2%)

Query: 18  YFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSIS 77
           + P  F    +          A + ++  +V+ I+I G   V    + + +P+  G + +
Sbjct: 2   FKPHRFVPKTVAAAALAVHGLAAHATSPFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFT 61

Query: 78  DADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV- 136
           D     A++ +YA G+F++VKI    +V+I+ + ER  I+ + F+G      D L   + 
Sbjct: 62  DDKASEAIRALYATGFFNDVKIATEGNVVIVQVQERPAISSIDFTGIKEFDKDNLTKALR 121

Query: 137 --RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
                    YD+  V+     +K+ Y + GY    V      +    ++I + + EG  A
Sbjct: 122 AVGLSQGRYYDKSLVDKAEQELKRQYLTRGYYAAEVTTTVTPVDANRVSILFSVAEGPSA 181

Query: 195 KINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGY 253
           KI  I F+GNK +S + L   +     + +  + K D+YSKE+++ D E +R++Y +RGY
Sbjct: 182 KIRQINFIGNKTFSTSTLRNEMQLSTPNWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGY 241

Query: 254 AAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
               + S  +        + +            +    S     ++  L  L++I++G  
Sbjct: 242 LEFNIDSTQVSISPDKKDMYLTLTLHEGEPYTISSIQLSGNLLDRQAELQKLVKIKAGER 301

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           ++ ++++ +++ I          F  V  + N D A   V +  ++D    +YV+RI + 
Sbjct: 302 FSAEKLQATTKAIVDKLGEYGYAFATVNAQPNIDQASHKVALTLVVDPSRRVYVRRINVV 361

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE+   E    +   +  +K R+   GYF++V+++ +P    SD V + 
Sbjct: 362 GNTRTRDEVVRREMRQLESSWFDSGRLALSKDRVNRLGYFTDVDVTTVPVEGTSDQVDVN 421

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V +   G++ +   +     + +   I  +N FG G    +     R         V+
Sbjct: 422 VKVTEKPTGAITLGAGFSSTDKVVLSAGISQDNVFGSGTSLSVNVNTARSYRTLTVTQVD 481

Query: 494 DPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
             + +      + +         +  + S  I      ++  +P +E  +  F       
Sbjct: 482 PYFTVDGIKRITDVFYRTYQPLYYSTNSSFRIITAGGDMKFGIPFSEVDTVFFGVGFEQN 541

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHS-ISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
           +    ++  +    Y    + G+ S+   ++     +  D+ ++P +G    ++ +Y   
Sbjct: 542 RLDVDADTPQSYQDYVQ--QFGRVSNSVPLTIGWSRDARDSALIPSRGYFTQANAEYGAP 599

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
               QY+++  +A Y+Y  +    +  + + GYG  I +     +F  +       +RG+
Sbjct: 600 VDKIQYYKMDVQAQYYYSFARGFILGLNFQGGYGNGIGNA--YPIFKNYYAGGIGSVRGY 657

Query: 668 AYKGIGPRVD-KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALG 726
               +GPR       IGG      +  ++FP+P       LR   F D   ++ N     
Sbjct: 658 EPSSLGPRDSKTNDPIGGSKMVVGNIELTFPLPGTGYDRTLRVFTFFDGGNVWGN----A 713

Query: 727 ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                   +  R   GV + W SP+G + +  G PL+  EGD+ Q+F F+IG   
Sbjct: 714 PGGTSTGANGLRYGYGVGLAWISPIGPLKLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|186476088|ref|YP_001857558.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           phymatum STM815]
 gi|184192547|gb|ACC70512.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           phymatum STM815]
          Length = 770

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 160/753 (21%), Positives = 315/753 (41%), Gaps = 15/753 (1%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
             + +   +V+ I I G   V    + S +P+  G + +D     A++ +YA G+F++VK
Sbjct: 23  VAHATTPFVVKDIRIEGLQRVEPGTVFSYLPIKQGDTFTDEKASEAIRALYATGFFNDVK 82

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHN 155
           I     V+++ ++ER  I  + FSG +  + D L   +          YD+  V+     
Sbjct: 83  IATEGDVVVVQVLERPAIGTIDFSGLHEFEKDNLVKALRAVGLSQGRYYDKALVDKAEQE 142

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           +K+ Y + G+    V      I    + + + + EG  AKI  I F+GNK +S   L   
Sbjct: 143 LKRQYLTRGFYAAEVTTTITPIDRNRVAVLFAVIEGPSAKIRQINFIGNKAFSTGTLRDE 202

Query: 216 IS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLI 274
           +     + +  + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +
Sbjct: 203 MQLSTPNWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSITPDKKDMYL 262

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
                       N    +     ++  L  LI+I+ G+ ++ ++++ +++ I        
Sbjct: 263 TVTLHEGEPYTINSIKLAGNLLDREAELNKLIKIKPGDRFSAEKLQATTKAIVDKLGEYG 322

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F  V      D     VD+   +D    +YV+RI + GN ++ D V+RRE+   E   
Sbjct: 323 YAFATVNALPQIDQEHHKVDLTLQVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSW 382

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDK 454
            + + +  +K RI   GYF++V+++ +P     D V + V V +   G++ +   +    
Sbjct: 383 FDSNRLALSKDRINRLGYFTDVDVTTVPVEGTPDQVDVDVKVAEKPTGAITLGAGFSSTD 442

Query: 455 GMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQ 509
            + +   +  +N FG G    +     +         V+  + +      + +       
Sbjct: 443 KVVLSAGVSQDNVFGSGTSLSVNVNTAKTYRTLTVTQVDPYFTVDGIKRITDVYYRTYEP 502

Query: 510 KTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH 569
             +  D S  I      ++  +P +E  +  F            +   +    Y      
Sbjct: 503 LYYSTDSSFRIVTMGGDLKFGIPFSEVDTVYFGAGFEQNTLDVDANTPQAYKNYVQDFGR 562

Query: 570 GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD 629
              ++  ++     +  D+ +VP +G    ++ +Y    G ++Y++   +A Y+Y  S  
Sbjct: 563 -VSNNVPLTVGWSRDARDSALVPSRGYFTQANAEYGTPIGGTEYYKADLQAQYYYSFSRG 621

Query: 630 SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYS 688
             I  +++ GYG  I +     +F  +       +RG+    +GPR       IGG    
Sbjct: 622 FVIGFNVQGGYGNGIGNA--YPIFKNYYAGGIGSVRGYEPSSLGPRDKVTNDPIGGNKMF 679

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWN 748
             +  ++FP+P       LR   F+D+  ++ +    G        +  R   GV + W 
Sbjct: 680 VTNVELTFPLPGTGYDRTLRVFTFLDAGNVWGDSRQGG--DTTVGSNGLRYGYGVGLAWI 737

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           SP+G + +  G PL+   GD+ Q+F F+IG   
Sbjct: 738 SPIGPLKLSLGFPLQKHTGDQYQKFQFQIGTAF 770



 Score = 53.6 bits (126), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/169 (15%), Positives = 57/169 (33%), Gaps = 18/169 (10%)

Query: 34  IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYA--- 90
           ++    ++      +  I++ G     +  +   I +  G   S   L    K I     
Sbjct: 260 MYLTVTLHEGEPYTINSIKLAGNLLDREAELNKLIKIKPGDRFSAEKLQATTKAIVDKLG 319

Query: 91  -MGY-FSNV----KIKIV--DSVLIIDLIE--RKIINHLFFSGNNNLKDDQLKMIVRSRS 140
             GY F+ V    +I        L + +    R  +  +   GN   +D+ ++  +R   
Sbjct: 320 EYGYAFATVNALPQIDQEHHKVDLTLQVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLE 379

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIE 189
           ++ +D + +      I +     GY    V V    +  T   +   ++
Sbjct: 380 SSWFDSNRLALSKDRINRL----GY-FTDVDVTTVPVEGTPDQVDVDVK 423


>gi|91775875|ref|YP_545631.1| surface antigen (D15) [Methylobacillus flagellatus KT]
 gi|91709862|gb|ABE49790.1| surface antigen (D15) [Methylobacillus flagellatus KT]
          Length = 790

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 190/791 (24%), Positives = 337/791 (42%), Gaps = 29/791 (3%)

Query: 19  FPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISD 78
                ++  I L       ++       +V+ I + G        + + +PV VG ++++
Sbjct: 1   MKFGMKLKHIPLLILALYSTSALAQEPFVVKDIRVEGLQRTEAGTVFNYLPVRVGDTMTE 60

Query: 79  ADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLK---MI 135
                A+K++Y  G+F +V+I+  + V+++ + ER  I  L F+GN +   D++K     
Sbjct: 61  EKATQAIKSLYGTGFFKDVRIESENGVVVVMVQERSAIAQLIFNGNKSFPTDKMKEGLKQ 120

Query: 136 VRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAK 195
           +       +D+  ++     IK+ Y S G     VK     +    + + + IEEG  +K
Sbjct: 121 IGLAEGLIFDQSMLDRAEQEIKRQYLSQGKYGASVKTSVTPLERNRVAVRFDIEEGAVSK 180

Query: 196 INSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYA 254
           I +I  VGNK Y+   L   ++    +    + K D YS+++++ D EA+R+FY ++GY 
Sbjct: 181 IRNINIVGNKEYTKEELLEKLTLTTPNWLTWWNKNDQYSRQKLTADLEALRSFYMNQGYL 240

Query: 255 AVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLY 314
              + S  +        + I                 +    I +    SLI +  G ++
Sbjct: 241 EFNIDSTQVSITPDKRDIYITINITEGEKYTVTDVKLAGEMLIPEAEARSLISVSPGEIF 300

Query: 315 NPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEG 374
           N Q + ESS+ I+    +    F  V      D  K  V   + ID G  +YV+RI + G
Sbjct: 301 NRQRVTESSKAINDRLGNDGYAFSNVNAIPEVDKEKHTVAFTFYIDPGRRVYVRRINLTG 360

Query: 375 NDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRV 434
           N ++ D V+RRE+   E        IER+K+R+    YFS+VN+        +D V L +
Sbjct: 361 NTRTRDEVLRREMRQLESAWYGADKIERSKQRLNRLQYFSDVNVETPAVPGTNDQVDLNI 420

Query: 435 SVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN---YTFS 491
           +V + S GSV         +G+ +   I+ NNF G G R       GR        YT  
Sbjct: 421 NVTERSTGSVMFGAGLSSFEGVVLGVTINQNNFLGTGNRVAAQVNTGRINTVYSLSYTDP 480

Query: 492 VEDPYFLGSPISAGFDL-QKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQY 550
              P  +    +        T+L  G        A V   +P+ E    S      +   
Sbjct: 481 YFTPDGISRGFNVYHRKVDTTYLRTGDYKTASYGAGVNFGMPLNERDFVSAGLTFDYTDV 540

Query: 551 GAISEKEKIPSIYTTLIEHGKFSSHS---ISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
              S        Y +  E     S+S   ++ +  ++T DN + P KG+L   S + A  
Sbjct: 541 ELSSNSPPQFKRYCSSSEDANSCSNSSWFVNLAWTHDTRDNIMFPNKGVLQRISSEVALP 600

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           G D QY+++  + +++  +S    ++ +   GYG     +K+   F  F       +RG+
Sbjct: 601 GLDLQYYKLEYKHAWYKDISKSVTLMLNGEIGYGNTYG-DKDYPFFKNFYAGGVNSVRGY 659

Query: 668 AYKGIGPRVDK------KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN 721
               IGPR+         +A GG     A+A + FP+P + +   LR + F+D+ ++  +
Sbjct: 660 EQSSIGPRIYDTQGQYRDFAAGGTKRFLANAELYFPIPGMKDNNALRLSTFIDAGSIAGD 719

Query: 722 HVALGADKLEG-----------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKI 770
            +      ++            + S  R STG+ + W SP G + +    PL  ++GD+ 
Sbjct: 720 GIDESGACIDSRGQVSGCPYSTSLSDIRYSTGIGVSWLSPFGPIKLVLAKPLNKQDGDRT 779

Query: 771 QQFGFRIGNRM 781
           Q   F++G + 
Sbjct: 780 QMLQFQMGQQF 790


>gi|307727039|ref|YP_003910252.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1003]
 gi|307587564|gb|ADN60961.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1003]
          Length = 769

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 153/777 (19%), Positives = 320/777 (41%), Gaps = 18/777 (2%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           +      S   G + L            +   +V+ I+I G   +    + + +P+  GQ
Sbjct: 1   MNFQALASRLAGTLSLAGITLASVPARAAEPFVVQDIKIEGLQRIEPGTVFAYLPIKQGQ 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
           + +D     +++ +YA G+F++V+I    +V+ + + ER  +  + F+G +    + L  
Sbjct: 61  TFTDEKASESIRALYATGFFNDVRISAEGNVVTVYVQERPAVGTIDFAGIHEFDKENLTK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +         ++D+  V+     +K+ Y + GY    V      I    + I + + EG
Sbjct: 121 ALRAVGLSQGRSFDKALVDKAEQELKRQYLTRGYYAAEVTTTTTPIDRHRVAILFSVAEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKI  I F+GN  +S   L   +     + +  + K D+Y+K++++ D E +R++Y +
Sbjct: 181 PSAKIRQINFIGNSTFSTDTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLEHVRSYYLN 240

Query: 251 RGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRS 310
           RGY    + S  +        + +            +    +     ++  L  L+ I+ 
Sbjct: 241 RGYLEFNIESTQVSVTPDKKDMYLTITLHEGEPYTISSIRLAGNLLDREAELTKLVNIKP 300

Query: 311 GNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           G  ++ ++++ +++ +          F  V      D  +  VD+   +D    +YV+ I
Sbjct: 301 GERFSAEKLQAATKAVVDKLGEYGYAFATVNAVPKIDQQRHTVDLTLQVDPSRRVYVRHI 360

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            + GN ++ D V+RRE+   E    + + +  +K R+   GYF++V+++ +P    +D V
Sbjct: 361 NVTGNTRTRDEVVRREMRQLESSWFDSNRLMLSKDRVNRLGYFTDVDVTTVPVEGSADQV 420

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTF 490
            + V V +   G++ +   +     + +   I  +N FG G    L     +        
Sbjct: 421 DVDVKVSEKPTGAITLGAGFSSTDKVVLSAGISQDNVFGSGTSIALNVNTAKTYRTLSLT 480

Query: 491 SVEDPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
             +  + +      + +         +  D S  I    A ++  +P +E+ +  F   L
Sbjct: 481 QTDPYFTVDGIKRITDVYYRTSYPLYYYTDTSFKIVTVGADLKFGIPFSEADTVYFGLGL 540

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
              +    S   +    Y +       ++  ++     +  D+ +VP +G  + ++ +  
Sbjct: 541 EQNRLSIDSSTPQSYKDYVSEF-GNVVNNVPVTAGWARDDRDSALVPSRGYFLQANGEVG 599

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
              G +QY++   +A Y+Y  S    +  +L+ GYG    + K   +F  +       +R
Sbjct: 600 TPAGGTQYYKTDVQAQYYYSFSRGFILGLNLQGGYGNGF-AGKAYPIFKNYYAGGIGSVR 658

Query: 666 GFAYKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVA 724
           G+    +GP        IGG     A+  ++FP+P       LR   F+D+  ++ +   
Sbjct: 659 GYESGSLGPTDKTTGDPIGGSRMVVANVEMTFPLPGTGWDRTLRVFTFLDAGNVWGSEGN 718

Query: 725 LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                     +  R S G  + W SP+G + +  G P+  R  DK Q+F F+IG   
Sbjct: 719 SNGA------NGLRYSYGAGLEWISPIGPLKLSLGFPVVKRATDKYQKFQFQIGTSF 769


>gi|238754799|ref|ZP_04616150.1| Outer membrane protein assembly factor yaeT [Yersinia ruckeri ATCC
           29473]
 gi|238706959|gb|EEP99325.1| Outer membrane protein assembly factor yaeT [Yersinia ruckeri ATCC
           29473]
          Length = 795

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 185/793 (23%), Positives = 329/793 (41%), Gaps = 38/793 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  I S      +     L +I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYITINLTEGEQYKLDSVIVSGNLAGHQSEAEKLTKIEPGELFNGGK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + I K        + RV+ +   + A + V +   +D G+  YV+++  EGND S
Sbjct: 301 VTRMEDDIKKMLGRYGYAYPRVQIQPEINDANKTVKLRVNVDAGNRFYVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E+ K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEQGKDRLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
            + GS+     Y  + G+  +  +  +N+ G G    +      +         +  + +
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTMTDPYFTV 480

Query: 499 G----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGVGYVHNSLSDML 540

Query: 555 EKEKIPSIYTTLIEHGKFS--------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +   ++          +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLESVGQKPNYTDRAEFTADDFTLNLGWTYNNLDRGFFPTSGVKSSVNSKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDD--SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++++++    S +  L  D    ++G  R GYG  +   K +  ++ F    +  +
Sbjct: 601 PGSDNEFYKVTFDTSAYLPLDQDRSWVLLGRGRLGYGDGLG-GKEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPR-----------VDKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAF 711
           RGF    IGP+                A+GG   + AS  +  P P + E+    +R + 
Sbjct: 660 RGFRSNNIGPKAAYYADNGTKINKSTDAVGGNAMAVASIELITPTPFISEKYSNSVRTSV 719

Query: 712 FVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHR 765
           F+DS T++  H    A           + S  RVS GV + W SPLG +   Y  P++  
Sbjct: 720 FIDSGTVWDTHWENTAMSQTAGIPDYNDPSNIRVSAGVALQWMSPLGPLVFSYAKPVKDY 779

Query: 766 EGDKIQQFGFRIG 778
            GDK +QF F IG
Sbjct: 780 PGDKSEQFQFNIG 792


>gi|237729483|ref|ZP_04559964.1| outer membrane protein assembly factor YaeT [Citrobacter sp. 30_2]
 gi|226909212|gb|EEH95130.1| outer membrane protein assembly factor YaeT [Citrobacter sp. 30_2]
          Length = 803

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 176/801 (21%), Positives = 320/801 (39%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + +L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGEQYKLSGVQVSGNLAGHSAEIETLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGRPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGVGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  P+ E  +          +   + 
Sbjct: 481 DGVSLGGRVFYNDFEADDADLSDYTNKSYGTDVTLGFPVNEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF-----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
            +  +     ++ +            + +    YN LD    P  G  ++ +      G 
Sbjct: 541 PQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLNGKVTIPGS 600

Query: 610 DSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           D++Y+++    + +  + DD   V  G  + GYG  I S K +  ++ F    +  +RGF
Sbjct: 601 DNEYYKLSMDTATYVPIDDDHKWVVLGRTKVGYGDGIGS-KEMPFYENFYAGGSSTVRGF 659

Query: 668 AYKGIGPRV------------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
               IGP+                             A+GG   + AS     P P + +
Sbjct: 660 QSNTIGPKAVYKNGARTDWDDGNNEECTQASGCKSDDAVGGNAMAVASLEFITPTPFISD 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGVY 757
           +    +R +FF D  T++  +    +   +     + S  R+S G+ + W SPLG +   
Sbjct: 720 KYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPSNIRMSAGIALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  +GDK +QF F IG
Sbjct: 780 YAQPFKKYDGDKAEQFQFNIG 800


>gi|317493180|ref|ZP_07951603.1| outer membrane protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918840|gb|EFV40176.1| outer membrane protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 795

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 188/794 (23%), Positives = 326/794 (41%), Gaps = 40/794 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKNIHFEGLQRVAVGAALLNMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ +YA G F +V++      LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALYATGNFEDVRVLRDGDNLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   +++    ++  Y S+G  +  VK     +    +++  V  EG  A+I  I
Sbjct: 121 VGEALDRTMLSSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGKSAQIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L     +R    +        Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHAFTSEELIARFQLRDEVPWWNLVGDRKYQKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K G  +   I EG+ Y +  + +   +       +  L  I  G LYN  
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLTGVEVNGNMAGYS-TDINRLTTIEPGELYNGA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +  + + K        + +V+T+   + A + V +   +D G+  YV+ I+  GND 
Sbjct: 300 KVTKMEDDVKKLLGRYGYAYPKVQTQPEINDADKTVKLHMNVDAGNRYYVRNIKFVGNDT 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S DSV+RRE+   EG  +   ++++ K R+  TGYF  V++         D V +   VK
Sbjct: 360 SKDSVLRREMRQMEGAWLGSDLVDQGKERLNRTGYFETVDVDTQRVPGAPDQVDVTYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVE 493
           + + G+      +  + G+  +  +   N+ G G    ++     +              
Sbjct: 420 ERNTGTFNFGVGFGTESGVSFQVGVQQENWLGTGNTVGISGTKNDYQTYAELSMTNPYFT 479

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        D +    +      +       +  PI E+ S              +
Sbjct: 480 VDGVSLGGRIFYNDFKADDADLSDYTNSSYGLDGTLGFPINENNSLRTGLGYVHNSLSDM 539

Query: 554 --------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
                     K    +   T          + S    YN +D    P +G   S +    
Sbjct: 540 QPQVAMWRYLKSVGQNPNDTDKADYTADDFTWSLGWTYNNVDRGFFPTQGTKASLNGKVT 599

Query: 606 GFGGDSQYHRIGSRASYFYLLSDD--SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++   +  +  L DD    ++G  R GYG  +   K +  ++ F    +  
Sbjct: 600 IPGSDNEYYKLTFDSQSYLPLDDDRSWVVMGRSRLGYGDGLG-GKEMPFYENFYAGGSSS 658

Query: 664 LRGFAYKGIGP--------------RVDKKYAIGGKIYSSASAAVSFPMPLVPERA--GL 707
           +RGF    IGP              +     A+GG   + AS  +  P P V E+    L
Sbjct: 659 VRGFQSNNIGPKAVYLNPNGSVDQSKTSDDDAVGGNAMAVASVELITPTPFVGEKYANSL 718

Query: 708 RGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRH 764
           R + F+D+ T++  +             + S  RVS G+ + W SPLG +   Y  P++ 
Sbjct: 719 RTSIFMDAGTVWDTNWDKSAYPNQPDYSDPSNIRVSAGLALQWMSPLGPLVFSYAQPVKK 778

Query: 765 REGDKIQQFGFRIG 778
            +GDK +QF F IG
Sbjct: 779 YDGDKAEQFQFNIG 792


>gi|317046990|ref|YP_004114638.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           At-9b]
 gi|316948607|gb|ADU68082.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           At-9b]
          Length = 803

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 182/801 (22%), Positives = 327/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDIR 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + +++++A G F +V++    + LI+ + ER  I  + FSGN  +K+DQLK  +     R
Sbjct: 61  NTIRSLFATGNFEDVQVLRDGTTLIVQVKERPTIASITFSGNKAVKEDQLKQNLEASGIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G     VK     +    +++ +V +EGV A+I  I
Sbjct: 121 VGEALDRTTLSSIEKGLEDFYYSVGKYTASVKAIATPLPRNRVDLKFVFQEGVSAQIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I               I +         +  L +I SG LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAGHSAEIEHLTKIPSGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV T+   + A + V +   +D G+  YV+++  EGND S
Sbjct: 301 VTQMEDDIKKLLGRYGYAYPRVVTQPEINDADKTVKLHINVDAGNRYYVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E+ K R+  TGYF  V++         D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVEQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      Y  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +              +  PI E+ +              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSDYTNKSYGVDGTLGFPINENNTLRVGLGYVHNDLSNMQ 540

Query: 555 EKEKIPSIYTT------LIEHGKF--SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     +      L + G F  +  + +    YNTLD    P  G   + +     
Sbjct: 541 PQVAMWRYLDSVGRHQGLNDDGDFSANDFTFNYGWTYNTLDRGFFPTSGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+ +++       +  ++ D   V     R GYG  +   K +  ++ F    +  +
Sbjct: 601 PGSDNSFYKATLDTQQYVPINRDRTWVLLGRGRVGYGDGLG-GKEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRVD-------------------KKYAIGGKIYSSASAAVSFPMPLVPERA 705
           RGF    IGP+                        A+GG   + AS  +  P P + E+ 
Sbjct: 660 RGFQSNTIGPKAAYLNDGSSTCTLSDPNGICKSDDAVGGNAMAVASLELITPTPFLSEKY 719

Query: 706 --GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
              +R + F D+ T++       A+          + +  RVS+G+ + W SPLG +   
Sbjct: 720 ANSVRTSVFFDAGTVWDTKWQNTAETRAAGIPDYSDPNNIRVSSGIALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P++  EGDK +QF F IG
Sbjct: 780 YAQPIKKVEGDKSEQFQFNIG 800


>gi|291616353|ref|YP_003519095.1| YaeT [Pantoea ananatis LMG 20103]
 gi|291151383|gb|ADD75967.1| YaeT [Pantoea ananatis LMG 20103]
          Length = 811

 Score =  405 bits (1040), Expect = e-110,   Method: Composition-based stats.
 Identities = 189/802 (23%), Positives = 330/802 (41%), Gaps = 46/802 (5%)

Query: 22  SFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
           +  M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+
Sbjct: 8   TMAMKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDV 67

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RS 138
            + +++++A G F +V++    + LI+ + ER  I  + FSGN  +KDDQLK  +     
Sbjct: 68  RNTIRSLFATGNFEDVQVLRDGNTLIVQVKERPTIASITFSGNKAVKDDQLKQNLEASGV 127

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R   A D  T+++    ++  Y S+G     VK     +    +++  V  EGV AKI  
Sbjct: 128 RVGEALDRTTISSIEKGLEDFYYSVGKYTASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQ 187

Query: 199 IRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  VGNK +S   L           +++      Y K++++ D E +R+FY DRGYA   
Sbjct: 188 INIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFN 247

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           + S  +        + I               I +         +  L +I +G LYN  
Sbjct: 248 IDSTQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAGHSAEIEHLTKIPAGELYNGT 307

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++    + I K        + RV T+   + A + V +   +D G+  YV+++  EGND 
Sbjct: 308 KVTSMEDDIKKLLGRYGYAYPRVVTQPEINDADKTVKLHINVDAGNRYYVRKVRFEGNDT 367

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S D+V+RRE+   EG  +   ++++ K R+  TGYF  V++         D V +   VK
Sbjct: 368 SKDAVLRREMRQMEGAWLGSDLVDQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVK 427

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVE 493
           + + G+      Y  + G+  +  +  +N+ G G    ++     +              
Sbjct: 428 ERNTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISGTKNDYQTYAEFSLTDPYFT 487

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        + + ++ +              +  PI E+ S              +
Sbjct: 488 VDGVSLGGRVFYNNFKASNADLSGYTNRSYGTDGTLGFPINENNSLRVGLGYVHNDLSDM 547

Query: 554 SEKEKIPSIY------TTLIEHGKF--SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
             +  +            L  +G F     + +    YNTLD       G   + +    
Sbjct: 548 RPQVAMWRYLDSVGKPQQLNSNGDFSADDFTFNYGWTYNTLDRGFFATSGNRTNLNGKVT 607

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D+Q++++   +  +  ++ D   V  G  R GYG  I S K +  ++ F    +  
Sbjct: 608 IPGSDNQFYKMTLDSQQYVPINKDHTWVVLGRGRVGYGDGI-SGKEMPFYENFYAGGSST 666

Query: 664 LRGFAYKGIGPRVD-------------------KKYAIGGKIYSSASAAVSFPMPLVPER 704
           +RGF    IGP+                        AIGG   + AS  +  P P + E+
Sbjct: 667 VRGFQSNTIGPKAAYLNNGSSYCNLSDPNGICKSSDAIGGNAMAIASLELITPTPFLSEK 726

Query: 705 A--GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGV 756
               +R + FVD+ T++       A+          + +  RVSTGV + W SPLG +  
Sbjct: 727 YSNSVRTSLFVDAGTVWDTKWQNTAETRAAGIPDYSDPNNIRVSTGVSLQWMSPLGPLVF 786

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P++  EGDK +QF F IG
Sbjct: 787 SYAQPVKKVEGDKSEQFQFNIG 808


>gi|327392805|dbj|BAK10227.1| outer membrane protein assembly factor YaeT precursor [Pantoea
           ananatis AJ13355]
          Length = 803

 Score =  405 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 189/801 (23%), Positives = 329/801 (41%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDVR 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + +++++A G F +V++    + LI+ + ER  I  + FSGN  +KDDQLK  +     R
Sbjct: 61  NTIRSLFATGNFEDVQVLRDGNTLIVQVKERPTIASITFSGNKAVKDDQLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G     VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYTASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I               I +         +  L +I +G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAGHSAEIEHLTKIPAGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + I K        + RV T+   + A + V +   +D G+  YV+++  EGND S
Sbjct: 301 VTSMEDDIKKLLGRYGYAYPRVVTQPEINDADKTVKLHINVDAGNRYYVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+  TGYF  V++         D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      Y  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       + + ++ +              +  PI E+ S              + 
Sbjct: 481 DGVSLGGRVFYNNFKASNADLSGYTNRSYGTDGTLGFPINENNSLRVGLGYVHNDLSDMR 540

Query: 555 EKEKIPSIY------TTLIEHGKF--SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +            L  +G F     + +    YNTLD       G   + +     
Sbjct: 541 PQVAMWRYLDSVGKPQQLNSNGDFSADDFTFNYGWTYNTLDRGFFATSGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+Q++++   +  +  ++ D   V  G  R GYG  I S K +  ++ F    +  +
Sbjct: 601 PGSDNQFYKMTLDSQQYVPINKDHTWVVLGRGRVGYGDGI-SGKEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRVD-------------------KKYAIGGKIYSSASAAVSFPMPLVPERA 705
           RGF    IGP+                        AIGG   + AS  +  P P + E+ 
Sbjct: 660 RGFQSNTIGPKAAYLNNGSSYCNLSDPNGICKSSDAIGGNAMAIASLELITPTPFLSEKY 719

Query: 706 --GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
              +R + FVD+ T++       A+          + +  RVSTGV + W SPLG +   
Sbjct: 720 SNSVRTSLFVDAGTVWDTKWQNTAETRAAGIPDYSDPNNIRVSTGVSLQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P++  EGDK +QF F IG
Sbjct: 780 YAQPVKKVEGDKSEQFQFNIG 800


>gi|197249707|ref|YP_002145229.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|226708912|sp|B5F8T8|YAET_SALA4 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|197213410|gb|ACH50807.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
          Length = 803

 Score =  405 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 174/801 (21%), Positives = 321/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
            +  +     ++ +           + +    YN LD    P  G  ++ +      G D
Sbjct: 541 PQIAMDRYLESMGDPDASDFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           ++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF 
Sbjct: 601 NEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGFQ 659

Query: 669 YKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
              IGP+                              A+GG   + AS     P P + E
Sbjct: 660 SNTIGPKAVYKNGARTSGGDNDEYEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFISE 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGVY 757
           +    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG +   
Sbjct: 720 KYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  +GDK +QF F IG
Sbjct: 780 YAQPFKKYDGDKAEQFQFNIG 800


>gi|224582072|ref|YP_002635870.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|254807341|sp|C0Q6K0|YAET_SALPC RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|224466599|gb|ACN44429.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322713248|gb|EFZ04819.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 805

 Score =  405 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 175/803 (21%), Positives = 321/803 (39%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF-----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
            +  +     ++ +            + +    YN LD    P  G  ++ +      G 
Sbjct: 541 PQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGS 600

Query: 610 DSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           D++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF
Sbjct: 601 DNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGF 659

Query: 668 AYKGIGPRV--------------------------DKKYAIGGKIYSSASAAVSFPMPLV 701
               IGP+                               A+GG   + AS     P P +
Sbjct: 660 QSNTIGPKAVYGYGAHTDPNDNNDDYEACTQSSGCKSDDAVGGNAMAVASLEFITPTPFI 719

Query: 702 PERA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMG 755
            E+    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG + 
Sbjct: 720 SEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GDK +QF F IG
Sbjct: 780 FSYAQPFKKYDGDKAEQFQFNIG 802


>gi|238911290|ref|ZP_04655127.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
          Length = 803

 Score =  405 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 174/801 (21%), Positives = 321/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
            +  +     ++ +           + +    YN LD    P  G  ++ +      G D
Sbjct: 541 PQIAMDRYLESMGDPDASDFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           ++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF 
Sbjct: 601 NEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGFQ 659

Query: 669 YKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
              IGP+                              A+GG   + AS     P P + E
Sbjct: 660 SNTIGPKAVYKNGARTSGGDNDDYEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFISE 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGVY 757
           +    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG +   
Sbjct: 720 KYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  +GDK +QF F IG
Sbjct: 780 YAQPFKKYDGDKAEQFQFNIG 800


>gi|260596597|ref|YP_003209168.1| outer membrane protein assembly factor YaeT [Cronobacter turicensis
           z3032]
 gi|260215774|emb|CBA28194.1| Outer membrane protein assembly factor yaeT [Cronobacter turicensis
           z3032]
          Length = 804

 Score =  405 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 177/801 (22%), Positives = 321/801 (40%), Gaps = 45/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVSDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFASGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN+ +S   L           +++      Y K+++  D E +R++Y DRGYA   +
Sbjct: 181 NIVGNRAFSTEELISNFQLRDEVPWWNVVGDRKYQKQKLQGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +                 S         + SL +++ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTINVTEGDQYKIAGVEVSGNLAGHSAEIESLTKMQPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + I K        + RV+T+   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTRMEDDIKKLLGRYGYAYPRVQTQPEINDADKTVKLHVNVDSGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   GYF  V+      +   D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDADTQRVSGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGINGTKNDYQTYSEFSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +  S           +  PI E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSSYTNKSYGVDGTLGFPINEYNTLRLGLGYVHNDLSNME 540

Query: 555 EKEKIPSIYTTLIEHGKFS---------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     +L +  K +           +++    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLDSLGQSAKTTSDDNGFSADDFTLNYGWTYNHLDRGFFPTSGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYL 664
             G D++++++    + +  + +D   V   R  +G     S K +  ++ F    +  +
Sbjct: 601 IPGSDNEFYKLTLDTATYVPIDEDHKWVVLGRTRWGYGDGLSGKEMPFYENFYAGGSSTV 660

Query: 665 RGFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVSFPMPLVPERA 705
           RGF    IGP+                        A+GG     AS     P P + E+ 
Sbjct: 661 RGFQSNNIGPKAVYYSGPGLDNCDKAVGGYCSSDDAVGGNAMGVASLEFITPTPFLSEKY 720

Query: 706 --GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
              +R + F D+ T++  +    A           + S  R+S G+ + W SPLG +   
Sbjct: 721 ANSVRTSLFADAGTVWDTNWKNTAAMRAAGVPDYSDPSNIRMSAGIALQWMSPLGPLVFS 780

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  EGDK +QF F IG
Sbjct: 781 YAQPFKKYEGDKAEQFQFNIG 801


>gi|156935308|ref|YP_001439224.1| outer membrane protein assembly factor YaeT [Cronobacter sakazakii
           ATCC BAA-894]
 gi|166227558|sp|A7MGT7|YAET_ENTS8 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|156533562|gb|ABU78388.1| hypothetical protein ESA_03165 [Cronobacter sakazakii ATCC BAA-894]
          Length = 804

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 177/802 (22%), Positives = 325/802 (40%), Gaps = 47/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFASGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN+ +S   L           +++      Y K+++  D E +R++Y DRGYA   +
Sbjct: 181 NIVGNRAFSTEELISNFQLRDEVPWWNVVGDRKYQKQKLQGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +                 S         + SL +++ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTINVTEGDQYKIAGVEVSGNLAGHSAEIESLTKMQPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + I K        + RV+T+   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTRMEDDIKKLLGRYGYAYPRVQTQPEINDADKTVKLHVNVDSGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   GYF  V++     +   D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDVDTQRVSGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGINGTKNDYQTYSEFSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +  S           +  P+ E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSSYTNKSYGVDGTLGFPVNEYNTLRLGLGYVHNDLSNME 540

Query: 555 EKEKIPSIYTTLIEHGKFS---------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     +L +  K +           +++    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLDSLGQSAKTTSDDNGFSADDFTLNYGWTYNHLDRGFFPTSGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++++++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEFYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVSFPMPLVPER 704
           +RGF    IGP+                        A+GG     AS     P P + E+
Sbjct: 660 VRGFQSNNIGPKAVYYSGPGLDNCDKAVGGYCSSDDAVGGNAMGVASLEFITPTPFLSEK 719

Query: 705 A--GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGV 756
               +R + F D+ +++  +    A           + S  R+S G+ + W SPLG +  
Sbjct: 720 YANSVRTSLFADAGSVWDTNWKNTAAMRAAGVPDYSDPSNIRMSAGIALQWMSPLGPLVF 779

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P +  EGDK +QF F IG
Sbjct: 780 SYAQPFKKYEGDKAEQFQFNIG 801


>gi|22127003|ref|NP_670426.1| outer membrane protein assembly factor YaeT [Yersinia pestis KIM
           10]
 gi|45442566|ref|NP_994105.1| outer membrane protein assembly factor YaeT [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51597310|ref|YP_071501.1| outer membrane protein assembly factor YaeT [Yersinia
           pseudotuberculosis IP 32953]
 gi|108806525|ref|YP_650441.1| outer membrane protein assembly factor YaeT [Yersinia pestis
           Antiqua]
 gi|108813108|ref|YP_648875.1| outer membrane protein assembly factor YaeT [Yersinia pestis
           Nepal516]
 gi|145598942|ref|YP_001163018.1| outer membrane protein assembly factor YaeT [Yersinia pestis
           Pestoides F]
 gi|149366947|ref|ZP_01888980.1| putative surface antigen [Yersinia pestis CA88-4125]
 gi|153949885|ref|YP_001400005.1| outer membrane protein assembly factor YaeT [Yersinia
           pseudotuberculosis IP 31758]
 gi|162418603|ref|YP_001607764.1| outer membrane protein assembly factor YaeT [Yersinia pestis
           Angola]
 gi|165927078|ref|ZP_02222910.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165939818|ref|ZP_02228358.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|166011895|ref|ZP_02232793.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166211785|ref|ZP_02237820.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167399781|ref|ZP_02305299.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167419790|ref|ZP_02311543.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167425352|ref|ZP_02317105.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|170023323|ref|YP_001719828.1| outer membrane protein assembly factor YaeT [Yersinia
           pseudotuberculosis YPIII]
 gi|186896415|ref|YP_001873527.1| outer membrane protein assembly factor YaeT [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928220|ref|YP_002346095.1| outer membrane protein assembly factor YaeT [Yersinia pestis CO92]
 gi|229837759|ref|ZP_04457919.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229840981|ref|ZP_04461140.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843082|ref|ZP_04463232.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229903551|ref|ZP_04518664.1| conserved protein [Yersinia pestis Nepal516]
 gi|270487332|ref|ZP_06204406.1| outer membrane protein assembly complex, YaeT protein [Yersinia
           pestis KIM D27]
 gi|294503069|ref|YP_003567131.1| putative surface antigen [Yersinia pestis Z176003]
 gi|81594467|sp|Q8ZH58|YAET_YERPE RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|81638766|sp|Q667J7|YAET_YERPS RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|122979775|sp|Q1CAM6|YAET_YERPA RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|123372993|sp|Q1CFF5|YAET_YERPN RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|166227560|sp|A4TL83|YAET_YERPP RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|166919053|sp|A7FFH7|YAET_YERP3 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708921|sp|B2JZ26|YAET_YERPB RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708922|sp|A9R388|YAET_YERPG RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708923|sp|B1JQG8|YAET_YERPY RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|21960049|gb|AAM86677.1|AE013913_7 hypothetical protein y3127 [Yersinia pestis KIM 10]
 gi|45437431|gb|AAS62982.1| putative surface antigen [Yersinia pestis biovar Microtus str.
           91001]
 gi|51590592|emb|CAH22233.1| putative surface antigen [Yersinia pseudotuberculosis IP 32953]
 gi|108776756|gb|ABG19275.1| surface antigen [Yersinia pestis Nepal516]
 gi|108778438|gb|ABG12496.1| putative surface antigen [Yersinia pestis Antiqua]
 gi|115346831|emb|CAL19717.1| putative surface antigen [Yersinia pestis CO92]
 gi|145210638|gb|ABP40045.1| surface antigen [Yersinia pestis Pestoides F]
 gi|149290561|gb|EDM40637.1| putative surface antigen [Yersinia pestis CA88-4125]
 gi|152961380|gb|ABS48841.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pseudotuberculosis IP 31758]
 gi|162351418|gb|ABX85366.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis Angola]
 gi|165912221|gb|EDR30858.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165920974|gb|EDR38198.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165989161|gb|EDR41462.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166207556|gb|EDR52036.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166962531|gb|EDR58552.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167050489|gb|EDR61897.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167055752|gb|EDR65536.1| surface antigen/outer membrane protein, OMP85 family [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|169749857|gb|ACA67375.1| outer membrane protein assembly complex, YaeT protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186699441|gb|ACC90070.1| outer membrane protein assembly complex, YaeT protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|229679321|gb|EEO75424.1| conserved protein [Yersinia pestis Nepal516]
 gi|229689958|gb|EEO82017.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229697347|gb|EEO87394.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229704136|gb|EEO91148.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262365347|gb|ACY61904.1| putative surface antigen [Yersinia pestis D182038]
 gi|270335836|gb|EFA46613.1| outer membrane protein assembly complex, YaeT protein [Yersinia
           pestis KIM D27]
 gi|294353528|gb|ADE63869.1| putative surface antigen [Yersinia pestis Z176003]
          Length = 795

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 190/793 (23%), Positives = 328/793 (41%), Gaps = 38/793 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V  I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVNDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++    + LI+ + ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  KTIRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            N  I S      +     L +I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYVTINITEGPQFKLNSVIVSGNLAGHQSEAEKLTKIEPGELFNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + I K        + RV T+   +   + V +   +D G+  YV+ I  EGND S
Sbjct: 301 VTRMEDDIKKMLGRYGYAYPRVVTQPEINDDDKTVKLHINVDAGNRFYVRHIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGAADLVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
            + GS+     Y  + G+  +  +  +N+ G G    +      +        ++  + +
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLMDPYFTV 480

Query: 499 G----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +   A   +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGADGTLGFPINENNSLRVGVGYVHNDLSDML 540

Query: 555 EKEKIPSIY--------TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +                E       +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLESVGERPGYDGREGFTTDDFTLNLGWTYNNLDRGFFPTSGVKSSVNTKITV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDD--SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++++++    S +  L++D    ++G  R GYG  I S K +  ++ F    +  +
Sbjct: 601 PGSDNEFYKVTFDTSAYQPLNEDRSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPR-----------VDKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAF 711
           RGF    IGP+            +   A+GG   + AS  +  P P + E+    +R + 
Sbjct: 660 RGFRSNNIGPKAAYYANGGATVTNSTDAVGGNAMAVASIELITPTPFISEKYSNSVRTSI 719

Query: 712 FVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHR 765
           F+DS T++  +    A          G  S  RVS GV + W SPLG +   Y  P++  
Sbjct: 720 FIDSGTVWDTNWENTAKTRAAGIPDYGKASNIRVSAGVALQWMSPLGPLVFSYAKPVKDY 779

Query: 766 EGDKIQQFGFRIG 778
           EGDK +QF F IG
Sbjct: 780 EGDKSEQFQFNIG 792


>gi|307129828|ref|YP_003881844.1| hypothetical protein Dda3937_01884 [Dickeya dadantii 3937]
 gi|306527357|gb|ADM97287.1| conserved protein [Dickeya dadantii 3937]
          Length = 805

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 186/802 (23%), Positives = 327/802 (40%), Gaps = 46/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVTDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L+I + ER  I  L FSGN  +K++ LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDSLLIQVKERPTIASLTFSGNKAVKEEMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYSATVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK++S   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKSFSSDELISRFQLRDEVPWWNVVGDRKYEKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  +           +  L R++SG LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVVVRGNLVGHATEIEDLTRVQSGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+   +   + V +   +D G+   V+RI  +GND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPEINDTDKTVRLNINVDAGNRFTVRRIRFDGNDVS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGGWLGNDLVQQGKERLNRLGYFESVDVETQRVPGTPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGSLNFGIGFGTESGVSFQAGVQQDNWLGTGNSVGISGTRNDYQTYVELSMTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA-- 552
                       + +    +          A   +  PI E+ S     D          
Sbjct: 481 DGVSLGGRIFYNNFKALDADLSDYTNQSYGAGTTLGFPINENNSLRVGLDYVHNSLSDMK 540

Query: 553 --------ISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
                   +S+    P   TT       +   ++    YN LD    P  G   + +   
Sbjct: 541 PQVAMWRYLSKAGVDPDPSTTSSASFDANDFFLTSGWTYNNLDRGYFPTAGNRANLNAKV 600

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYY 663
              G D++Y+++   ++ ++ LS++ + V   R   G     S K +  +D F    +  
Sbjct: 601 TVPGSDNEYYKLTFDSASYFPLSENHNWVLMARTKAGYADGLSGKEVPFYDNFFAGGSSS 660

Query: 664 LRGFAYKGIGPRVDK-------------------KYAIGGKIYSSASAAVSFPMPLVPER 704
           +RGF    IGP+                      + A+GG   + ASA +  P P + ++
Sbjct: 661 VRGFRSNTIGPKAAYYTGCSTANVSSCSIDSTKMRDAVGGNAMAVASAELIVPTPFISDK 720

Query: 705 A--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGV 756
               +R +FFVD+ T++  H    A  L             R+S+G+ + W SPLG +  
Sbjct: 721 YSSSIRTSFFVDAGTVWDTHWENTAQTLAAGVPDYSTPGNIRMSSGLAVQWMSPLGPLVF 780

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P +  +GD+ +QF F IG
Sbjct: 781 SYAQPFKKYDGDRSEQFQFNIG 802


>gi|161612596|ref|YP_001586561.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167553363|ref|ZP_02347112.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|168464212|ref|ZP_02698115.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|198241995|ref|YP_002214185.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|207855742|ref|YP_002242393.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|189040683|sp|A9N0S6|YAET_SALPB RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708913|sp|B5FJ24|YAET_SALDC RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708914|sp|B5R3J0|YAET_SALEP RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|161361960|gb|ABX65728.1| hypothetical protein SPAB_00287 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|195632753|gb|EDX51207.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197936511|gb|ACH73844.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205322171|gb|EDZ10010.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|206707545|emb|CAR31819.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 804

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 175/802 (21%), Positives = 321/802 (40%), Gaps = 47/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF-----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
            +  +     ++ +            + +    YN LD    P  G  ++ +      G 
Sbjct: 541 PQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGS 600

Query: 610 DSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           D++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF
Sbjct: 601 DNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGF 659

Query: 668 AYKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVP 702
               IGP+                              A+GG   + AS     P P + 
Sbjct: 660 QSNTIGPKAVYKNGAHTSWDDNDDYEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFIS 719

Query: 703 ERA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGV 756
           E+    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG +  
Sbjct: 720 EKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVF 779

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P +  +GDK +QF F IG
Sbjct: 780 SYAQPFKKYDGDKAEQFQFNIG 801


>gi|270264812|ref|ZP_06193076.1| outer membrane protein assembly complex, YaeT protein [Serratia
           odorifera 4Rx13]
 gi|270041110|gb|EFA14210.1| outer membrane protein assembly complex, YaeT protein [Serratia
           odorifera 4Rx13]
          Length = 800

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 181/798 (22%), Positives = 323/798 (40%), Gaps = 43/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVTDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +++  L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHAFTNDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  + +         +  L ++  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGEQYKLSGVMVNGNLAGHSAEVAQLTKVEPGELYNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + +          + RV T+   + A + V +   ID G+  YV+RI+ EGND S
Sbjct: 301 VTKMEDNVKTMLGRYGYAYPRVSTQPEINDADKTVKLHVNIDAGNRFYVRRIKFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +  + +E+ K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNAQVEQGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      Y  + G+  +  +  +N+ G GY   ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQAGVQQDNWLGTGYSVGISGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI- 553
                       D +    +              +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSDYTNKSYGIDGTLGFPINENNSLRTGLGYVHNGLSNMQ 540

Query: 554 -------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                         +  T           +++    YN LD    P  G   + +     
Sbjct: 541 PQIAMWRYLDSMGLNPNTNDRASYSADDFTLNLGWTYNNLDRGYFPTSGNRTTLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++Y+++   +  +  + DD   V     R GY   +   K +  ++ F    +  +
Sbjct: 601 PGSDNEYYKMTLDSVQYVPIDDDRTWVLLGRGRLGYADGLG-GKEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV-----------------DKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           RGF    IGP+                  +   A+GG   + AS  +  P P + E+   
Sbjct: 660 RGFGSNTIGPKAVYYNSSSYSCSNSTKICNSDDAVGGNAMAVASMELITPTPFISEKYAN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKLEGND-----SFWRVSTGVEIMWNSPLGMMGVYYGI 760
            +R + F+D+ T++  +      +          S  RVS G+ + W SPLG +   Y  
Sbjct: 720 SVRTSLFMDAGTVWDTNWDNSKTQGFDIPDYSKASNIRVSAGIALQWMSPLGPLVFSYAN 779

Query: 761 PLRHREGDKIQQFGFRIG 778
           PL+  EGDK +QF F IG
Sbjct: 780 PLKKYEGDKSEQFQFNIG 797


>gi|94310385|ref|YP_583595.1| surface antigen (D15) [Cupriavidus metallidurans CH34]
 gi|93354237|gb|ABF08326.1| outer membrane protein assembly factor,outer membrane protein,
           surface antigen OMA87 [Cupriavidus metallidurans CH34]
          Length = 791

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 167/787 (21%), Positives = 327/787 (41%), Gaps = 21/787 (2%)

Query: 8   FRRI-KRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILS 66
            + + KR       +   +G +          A + ++  +V+ I + G   V    +  
Sbjct: 13  MKSMRKRGSTLIRNKRISLGLLTSAIIAAWSPAGFAADPFVVKDIRVEGLQRVEPGTVFG 72

Query: 67  RIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNN 126
            +PV VG++ +D     A++ +Y  G+F +V+I+  D VL++ + ER  I+ L F G   
Sbjct: 73  YLPVRVGETFTDDKGADAIRALYNTGFFKDVQIRAEDGVLVVQVEERPAISQLEFVGIKE 132

Query: 127 LKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLN 183
              D L+  +       A  YD+  ++     +K+ Y + GY    V+     +    ++
Sbjct: 133 FDKDTLRRSLRAVGVAEARYYDKALIDKAEQELKRQYVARGYYAAEVQTTVTPVDRNRVS 192

Query: 184 ITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEE 242
           + + ++EG  AKI  I  VGNK +  + L   +     +    + K D+YSK++++ D E
Sbjct: 193 VVFNVDEGPVAKIRQINIVGNKAFKESTLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLE 252

Query: 243 AIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTL 302
           A+R++Y +RGY   ++ S  +        + +            +    +     +++ +
Sbjct: 253 ALRSYYLNRGYLEFQIESTQVSITPDKKDIYLTLNISEGDQYKVSDIRLAGETLGKQEEM 312

Query: 303 LSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQG 362
             L++++ G++++ +++  S++ I+    +    F  +  +   D  KR V +  ++D G
Sbjct: 313 EKLLQLKKGDIFSSEKLTASTKAITDLLGTYGYAFTTINPQPQVDKEKREVALTLMVDPG 372

Query: 363 SPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLP 422
             +YV+R+ + GN ++ D V+RRE+   E    +   +++++ RI  TGYF++ NI+   
Sbjct: 373 RRVYVRRVNVVGNSKTRDEVVRREMRQMESSWFDSEKLQQSQARINRTGYFTDTNITTED 432

Query: 423 ANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGR 482
                D V + V+V +   G + +   +     + ++  +  +N FG G    L     +
Sbjct: 433 VPGAPDQVDVNVNVTEKPTGQISLGLGFSSTDKLVLQAGLRQDNVFGSGTSLGLDVNTAK 492

Query: 483 HAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESI 537
                     +  + +      + I         +  D    I       +  VP +E+ 
Sbjct: 493 SFRTIALTQYDPYFTVDGISRSTDIYYRTSRPLYYTGDQDYKIVSAGGGFKFGVPFSEND 552

Query: 538 STSFKYDLRFLQYGAISEKEKIPSIYTTLI---EHGKFSSHSISQSIIYNTLDNPIVPRK 594
           +  F       Q           + +   I        ++   +     +  D+ ++P K
Sbjct: 553 TVFFGIGYERTQVYTSPNTPNQYTAWLQKIGKASGDPINNFPFTIGWARDRRDSALIPTK 612

Query: 595 GMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFD 654
           G    ++ +    GGD+QY+R   +  YFY LS    +  +    YG     N    +F 
Sbjct: 613 GPYTQANLEVGVPGGDTQYYRASLQQQYFYPLSKSFTLAFNGEVAYGHGYG-NTPFPVFK 671

Query: 655 QFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
            F       +RG+    +GP+      +GG      +    FP+P       LR   F D
Sbjct: 672 YFYAGGIGSVRGYQTSTLGPKDQNGNPVGGASKMIGNVEFVFPLPGSGVDRTLRLFTFFD 731

Query: 715 SATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
              +Y     L         S  + STG  + W SP+G + V  G PL+  E DK+Q+F 
Sbjct: 732 FGNVYQEGAPLSF-------SDLKYSTGFGMSWLSPIGPLKVSMGFPLKKDETDKVQRFQ 784

Query: 775 FRIGNRM 781
           F+IG   
Sbjct: 785 FQIGTAF 791


>gi|16759214|ref|NP_454831.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29140764|ref|NP_804106.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|168823253|ref|ZP_02835253.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|213163131|ref|ZP_03348841.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213425950|ref|ZP_03358700.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213646661|ref|ZP_03376714.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|289825707|ref|ZP_06544875.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|81515728|sp|Q8Z9A3|YAET_SALTI RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|25320996|pir||AB0530 outer membrane protein precursor yaeT [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501505|emb|CAD08682.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29136388|gb|AAO67955.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|205340481|gb|EDZ27245.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|320084478|emb|CBY94271.1| Outer membrane protein assembly factor yaeT Flags: Precursor
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
          Length = 803

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 174/801 (21%), Positives = 321/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
            +  +     ++ +           + +    YN LD    P  G  ++ +      G D
Sbjct: 541 PQIAMDRYLESMGDPDASDFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           ++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF 
Sbjct: 601 NEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGFQ 659

Query: 669 YKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
              IGP+                              A+GG   + AS     P P + E
Sbjct: 660 SNTIGPKAVYKNGAHTSWDDDDDYEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFISE 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGVY 757
           +    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG +   
Sbjct: 720 KYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  +GDK +QF F IG
Sbjct: 780 YAQPFKKYDGDKAEQFQFNIG 800


>gi|238792747|ref|ZP_04636378.1| Outer membrane protein assembly factor yaeT [Yersinia intermedia
           ATCC 29909]
 gi|238727855|gb|EEQ19378.1| Outer membrane protein assembly factor yaeT [Yersinia intermedia
           ATCC 29909]
          Length = 794

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 192/792 (24%), Positives = 324/792 (40%), Gaps = 37/792 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  KTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLEILRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  + S      +     L+ I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSDADKLVAIEPGELYNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEEGIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    +      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGLGYVHNDLSDME 540

Query: 555 EKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +               +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLDSVGQDPNLTDRASFTADDFTLNLGWTYNNLDRGFFPTSGVKSSVNTKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+++++I    S +  L +D   V     R GYG  I S K +  ++ F    +  +
Sbjct: 601 PGSDNEFYKITFDTSAYQPLDEDHSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV----------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAFF 712
           RGF    IGP+           D   A+GG   + AS  +  P P + E+    +R +FF
Sbjct: 660 RGFRSNNIGPKAAYYNANGTIRDSTDAVGGNAMAVASLELITPTPFISEKYSNSVRTSFF 719

Query: 713 VDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
           +DS T++  +    A             S  RVS GV + W SPLG +   Y  P++  E
Sbjct: 720 IDSGTVWDTNWENTAATRAAGIPDYSTASNIRVSAGVSLQWMSPLGPLVFSYAKPVKDYE 779

Query: 767 GDKIQQFGFRIG 778
           GDK +QF F IG
Sbjct: 780 GDKSEQFQFNIG 791


>gi|325496109|gb|EGC93968.1| outer membrane protein assembly factor YaeT [Escherichia fergusonii
           ECD227]
          Length = 802

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 178/800 (22%), Positives = 318/800 (39%), Gaps = 45/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSATIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTNELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVTGNLAGHSAEIEELTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGYAVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S          +   + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
            +  +     ++ E+GK        + +    YN LD    P  G  ++ +      G D
Sbjct: 541 PQVAMDRYLESMGEYGKDSFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           ++Y+++    + +  + DD   V  G  R+GYG  I   K +  ++ F    +  +RGF 
Sbjct: 601 NEYYKLSLDTATYVPIDDDHKWVVLGRTRWGYGDGIG-GKEMPFYENFYAGGSSTVRGFQ 659

Query: 669 YKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
              IGP+                              A+GG   + AS  +  P P + E
Sbjct: 660 SNTIGPKAVYKKGAHSSNDEYDDYEECTESNGCQSDDAVGGNAMAVASFELITPTPFISE 719

Query: 704 RA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
           +    +R + F D  T++  +             +    R+S G+ + W SPLG +   Y
Sbjct: 720 KYANSVRTSLFWDMGTVWDTNWQASRYPDYPDYSDPGNIRMSAGIALQWMSPLGPLVFSY 779

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             P +  +GDK +QF F IG
Sbjct: 780 AQPFKKYDGDKAEQFQFNIG 799


>gi|238751443|ref|ZP_04612935.1| Outer membrane protein assembly factor yaeT [Yersinia rohdei ATCC
           43380]
 gi|238710310|gb|EEQ02536.1| Outer membrane protein assembly factor yaeT [Yersinia rohdei ATCC
           43380]
          Length = 795

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 191/793 (24%), Positives = 323/793 (40%), Gaps = 38/793 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  KTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  + S      +     L +I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGNQYKLNSVVVSGNLAGHQSEAEKLTKIEPGELFNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVTLRINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V +         D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVEVETQRVPGTDDLVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    +      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGLGYVHNDLSDME 540

Query: 555 EKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +               +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLESVGQDPNLTDRASFTADDFTLNLGWTYNNLDRGFFPTSGVKSSVNTKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDD--SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+++++I    S +  L +D    ++G  R GYG  I S K +  ++ F    +  +
Sbjct: 601 PGSDNEFYKITFDTSAYQPLDEDRSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV-----------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAF 711
           RGF    IGP+            D   A+GG   + AS  +  P P + E+    +R +F
Sbjct: 660 RGFRSNNIGPKAAYYTNADGSVRDSTDAVGGNAMAVASLELITPTPFISEKYSNSVRTSF 719

Query: 712 FVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHR 765
           F+DS T++  +    A             S  RVS GV + W SPLG +   Y  P++  
Sbjct: 720 FIDSGTVWDTNWENTAQTRAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYAKPVKDY 779

Query: 766 EGDKIQQFGFRIG 778
           EGDK +QF F IG
Sbjct: 780 EGDKSEQFQFNIG 792


>gi|187924101|ref|YP_001895743.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           phytofirmans PsJN]
 gi|187715295|gb|ACD16519.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           phytofirmans PsJN]
          Length = 769

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 151/777 (19%), Positives = 316/777 (40%), Gaps = 18/777 (2%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           +      S   G + L        + + +   +V+ I I G   V    + + +P+  G 
Sbjct: 1   MNLQVLTSRLAGALSLAGIALTSGSAHAAQAFVVQDIRIEGLKRVEPGTLFAYLPIKQGD 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
           + SD     A++ +YA G+F+ V+I      +++ + ER  +  + F+G +    + L  
Sbjct: 61  TFSDEKASEAIRALYATGFFNEVRISTQGDTVVVSVQERPAVGTIDFAGIHEFDKENLTK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +          YD+  V+     +K+ Y + GY    V      I    + + + + EG
Sbjct: 121 ALGSVGLSQGRYYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVAVLFSVAEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKI  I F+GN+ +S   L   +     + +  + K D+Y+K++++ D E +R++Y +
Sbjct: 181 PSAKIRQINFIGNQAFSSDTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLEHVRSYYLN 240

Query: 251 RGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRS 310
           RGY    + S  +        + +                 +     ++  L  L+ I++
Sbjct: 241 RGYLEFSIESTQVSLTPDKKEMYLTVTLHEGEPYTIASIGLAGNLLDREAELKKLVNIKA 300

Query: 311 GNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           G  ++ ++++ +++ I          F  V      D  +  VD+   +D    +YV+ I
Sbjct: 301 GERFSAEKLQATTKAIVDKLGEYGYAFATVNAVPKIDQQRHTVDLTLQVDPSRRVYVRHI 360

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            + GN ++ D V+RRE+   E    + + +  +K R+   GYF++V+++ +P     D V
Sbjct: 361 NVVGNTRTRDEVVRREMRQLESSWFDSNRLTLSKDRVNRLGYFTDVDVTTVPVEGSPDQV 420

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTF 490
            + V V +   G++ +   +     + +   +  +N FG G    +     +        
Sbjct: 421 DVDVKVSEKPTGAITLGAGFSSTDKVVLSAGVSQDNVFGSGTSLAVNVNTAKTYRTLTVT 480

Query: 491 SVEDPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
             +  + +      + +         +  D S  I    A ++  +P +E+ +  F   L
Sbjct: 481 QTDPYFTVDGIKRITDVYYRTSYPLYNYTDTSFRIITMGADLKFGIPFSEADTVYFGVGL 540

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
              +    S   +    Y +       ++  ++     +  D+ +VP +G  I ++ +  
Sbjct: 541 EQNRLNTDSSTPQSYLDYVSEFGR-VVNNVPLTTGWARDNRDSALVPSRGYFIQTNGEVG 599

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
              G ++Y++   +A Y+Y  +    +  +L+ GYG    + K   +F  +       +R
Sbjct: 600 TPAGGTEYYKADVQAQYYYSFARGFILGLNLQGGYGNGF-AGKAYPIFKNYYAGGIGSVR 658

Query: 666 GFAYKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVA 724
           G+    +GP        IGG     A+  ++FP+P       LR   F+D+  ++ +   
Sbjct: 659 GYEAGSLGPTDKTTGDPIGGSRMVVANVEMTFPLPGSGWDRTLRVFTFLDAGNVWGDEGN 718

Query: 725 LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                     +  R S G  + W SP+G + +  G P+     DK Q+F F+IG   
Sbjct: 719 STGA------NGLRYSYGAGLEWISPIGPLKLSLGFPVVKHATDKYQKFQFQIGTSF 769


>gi|34497659|ref|NP_901874.1| outer membrane protein [Chromobacterium violaceum ATCC 12472]
 gi|34103515|gb|AAQ59877.1| probable outer membrane protein [Chromobacterium violaceum ATCC
           12472]
          Length = 771

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 186/773 (24%), Positives = 344/773 (44%), Gaps = 16/773 (2%)

Query: 23  FQMGFIILFYAIFGLSAVY-GSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
            ++  + +      ++ V   ++  +++ I + G        + + +PV VG + +DA  
Sbjct: 1   MKLKRLAVAAMGLTMATVAMAADPFVIKDIRVEGLQRTEPGTVFNYLPVKVGDTFTDAKA 60

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---S 138
             A+K ++  G+F++V+++     LI+ + ER +I  L  +G      DQLK  ++    
Sbjct: 61  KEAIKALFGTGFFNDVRVESRGDTLIVTVAERPVITQLNINGAKEFSKDQLKKALKDNGF 120

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
             +  +D+  ++  V  +K+ Y S G  +V +      +    + +T  I EGV A+I  
Sbjct: 121 AESLIFDQALLDGAVQELKRQYYSRGKYSVEITPTVTKLERNRVAVTLDINEGVTARIRE 180

Query: 199 IRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           IR VG   ++ ++L    S           K D YSK++++ D E ++AFY ++GY    
Sbjct: 181 IRIVGANAFAQSKLLDEFSLTTGGWLSWITKDDQYSKQKLTGDLEKLKAFYQNQGYMEFG 240

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           + S  +        + +            +    +   ++ +  L+ L++++ G+ +N +
Sbjct: 241 IDSSQVSIGADKKDMYLVINVHEGKKYTVSDVRLAGDLKVPEAELMKLMQVKRGDTFNNE 300

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ ES + +S    +    F  V    + D  K+     + +D G   YV+R+ + GN +
Sbjct: 301 KVTESVKALSDRLGNEGYAFANVNVLPDIDREKQTAAFTFFVDPGRKTYVRRVNVAGNSK 360

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D VIRREL   EG P N + ++R+K R+   GYF +VN+      D  D V + + +K
Sbjct: 361 TRDEVIRRELRQLEGAPYNAANVKRSKERLELLGYFEDVNVETPAVADAPDQVDMNIGLK 420

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
           + S GS+  +  Y   +G+ +  +I  +N FG G    L    G    +NY+ S  DPYF
Sbjct: 421 ERSTGSISGSLGYVQGEGLVLGANISQSNIFGSGKYMSLGMSTG-KVNKNYSLSFTDPYF 479

Query: 498 LGSPISAGFDLQKTHLED-----GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA 552
               +S G+DL             +   +   A +R  VPITE    +F           
Sbjct: 480 TPDGVSLGYDLYNRVYNPDATSISAYKTSTTGADMRFGVPITEYDRINFTIGAEKTDITT 539

Query: 553 ISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQ 612
            S   +    +     +  ++    +     +T D+ + P +G  I  + D+   GG  Q
Sbjct: 540 YSNSPQQYIDFVKQYGNSNYTVLG-TVGWGRDTRDSALWPTRGASIRVNADFGLPGGSLQ 598

Query: 613 YHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGI 672
           Y+ +  + ++F+ LS D  ++ +   GY       K L  F  F +     +RG+    I
Sbjct: 599 YYSLTHQQTWFFPLSKDFTLMLNGELGYADGYGKTKQLPFFKNFYMGGLGSVRGYDSSSI 658

Query: 673 GPRVD-KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADK-- 729
           GP        +GG   + A+  + FP P + +   LR + F D+ TL+  ++        
Sbjct: 659 GPYDSVANSYLGGNRKAVANVEILFPFPGMKDNKSLRTSLFFDAGTLWNTNLTAAEKAQG 718

Query: 730 -LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                   +R S G+ + W SP+G M      PL+  +GDKIQ+F F++G   
Sbjct: 719 ITSSPSDGFRYSAGLALTWLSPMGPMKFSIANPLKKEQGDKIQRFQFQLGTAF 771


>gi|295676817|ref|YP_003605341.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1002]
 gi|295436660|gb|ADG15830.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1002]
          Length = 770

 Score =  404 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 159/753 (21%), Positives = 314/753 (41%), Gaps = 15/753 (1%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
             + +   +V+ I I G   V    + + +P+  G + SD     A++ +YA G+F++VK
Sbjct: 23  VAHATTPFVVQDIRIEGLQRVEPGTVFAYLPIKQGDTFSDDKASEAIRALYATGFFNDVK 82

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHN 155
           I    +V+++ + ER  I  + F+G +  + D L   +          +D+  V+     
Sbjct: 83  IATEGNVVVVQVQERPAIGTIDFAGIHEFEKDNLIKALRAVGLSQGRYFDKALVDKAEQE 142

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           +K+ Y + G+    V      I    + I + + EG  AKI  I F+GNK +S   L   
Sbjct: 143 LKRQYLTRGFYAAEVTTTITPIDRNRVGILFSVAEGPSAKIRQINFIGNKTFSTGTLRDE 202

Query: 216 IS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLI 274
           +     + +  + K D+Y+K++++ D E +R+FY +RG+    + S  +        + +
Sbjct: 203 MQLSTPNWFSWYTKNDLYAKDKLTGDLENLRSFYLNRGFLEFSIESTQVSISPDKKDMYL 262

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
                       +    +     ++  L  LI+I+ G+ ++ ++++ +++ I        
Sbjct: 263 TITLHEGQPYTISNIRLAGNLLDREAELKKLIKIKPGDRFSAEKLQATTKAIVDKLGEYG 322

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F  V  + N D     VD+   +D    +YV+RI + GN ++ D V+RRE+   E   
Sbjct: 323 YAFATVNAQPNIDQNNHTVDLTLQVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSW 382

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDK 454
            + + +  +K RI   GYF++V+++ +P     D V + V V +   G++ +   +    
Sbjct: 383 FDSNRLSLSKDRINRLGYFTDVDVTTVPVEGTPDQVDIDVKVAEKPTGAITLGAGFSSTD 442

Query: 455 GMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQ 509
            + +   I  +N FG G    +     +         V+  + +      + +       
Sbjct: 443 KVVLSAGISQDNVFGSGTSLAVNINTAKTYRTLTVTQVDPYFTVDGIKRITDVYYRTYQP 502

Query: 510 KTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH 569
             +  D S  I      ++  +P +E  +  F       Q    +        Y      
Sbjct: 503 LYYSTDSSFKIVTMGGDLKFGIPFSEVDTVYFGAGFEQNQLDVDANTPASYRQYVNDFGR 562

Query: 570 GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD 629
              ++  ++     +  D+ +VP +G    ++ +Y    G +QY++    A Y+Y  +  
Sbjct: 563 -VSNNVPLTVGWSRDARDSALVPSRGYFAQANAEYGTPIGGTQYYKADINAQYYYSFARG 621

Query: 630 SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV-DKKYAIGGKIYS 688
             +  + + GYG  + S K   +F  +       +RG+    +GPR       IGG    
Sbjct: 622 FVLGFNFQGGYGNGL-SGKPYPIFKNYYAGGIGSVRGYEPSSLGPRDKTTGDPIGGSKLL 680

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWN 748
             +  ++FP+P       LR   F+D+  ++A              +  R   GV + W 
Sbjct: 681 VGNIELTFPLPGTGYDRTLRVFTFLDAGNVWA---DASTAATSTGANGLRYGYGVGLAWI 737

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           SP+G + +  G PL    GD+ Q+F F+IG   
Sbjct: 738 SPIGPLKLSLGFPLTKHTGDQYQKFQFQIGTAF 770



 Score = 56.7 bits (134), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 56/169 (33%), Gaps = 18/169 (10%)

Query: 34  IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYA--- 90
           ++    ++      +  I + G     +  +   I +  G   S   L    K I     
Sbjct: 260 MYLTITLHEGQPYTISNIRLAGNLLDREAELKKLIKIKPGDRFSAEKLQATTKAIVDKLG 319

Query: 91  -MGY-FSNV----KIKIVDSVLIIDLIERKI----INHLFFSGNNNLKDDQLKMIVRSRS 140
             GY F+ V     I   +  + + L         +  +   GN   +D+ ++  +R   
Sbjct: 320 EYGYAFATVNAQPNIDQNNHTVDLTLQVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLE 379

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIE 189
           ++ +D + ++     I +     GY    V V    +  T   +   ++
Sbjct: 380 SSWFDSNRLSLSKDRINRL----GY-FTDVDVTTVPVEGTPDQVDIDVK 423


>gi|218547632|ref|YP_002381423.1| outer membrane protein assembly factor YaeT [Escherichia fergusonii
           ATCC 35469]
 gi|226708910|sp|B7LW74|YAET_ESCF3 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|218355173|emb|CAQ87780.1| outer membrane protein assembly factor [Escherichia fergusonii ATCC
           35469]
 gi|324112412|gb|EGC06389.1| outer membrane protein [Escherichia fergusonii B253]
          Length = 802

 Score =  404 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 178/800 (22%), Positives = 318/800 (39%), Gaps = 45/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSATIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTNELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVTGNLAGHSAEIEELTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQIGVQQDNWLGTGYAVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S          +   + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
            +  +     ++ E+GK        + +    YN LD    P  G  ++ +      G D
Sbjct: 541 PQVAMDRYLESMGEYGKDSFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           ++Y+++    + +  + DD   V  G  R+GYG  I   K +  ++ F    +  +RGF 
Sbjct: 601 NEYYKLSLDTATYVPIDDDHKWVVLGRTRWGYGDGIG-GKEMPFYENFYAGGSSTVRGFQ 659

Query: 669 YKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
              IGP+                              A+GG   + AS  +  P P + E
Sbjct: 660 SNTIGPKAVYKKGAHSSNDEYDDYEECTESNGCQSDDAVGGNAMAVASFELITPTPFISE 719

Query: 704 RA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
           +    +R + F D  T++  +             +    R+S G+ + W SPLG +   Y
Sbjct: 720 KYANSVRTSLFWDMGTVWDTNWQASRYPDYPDYSDPGNIRMSAGIALQWMSPLGPLVFSY 779

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             P +  +GDK +QF F IG
Sbjct: 780 AQPFKKYDGDKAEQFQFNIG 799


>gi|16763614|ref|NP_459229.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167990110|ref|ZP_02571210.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168263908|ref|ZP_02685881.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|197265202|ref|ZP_03165276.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|81523927|sp|Q8ZRP0|YAET_SALTY RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|16418729|gb|AAL19188.1| putative outer membrane antigen [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|197243457|gb|EDY26077.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|205331366|gb|EDZ18130.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205347521|gb|EDZ34152.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|261245456|emb|CBG23246.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267991915|gb|ACY86800.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301156851|emb|CBW16327.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312911194|dbj|BAJ35168.1| outer membrane protein assembly complex YaeT protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|321222192|gb|EFX47264.1| Outer membrane protein assembly factor YaeT precursor [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323128544|gb|ADX15974.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|332987176|gb|AEF06159.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 804

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 175/802 (21%), Positives = 322/802 (40%), Gaps = 47/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + +L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIENLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF-----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
            +  +     ++ +            + +    YN LD    P  G  ++ +      G 
Sbjct: 541 PQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGS 600

Query: 610 DSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           D++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF
Sbjct: 601 DNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGF 659

Query: 668 AYKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVP 702
               IGP+                              A+GG   + AS     P P + 
Sbjct: 660 QSNTIGPKAVYKNGAHTSWDDNDDYEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFIS 719

Query: 703 ERA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGV 756
           E+    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG +  
Sbjct: 720 EKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVF 779

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P +  +GDK +QF F IG
Sbjct: 780 SYAQPFKKYDGDKAEQFQFNIG 801


>gi|56412497|ref|YP_149572.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197361432|ref|YP_002141068.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|81359599|sp|Q5PD65|YAET_SALPA RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708918|sp|B5BAN4|YAET_SALPK RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|56126754|gb|AAV76260.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197092908|emb|CAR58337.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 803

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 174/801 (21%), Positives = 321/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
            +  +     ++ +           + +    YN LD    P  G  ++ +      G D
Sbjct: 541 PQIAMDRYLESMGDPDASDFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           ++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF 
Sbjct: 601 NEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGFQ 659

Query: 669 YKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
              IGP+                              A+GG   + AS     P P + E
Sbjct: 660 SNTIGPKAVYKNGAHTSWDDNDDYEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFISE 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGVY 757
           +    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG +   
Sbjct: 720 KYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  +GDK +QF F IG
Sbjct: 780 YAQPFKKYDGDKAEQFQFNIG 800


>gi|62178794|ref|YP_215211.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|75484795|sp|Q57T31|YAET_SALCH RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|62126427|gb|AAX64130.1| putative outer membrane antigen [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 805

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 175/803 (21%), Positives = 321/803 (39%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF-----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
            +  +     ++ +            + +    YN LD    P  G  ++ +      G 
Sbjct: 541 PQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGS 600

Query: 610 DSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           D++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF
Sbjct: 601 DNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGF 659

Query: 668 AYKGIGPRV--------------------------DKKYAIGGKIYSSASAAVSFPMPLV 701
               IGP+                               A+GG   + AS     P P +
Sbjct: 660 QSNTIGPKAVYGYGAHTDPNDNNDDYEACTQSSGCKSDDAVGGNAMAVASLEFMTPTPFI 719

Query: 702 PERA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMG 755
            E+    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG + 
Sbjct: 720 SEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GDK +QF F IG
Sbjct: 780 FSYAQPFKKYDGDKAEQFQFNIG 802


>gi|238784888|ref|ZP_04628888.1| Outer membrane protein assembly factor yaeT [Yersinia bercovieri
           ATCC 43970]
 gi|238714205|gb|EEQ06217.1| Outer membrane protein assembly factor yaeT [Yersinia bercovieri
           ATCC 43970]
          Length = 794

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 192/792 (24%), Positives = 326/792 (41%), Gaps = 37/792 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  KTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 IGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLEILRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  + S      +     L++I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSDADKLVKIEPGELYNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    +      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGLGYVHNDLSDME 540

Query: 555 EKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +               +++    YN LD    P KG+  S +     
Sbjct: 541 PQVAMWRYLDSVGQDPNLIDRAGFTADDFTLNLGWTYNNLDRGFFPTKGVKSSVNTKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++++++    S +  L +D   V     R GYG  I S K +  ++ F    +  +
Sbjct: 601 PGSDNEFYKVTFDTSAYQPLDEDHSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV----------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAFF 712
           RGF    IGP+           D   A+GG   + AS  +  P P + E+    +R +FF
Sbjct: 660 RGFRSNNIGPKAAYYNANGTVRDSTDAVGGNAMAVASLELITPTPFISEKYANSIRTSFF 719

Query: 713 VDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
           +DS T++  +    A             S  RVS GV + W SPLG +   Y  P++  E
Sbjct: 720 IDSGTVWDTNWENTAATRAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYAKPVKDYE 779

Query: 767 GDKIQQFGFRIG 778
           GDK +QF F IG
Sbjct: 780 GDKSEQFQFNIG 791


>gi|297538511|ref|YP_003674280.1| outer membrane protein assembly complex protein YaeT [Methylotenera
           sp. 301]
 gi|297257858|gb|ADI29703.1| outer membrane protein assembly complex, YaeT protein
           [Methylotenera sp. 301]
          Length = 782

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 186/789 (23%), Positives = 342/789 (43%), Gaps = 24/789 (3%)

Query: 8   FRRIKRLLE-KYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILS 66
            +++K      +  ++ ++  +++  +    ++       +V+ I + G        + +
Sbjct: 3   LKKLKHSKNTDHIFKNLKLKSVLILVSGLFANSALALEPFVVKDIRVEGLQRTEAGTVFT 62

Query: 67  RIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNN 126
            +PV VG++++D     A+K++Y  G+F +V+I+    VL++ + ER  I  + FSGN +
Sbjct: 63  YLPVKVGETMNDDLASQAIKSLYNTGFFKDVRIEAEGDVLVVTVQERSSIAQIDFSGNKS 122

Query: 127 LKDDQLK---MIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLN 183
              D++K     +       +D+  ++     +K+ Y S G     VK     +    + 
Sbjct: 123 FPTDKMKEGLKQIGIAEGQIFDKSQLDRAEQEVKRQYLSQGKYGATVKAVVSPLERNRVA 182

Query: 184 ITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEE 242
           + + IEEG  +KI SI  VGN+ +S   L     + T  +   + K D YSK++++ D E
Sbjct: 183 VRFDIEEGAVSKIRSINIVGNQAFSMDDLRAEFLLTTPNWMSWWNKDDQYSKQKLNADLE 242

Query: 243 AIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTL 302
           A+R+FY +RGY    + S  +        + I            +    +    +    +
Sbjct: 243 ALRSFYLNRGYLEFNIDSTQVSITPDKKDIYITVNVTEGEKYTISEVKLAGDTIVPDSEI 302

Query: 303 LSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQG 362
             LI ++ G+ ++ ++I ESS+ IS    +    F  V      +  +      + +D G
Sbjct: 303 QQLITVKKGDTFSREKITESSKAISDRLSNDGYAFSNVNPVPEVNKEQHTAAFTFFVDPG 362

Query: 363 SPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLP 422
             +YV+RI I GN ++ D V+RRE+   E        I R+K R++ T +FS+VNI    
Sbjct: 363 KRVYVRRINIAGNTRTRDEVLRREVRQLESAWYASDKINRSKERLIRTDFFSDVNIETPA 422

Query: 423 ANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGR 482
               +D V L +SV + S GS+         +G+ +   ++ NNF G G R       G+
Sbjct: 423 VPGTTDQVDLNISVTEKSTGSIQFGAGLSSSEGVVLGITVNQNNFLGTGNRVSAQINTGK 482

Query: 483 HAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDG-----SLDINDESAAVRMIVPITESI 537
                Y+ S  DPYF    IS GFD+ +  ++       S + +     VR  VP+ E  
Sbjct: 483 VNT-TYSLSYTDPYFTPDGISRGFDIYRRDVDTSSLNVASYNTSSYGGGVRFGVPLNERD 541

Query: 538 STSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGML 597
             +F     F      +        Y         +S  +S    ++T D+ +    G+L
Sbjct: 542 GINFGLAADFTTVDLNTNSPIQYQKYCGNATGCSSNSIVVSGGWSHDTRDSIMFTNNGVL 601

Query: 598 ISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFS 657
              S + +    D  Y++I  + ++F  +  D   + +   GY      NKN   F  + 
Sbjct: 602 QKLSAEVSLPVLDLNYYKIDYKQAWFKNVYKDFTFMLNGEIGYADSYG-NKNFPFFKNYF 660

Query: 658 VSSNYYLRGFAYKGIGPRVDK-----KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFF 712
           +     +RG+    +GPR         +A+GG      +A + FP+P + +    R + F
Sbjct: 661 MGGVNSVRGYDNGSLGPRDIDPITGLDFAVGGTKRLLGNAELFFPVPGLKDSKQFRLSAF 720

Query: 713 VDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQ 772
           +D   ++ +  +     L       R STG+ I W SP G + + Y  PL  +  D  Q 
Sbjct: 721 LDGGNVWGSDSSYSLSDL-------RYSTGLGISWLSPFGPLKLVYAKPLNSKSTDNTQS 773

Query: 773 FGFRIGNRM 781
             F++G++ 
Sbjct: 774 IQFQLGSQF 782


>gi|295098668|emb|CBK87758.1| outer membrane protein assembly complex, YaeT protein [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 805

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 177/803 (22%), Positives = 326/803 (40%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRPGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLVVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISNFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + SL +I+ G+LY+  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDKYTLSGVEVSGNLAGHSAEIESLTKIQPGDLYSGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+T+   +   + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDSIKKLLGRYGYAYPRVQTQPEINDTDKTVKLHVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGRPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGYSVGINGTKNDYQTYSEFSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +  S           +  P+ E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSSYTNKSYGLDGTLGFPVNEYNTLRAGLGYVHNDLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF---------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ +                + +    YN LD    P +G  ++ +    
Sbjct: 541 PQVAMWRYLDSIGQSASTSSDDNGFAADDFTFNYGWTYNRLDRGYFPTEGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++++++    + ++ + +D   V  G  R+GYG  I S K L  ++ F    +  
Sbjct: 601 IPGSDNEFYKVTLDTASYFPIDEDHKWVVLGRTRWGYGDGIGS-KELPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV--------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
           +RGF    IGP+                         A+GG   + AS     P P + +
Sbjct: 660 VRGFQSNNIGPKAVYYGGNDEDNCASRDPKQVCSSDDAVGGNAMAVASLEFITPTPFISD 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R +FF+D+ T++  +    A           + S  R+S G+ + W SPLG + 
Sbjct: 720 KYANSVRTSFFMDAGTVWDTNWENTAQMRAAGVPDYSDPSNIRMSAGIALQWMSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GDK +QF F IG
Sbjct: 780 FSYAQPFKKYDGDKAEQFQFNIG 802


>gi|283835239|ref|ZP_06354980.1| outer membrane protein assembly complex, YaeT protein [Citrobacter
           youngae ATCC 29220]
 gi|291068950|gb|EFE07059.1| outer membrane protein assembly complex, YaeT protein [Citrobacter
           youngae ATCC 29220]
          Length = 805

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 176/803 (21%), Positives = 321/803 (39%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + +L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIETLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGVGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  P+ E  +          +   + 
Sbjct: 481 DGVSLGGRVFYNDFEADDADLSDYTNKSYGTDVTLGFPVNEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF-----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
            +  +     ++ +            + +    YN LD    P  G  ++ +      G 
Sbjct: 541 PQIAMDRYLESMGQPADTSSFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLNGKVTIPGS 600

Query: 610 DSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGF 667
           D++Y+++    + +  + DD   V  G  ++GYG  I S K +  ++ F    +  +RGF
Sbjct: 601 DNEYYKLSLDTATYVPIDDDHKWVVLGRTKWGYGDGIGS-KEMPFYENFYAGGSSTVRGF 659

Query: 668 AYKGIGPRV--------------------------DKKYAIGGKIYSSASAAVSFPMPLV 701
               IGP+                               A+GG   + AS     P P +
Sbjct: 660 QSNTIGPKAVYKNGAHTDWNDDGDDYEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFI 719

Query: 702 PERA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMG 755
            ++    +R +FF D  T++  +    +   +     + S  R+S G+ + W SPLG + 
Sbjct: 720 SDKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPSNIRMSAGIALQWMSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GDK +QF F IG
Sbjct: 780 FSYAQPFKKYDGDKAEQFQFNIG 802


>gi|56478859|ref|YP_160448.1| outer membrane protein/surface antigen [Aromatoleum aromaticum
           EbN1]
 gi|56314902|emb|CAI09547.1| probable outer membrane protein/surface antigen [Aromatoleum
           aromaticum EbN1]
          Length = 766

 Score =  403 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 156/766 (20%), Positives = 312/766 (40%), Gaps = 22/766 (2%)

Query: 30  LFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIY 89
           L  A+F ++ V+     +V+ I + G        + + +PV VG++ ++A    A++ ++
Sbjct: 9   LLTALFAVAPVHAFEPFVVKDIRVEGIQRTEAGTVFNYLPVRVGETFTEAQAAEAIRGLF 68

Query: 90  AMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM---IVRSRSAAAYDE 146
           A G+F +V+I++   VL++ + ER  I  + F G      + LK     V    +  +D 
Sbjct: 69  ATGFFKDVRIEVEGDVLVVLVDERPAIAQIDFVGVKEFDKEALKKGLREVGLAESRIFDR 128

Query: 147 DTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKN 206
             +      +K+ Y S G    +++     +    + + + ++EG  AKI  I  +GNK 
Sbjct: 129 SLLERAEQELKRQYLSRGKYAAVIETTVTPLERNRVGLNFKVDEGEVAKIRQIEIIGNKA 188

Query: 207 YSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFD 265
           +  + +  +           + K D YS+++++ D E +R++Y +RGY    + S  +  
Sbjct: 189 FKDSEVLGLFQLTTPGWLTWYTKNDQYSRQKLAADLENLRSYYLNRGYLDFNIDSTQVSI 248

Query: 266 KQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEK 325
                 + I            +    +    + ++    L  I+ G +++ +++ E+++ 
Sbjct: 249 TPDKKDIYISVSVTEGERYTVSAVRFAGDLILPEEEYRKLAAIKPGEIFSREKLTETTKA 308

Query: 326 ISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRR 385
           ++    +    F  V      D  KR V     +D G  +YV+RI + GN ++ D V+RR
Sbjct: 309 VADRLGNEGYAFANVNASPEVDKEKREVAFTIFVDPGRRVYVRRINVGGNTKTRDEVVRR 368

Query: 386 ELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVG 445
           E+   EG   +   I R++ RI   G+F EV +        +D V +  +VK+   G++ 
Sbjct: 369 EMRQMEGAWYDAEEINRSRTRIDRLGHFEEVTVETPAVTGTTDQVDVNFNVKERPTGNLT 428

Query: 446 IATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----S 500
           +   +   + + +   +   N FG G    LA      +           +         
Sbjct: 429 LGVGFSSSENVVLSASVSQQNLFGSGNALTLALNTSESSRTYALSFTNPYFTQDGLSLGW 488

Query: 501 PISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
                       L           A +RM  PI E  + +F   +         E  +  
Sbjct: 489 DAYHRTYDPSESLSVAPYKTVSSGAGLRMGYPIAEDDAINFGLAVDRTVITTFDESPQQY 548

Query: 561 ----SIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRI 616
                      +    +S   +     +T D+   PR G       + +   G  +Y+++
Sbjct: 549 LDFCDPDKDDFDCDSVTSLVATAGWSRDTRDSTFYPRMGSYQRVFGELSIPPGALRYYKL 608

Query: 617 GSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV 676
             +  +++    D  ++ +   G+G      K L  +  F       +RGF    IGP+ 
Sbjct: 609 NYQYQHWFPFGRDYALMLNTDLGWGKGYG-GKPLPFYKNFYAGGIGSVRGFDQSSIGPKD 667

Query: 677 D-KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDS 735
              + A+GG      +A   FP+P        R + F D  ++++    + A        
Sbjct: 668 PISEDALGGNRRVIGNAEFYFPLPGTGRDRSFRMSAFFDVGSVWSEGDKVKA-------G 720

Query: 736 FWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             R STG+   W+SP+G +   +G+PL+ +E D++Q+F F++G+  
Sbjct: 721 DLRYSTGLAFSWSSPIGPLKFSFGLPLKKKETDELQKFQFQLGSVF 766


>gi|157372017|ref|YP_001480006.1| outer membrane protein assembly factor YaeT [Serratia
           proteamaculans 568]
 gi|166919052|sp|A8GID8|YAET_SERP5 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|157323781|gb|ABV42878.1| surface antigen (D15) [Serratia proteamaculans 568]
          Length = 801

 Score =  403 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 184/799 (23%), Positives = 325/799 (40%), Gaps = 44/799 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVTDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +++  L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHAFTNDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I               + +         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGEQYKLTDVVVNGNLAGHSAEVAQLTKIEPGELYNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I          + RV T+   + A + V +   ID G+  YV+RI+ EGND S
Sbjct: 301 VTKMEDNIKTMLGRYGYAYPRVSTQPEINDADKTVKLHVNIDAGNRFYVRRIKFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +  + +E+ K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNAQVEQGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      Y  + G+  +  +  +N+ G GY   ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQAGVQQDNWLGTGYSVGISGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI- 553
                       D +    +              +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSDYTNKSYGIDGTLGFPINENNSLRTGLGYVHNGLSNMQ 540

Query: 554 -------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                         +  TT          +++    YN LD    P  G   + +     
Sbjct: 541 PQIAMWRYLDSMGLNPNTTDRASYSADDFTLNLGWTYNNLDRGYFPTSGNRTTLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++Y+++   +  +  ++DD   V     R GY   +   K +  ++ F    +  +
Sbjct: 601 PGSDNEYYKLTLDSVQYVPINDDRTWVLLGRGRLGYADGLG-GKEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV-----------------DKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           RGF    IGP+                  +   A+GG   + AS  +  P P + E+   
Sbjct: 660 RGFGSNTIGPKAAYYNSNSYGCSNGTPICNSDDAVGGNAMAVASMELITPTPFISEKYAN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKLEGN------DSFWRVSTGVEIMWNSPLGMMGVYYG 759
            +R + F+D+ T++  +    A     +       S  RVS G+ + W SPLG +   Y 
Sbjct: 720 SVRTSLFMDAGTVWDTNWQNTAQTSMYDIPDYSKASNIRVSAGIALQWMSPLGPLVFSYA 779

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P++  EGDK +QF F IG
Sbjct: 780 NPIKKYEGDKSEQFQFNIG 798


>gi|323529809|ref|YP_004231961.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1001]
 gi|323386811|gb|ADX58901.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1001]
          Length = 769

 Score =  403 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 151/777 (19%), Positives = 314/777 (40%), Gaps = 18/777 (2%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           +      S   G +         +        +V+ I I G   V    + + +P+  G+
Sbjct: 1   MNFQALTSRLAGALSFAGITLATATAQAVEPFVVQDIRIEGLQRVEPGTLFAYLPIKQGE 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
           + +D     +++ +YA G+F++V+I    +V+ + + ER  +  + F+G +    + L  
Sbjct: 61  TFTDDKASESIRALYATGFFNDVRISTEGNVVTVHVKERPAVGTIDFAGIHEFDKENLTK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +         +YD+  V+     +K+ Y + GY    V      I    + I + + EG
Sbjct: 121 ALRAVGLSQGRSYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVAILFAVAEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKI  I F+GN  +S   L   +     + +  + K D+Y+K++++ D E +R++Y +
Sbjct: 181 PSAKIRQINFIGNSVFSTDTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLEHVRSYYLN 240

Query: 251 RGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRS 310
           RGY    V S  +        + +            +    +     ++  L  L+ I++
Sbjct: 241 RGYLEFNVESTQVSLTPDKKDMYLTVTLHEGEPYTISSIKLAGNLLDRENELTRLVNIKA 300

Query: 311 GNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           G  ++ ++++ +++ +          F  V      D     VD+   +D    +YV+ I
Sbjct: 301 GERFSAEKLQAATKAVVDKLGEYGYAFATVNALPKIDQQHHTVDLTLQVDPSRRVYVRHI 360

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            + GN ++ D V+RRE+   E    + + +  +K R+   GYF++V+++ +P     D V
Sbjct: 361 NVTGNIRTRDEVVRREMRQLESSWFDSNRLMLSKDRVNRLGYFTDVDVTTVPVEGSPDQV 420

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTF 490
            + V V +   G++ +   +     + +   I  +N FG G    +     +        
Sbjct: 421 DVDVKVNEKPTGAITLGAGFSSTDKVVLSAGISQDNVFGSGTSLAVNLNTAKTYRTLSLT 480

Query: 491 SVEDPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
             +  + +      + +         +  D S  +    A ++  +P +E+ +  F   +
Sbjct: 481 QTDPYFTVDGIKRITDVYYRTSYPLYYYTDTSFRVITVGADLKFGIPFSEADTVYFGLGI 540

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
              +    S   +    Y         ++  I+     +  D+ +VP +G  + ++ +  
Sbjct: 541 EQNRLRTDSSTPQSYKDYVAEF-GNVVNNVPITAGWARDNRDSALVPSRGYFVQANSEIG 599

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
              G +QY++   +A  +Y  S    +  +L+ GYG    + K   +F  +       +R
Sbjct: 600 TPAGGTQYYKTDVQAQSYYSFSRGFILGLNLQGGYGNGF-AGKAYPIFKNYYAGGIGSVR 658

Query: 666 GFAYKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVA 724
           G+    +GP        IGG     A+  ++FP+P       LR   F+D+  ++ N   
Sbjct: 659 GYESGSLGPTDKTTGDPIGGSRMVVANVEMTFPLPGTGWDRTLRVFTFLDAGNVWGNEGN 718

Query: 725 LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                     +  R S G  + W SP+G + +  G P+     DK Q+F F+IG   
Sbjct: 719 SNGA------NGLRYSYGAGLEWISPIGPLKLSLGFPVVRHATDKYQKFQFQIGTSF 769


>gi|288941766|ref|YP_003444006.1| outer membrane protein assembly complex, YaeT protein
           [Allochromatium vinosum DSM 180]
 gi|288897138|gb|ADC62974.1| outer membrane protein assembly complex, YaeT protein
           [Allochromatium vinosum DSM 180]
          Length = 776

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 166/764 (21%), Positives = 316/764 (41%), Gaps = 13/764 (1%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           ++L      +  +  +    V  I + G   +    + + +P+ VG ++ D      ++ 
Sbjct: 16  LLLCALATSIPGMAIAEVFQVSDIRVEGLRRIAPGTVFNYLPIQVGDTVGDDVTGGIIRA 75

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLK---MIVRSRSAAAY 144
           +Y  G+F +V+++   +VL+I + ER  I  +  SGN +++   L+     +  +    +
Sbjct: 76  LYQTGFFDDVRVERDGNVLVIQVRERPAIAEIKISGNKDIETKALETALADIGLKEGRVF 135

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           +   ++     +++ Y + G   V+V+     +    + +   I EG+ A+I  I  +GN
Sbjct: 136 NRSVLDRIEQELERQYFARGKYGVVVQSTVSPLERNRVAVNIEIIEGLTARIKQINLIGN 195

Query: 205 KNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL 263
           + +    L +V     T     + K D YSK++++ D E++R+FY DRGY    V S  +
Sbjct: 196 QAFEADELRKVFELGPTRWNSFYTKNDQYSKQKLAGDLESLRSFYLDRGYIKFDVKSTQV 255

Query: 264 FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESS 323
                   + +    +       +    +    +  + L  LI ++ G  ++ +   ES+
Sbjct: 256 SISADRKDIYVTVTIDEGQPFRVSDIKLAGDPSVPAEQLFPLIHLKRGEFFSRKLTTESA 315

Query: 324 EKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVI 383
           E+IS         F  V T    D  K  V + + +D G  +YV+R++++GN ++ D V+
Sbjct: 316 ERISNLLGDEGYAFANVNTIPEVDEEKHEVAVTFFVDAGKRVYVRRVDMQGNTRTRDEVL 375

Query: 384 RRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS 443
           RRE+   E    +  ++ +++ R+   GYF EV I        +D V + V VK+  AG+
Sbjct: 376 RREMRQLETAWFSADLVRKSRERLQRLGYFDEVAIETPAVPGSADQVDVEVKVKEKPAGN 435

Query: 444 VGIATNYEVDKGMGVEGHIDDNNFFGQGYR----ARLAAGFGRHAVQNYTFSVEDPYFLG 499
           +     +    G+ +   +  NNF G G R       ++    +                
Sbjct: 436 LAAGIGFSQSDGILLNASVTQNNFLGTGKRVAVAFNNSSSTTLYQFGYTNPYYTVDGISR 495

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKI 559
               +  +     L       +   A +   +PIT++      ++    QY   +  E  
Sbjct: 496 GFNLSYRETDYDELVGADYSTDIGIAGLNFGLPITDTSRAGLGFNY---QYTDFTAGESE 552

Query: 560 PSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR 619
            +          FS  S++ S   +T D  + P +G L S   +    G D QY++I   
Sbjct: 553 IAQDFVANNGNTFSDFSLTASYTRDTRDKAVFPTRGSLRSLQAELTVPGSDLQYYKIRYD 612

Query: 620 ASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-VDK 678
              +  L+    +  S   GYG        L  F+ F       +RG+    +GPR V  
Sbjct: 613 EQLYIPLTSRYIVALSANLGYGDSYGETNYLPFFENFYAGGPRSVRGWKANTLGPREVGS 672

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPE-RAGLRGAFFVDSATLYANHVALGADKLEGNDSFW 737
              +GG +  + S     P P+  +    LR   F+D   +++ + +        +    
Sbjct: 673 DDPVGGNLKFAGSIEFFAPAPIGGQFEKSLRLGAFLDFGNVWSTYDSNLLTYSGFDLGDL 732

Query: 738 RVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           R STGV + W SP+G + V +  PL  ++GD+ Q F F  G   
Sbjct: 733 RYSTGVSVTWLSPVGALSVSFAFPLNEKDGDETQVFQFGFGQTF 776


>gi|271499503|ref|YP_003332528.1| outer membrane protein assembly complex, YaeT protein [Dickeya
           dadantii Ech586]
 gi|270343058|gb|ACZ75823.1| outer membrane protein assembly complex, YaeT protein [Dickeya
           dadantii Ech586]
          Length = 805

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 184/803 (22%), Positives = 332/803 (41%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVTDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L+I + ER  I  L FSGN  +K++ LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNSLLIQVKERPTIASLTFSGNKAVKEEMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYSATVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK++S   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKSFSSDELISRFQLRDEVPWWNVVGDRKYEKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  +           +  L RI+ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGNQYKLSGVVVRGNLVGHATEIEDLTRIQPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+ + +   + V +   +D G+   V+RI  EGND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPDINDTDKTVRLNINVDAGNRFTVRRIRFEGNDVS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGGWLGNDLVQQGKERLNRLGYFESVDTETQRVPGTPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
            + GS+     +  + G+  +  +  +N+ G G    ++     +         +    +
Sbjct: 421 RNTGSLNFGVGFGTESGISFQAGVQQDNWLGTGNSVGISGTRNDYQTYVELSMTDPYLTV 480

Query: 499 G----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA-- 552
                       + +  + +              +  PI E+ S     D          
Sbjct: 481 DGVSLGGRVFYNNFKALNADLADYTNQSYGIGSTLGFPINENNSLRLGLDYVHNSLSDMK 540

Query: 553 --------ISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
                   +++    P   +T       +   ++    YN LD    P  G  ++ S   
Sbjct: 541 PQVAMWRYLNKAGVDPDPNSTSSASFSANDFFLTPGWTYNNLDRGYFPTAGNRVNLSTKV 600

Query: 605 AGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNY 662
              G D++Y+++   ++ ++ LS+  +  ++   + GY   + S K +  +D F    + 
Sbjct: 601 TVPGSDNEYYKMTFDSASYFPLSESRNWVLMAKTKAGYADGL-SGKEVPFYDNFFAGGSN 659

Query: 663 YLRGFAYKGIGPR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
            +RGF    IGP+                    +   A+GG   + ASA +  P P + +
Sbjct: 660 TVRGFRSNTIGPKAAYYTAGSCSSSSVSSCSIANSTDAVGGNAMAVASAELIVPTPFISD 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R +FFVD+ T++  H    A  L             R+S+G+ + W SPLG + 
Sbjct: 720 KYASSVRTSFFVDAGTVWDTHWENTAQTLAAGIPDYSKPGNIRMSSGLAVQWVSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GD+ +QF F IG
Sbjct: 780 FSYAQPFKKYDGDRSEQFQFNIG 802


>gi|53719760|ref|YP_108746.1| putative outer membrane protein [Burkholderia pseudomallei K96243]
 gi|217421712|ref|ZP_03453216.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           576]
 gi|237812799|ref|YP_002897250.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           pseudomallei MSHR346]
 gi|242314819|ref|ZP_04813835.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           1106b]
 gi|52210174|emb|CAH36153.1| putative outer membrane protein [Burkholderia pseudomallei K96243]
 gi|125719296|gb|ABN54438.1| outer membrane protein [Burkholderia pseudomallei]
 gi|217395454|gb|EEC35472.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           576]
 gi|237504063|gb|ACQ96381.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           pseudomallei MSHR346]
 gi|242138058|gb|EES24460.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           1106b]
          Length = 769

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 154/747 (20%), Positives = 316/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I     
Sbjct: 30  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGG 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     
Sbjct: 150 TRGFYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             +   D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +
Sbjct: 330 NAQPEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            I  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 450 GISQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTN 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E+ +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++     +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  +
Sbjct: 569 PLTIGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
            + GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 FQAGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   G+ + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|126452465|ref|YP_001066743.1| OMP85 family outer membrane protein [Burkholderia pseudomallei
           1106a]
 gi|167903254|ref|ZP_02490459.1| putative outer membrane protein [Burkholderia pseudomallei NCTC
           13177]
 gi|126226107|gb|ABN89647.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           1106a]
          Length = 768

 Score =  402 bits (1033), Expect = e-109,   Method: Composition-based stats.
 Identities = 154/747 (20%), Positives = 316/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I     
Sbjct: 29  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGG 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     
Sbjct: 149 TRGFYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             +   D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +
Sbjct: 329 NAQPEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            I  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 449 GISQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTN 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E+ +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++     +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  +
Sbjct: 568 PLTIGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
            + GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 FQAGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   G+ + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|238796617|ref|ZP_04640124.1| Outer membrane protein assembly factor yaeT [Yersinia mollaretii
           ATCC 43969]
 gi|238719595|gb|EEQ11404.1| Outer membrane protein assembly factor yaeT [Yersinia mollaretii
           ATCC 43969]
          Length = 794

 Score =  402 bits (1032), Expect = e-109,   Method: Composition-based stats.
 Identities = 193/792 (24%), Positives = 328/792 (41%), Gaps = 37/792 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  KTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 IGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLEILRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  + S      +     L++I SG LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSDADKLVKIESGELYNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    +      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGLGYVHNDLSDME 540

Query: 555 EKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +               +++    YN LD    P KG+  S +     
Sbjct: 541 PQVAMWRYLDSVGQDPNLTDRAGFTADDFTLNLGWTYNNLDRGFFPTKGVKSSVNTKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++++++    S +  L +D   V     R GYG  I S K +  ++ F    +  +
Sbjct: 601 PGSDNEFYKVTFDTSAYQPLDEDHSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV----------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAFF 712
           RGF    IGP+           D   A+GG   + AS  +  P P + E+    +R +FF
Sbjct: 660 RGFRSNNIGPKAAYYNANGTIRDSTDAVGGNAMAVASLELITPTPFISEKYANSIRTSFF 719

Query: 713 VDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
           +DS T++  +    A+            S  RVS GV + W SPLG +   Y  P++  E
Sbjct: 720 IDSGTVWDTNWENTAETRAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYAKPVKDYE 779

Query: 767 GDKIQQFGFRIG 778
           GDK +QF F IG
Sbjct: 780 GDKSEQFQFNIG 791


>gi|311280854|ref|YP_003943085.1| outer membrane protein assembly complex, YaeT protein [Enterobacter
           cloacae SCF1]
 gi|308750049|gb|ADO49801.1| outer membrane protein assembly complex, YaeT protein [Enterobacter
           cloacae SCF1]
          Length = 803

 Score =  402 bits (1032), Expect = e-109,   Method: Composition-based stats.
 Identities = 178/801 (22%), Positives = 326/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISNFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + SL +++ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINVTEGDQYKLSGVAVSGNLAGHSAEIESLTKVQPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I   GND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLHVNVDAGNRYYVRKIRFVGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKDRLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQVGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +  S           +  PI E  S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSSYTNKSYGVDGTLGFPINEYNSLRAGLGYVHNDLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF---------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ +                + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMNRYLDSIGQTTSTTSTDNSFSADDFTFNYGWTYNKLDRGFFPTDGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D+++++I    + ++ + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 LPGSDNEFYKISLDTASYFPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV------------------DKKYAIGGKIYSSASAAVSFPMPLVPERA 705
           +RGF    IGP+                     + A+GG   + AS  +  P P + ++ 
Sbjct: 660 VRGFQSNNIGPKAVYYGPNQDNCGSTSTGVCKSEDAVGGNAMAVASLELIVPTPFISDKY 719

Query: 706 --GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
              +R +FF D+ +++  H    A           + S  R+S G+ + W SPLG +   
Sbjct: 720 ANSVRTSFFWDAGSVWDTHWDNTAQMKAAGIPDYSDPSNIRMSAGIALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  EGDK +QF F IG
Sbjct: 780 YAQPFKKYEGDKAEQFQFNIG 800


>gi|209518716|ref|ZP_03267532.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. H160]
 gi|209500830|gb|EEA00870.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. H160]
          Length = 767

 Score =  402 bits (1031), Expect = e-109,   Method: Composition-based stats.
 Identities = 158/753 (20%), Positives = 313/753 (41%), Gaps = 18/753 (2%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
             + +   +V+ I I G   V    + + +P+  G + SD     A++ +YA G+F++VK
Sbjct: 23  VAHATTPFVVQDIRIEGLQRVEPGTVFAYLPIKQGDTFSDDKASEAIRTLYATGFFNDVK 82

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHN 155
           I    +V+++ + ER  I  + F+G +  + D L   +          YD+  V+     
Sbjct: 83  IATEGNVVVVQVQERPAIGTIDFAGIHEFEKDNLIKALRAVGLSQGRYYDKALVDKAEQE 142

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           +K+ Y + G+    V      I    + I + + EG  AKI  I F+GNK +S   L   
Sbjct: 143 LKRQYLTRGFYAAEVTTTITPIDRNRVGILFSVAEGPSAKIRQINFIGNKTFSTGTLRDE 202

Query: 216 IS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLI 274
           +     + +  + K D+Y+K++++ D E +R++Y +RGY    + S  +        + +
Sbjct: 203 MQLSTPNWFSWYTKNDLYAKDKLTGDLENVRSYYLNRGYLEFAIESTQVSISPDKKDMYL 262

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
                       +    +     ++  L  LI+I+ G+ ++ ++++ +++ I        
Sbjct: 263 TVTLHEGEPYTISSIKLAGNLLDREAELKKLIKIKPGDRFSAEKLQATTKAIVDKLGEYG 322

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F  V  +   D     VD+   +D    +YV+RI + GN ++ D V+RRE+   E   
Sbjct: 323 YAFATVNAQPQIDQQHHTVDLTLQVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSW 382

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDK 454
            + + +  +K RI   GYF++V+++ +P     D V + V V +   G++ +   +    
Sbjct: 383 FDSNRLALSKDRINRLGYFTDVDVTTVPVEGTPDQVDIDVKVAEKPTGAITLGAGFSSTD 442

Query: 455 GMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQ 509
            + +   I  +N FG G    +     +         V+  + +      + +       
Sbjct: 443 KVVLSAGISQDNVFGSGTSLSVNINTAKTYRTLTVTQVDPYFTVDGIKRITDVYYRTYQP 502

Query: 510 KTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH 569
             +  D S  I      ++  +P +E  +  F       Q    +   +    Y      
Sbjct: 503 LYYSTDSSFKIVTLGGDLKFGIPFSEVDTVYFGAGFEQNQLDVDANTPQSYKDYVNEFGR 562

Query: 570 GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD 629
              ++  ++     +  D+ +VP +G    ++ +Y    G +QY++    A Y+Y  +  
Sbjct: 563 -VSNNVPLTVGWSRDARDSALVPSRGYFTQANAEYGTPIGGTQYYKADINAQYYYSFARG 621

Query: 630 SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYS 688
             +  + + GYG  + + K   +F  +       +RG+    +GPR       IGG    
Sbjct: 622 FVLGLNFQGGYGNGL-AGKPYPIFKNYFAGGIGSVRGYEPSSLGPRDAKTGDPIGGSKLL 680

Query: 689 SASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWN 748
             +  ++FP+P       LR   FVD   ++               +  R + GV + W 
Sbjct: 681 VGNIELTFPLPGTGYDRTLRVFTFVDGGNVWGTEGNSIGA------NGLRYAYGVGLAWI 734

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           SP+G + +  G PL    GD+ Q+F F+IG   
Sbjct: 735 SPIGPLKLSLGFPLTKHTGDQYQKFQFQIGTAF 767



 Score = 55.1 bits (130), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 56/169 (33%), Gaps = 18/169 (10%)

Query: 34  IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYA--- 90
           ++    ++      +  I++ G     +  +   I +  G   S   L    K I     
Sbjct: 260 MYLTVTLHEGEPYTISSIKLAGNLLDREAELKKLIKIKPGDRFSAEKLQATTKAIVDKLG 319

Query: 91  -MGY-FSNVKIKIV------DSVLIIDLIE--RKIINHLFFSGNNNLKDDQLKMIVRSRS 140
             GY F+ V  +           L + +    R  +  +   GN   +D+ ++  +R   
Sbjct: 320 EYGYAFATVNAQPQIDQQHHTVDLTLQVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLE 379

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIE 189
           ++ +D + +      I +     GY    V V    +  T   +   ++
Sbjct: 380 SSWFDSNRLALSKDRINRL----GY-FTDVDVTTVPVEGTPDQVDIDVK 423


>gi|304396652|ref|ZP_07378533.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           aB]
 gi|304356161|gb|EFM20527.1| outer membrane protein assembly complex, YaeT protein [Pantoea sp.
           aB]
          Length = 803

 Score =  402 bits (1031), Expect = e-109,   Method: Composition-based stats.
 Identities = 183/801 (22%), Positives = 325/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDVR 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + +++++A G F +V++    + LI+ + ER  I  + F+GN  +K+DQLK  +     R
Sbjct: 61  NTIRSLFATGNFEDVQVLRDGTTLIVQVKERPTIASITFTGNKAVKEDQLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G     VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYTANVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I               I +         +  L +I +G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAGHSAEIEHLTKIPAGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV T+   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVVTQPEINDADKTVKLHINVDAGNRYYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E+ K R+  TGYF  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVEQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      Y  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +              +  P+ E+ +              + 
Sbjct: 481 DGVSLGGRLFYNDFKADNADLSDYTNKSYGLDGTLGFPVNENNTLRVGLGYVHNDLSNMQ 540

Query: 555 EKEKIPSIY------TTLIEHGKF--SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +            L + G+F     + +    YNTLD    P  G   + +     
Sbjct: 541 PQVAMWRYLDSVGKPQQLNDKGEFSADDFTFNYGWTYNTLDRGFFPTSGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+ +++    +  +  ++ D   V     R GYG  +   K +  ++ F    +  +
Sbjct: 601 PGSDNSFYKATLDSQQYVPINQDRTWVLLGRGRIGYGDGLG-GKEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRVD-------------------KKYAIGGKIYSSASAAVSFPMPLVPERA 705
           RGF    IGP+                        A+GG   + AS  +  P P + E+ 
Sbjct: 660 RGFQSNTIGPKAAYFNNNSSNCRIADPNGVCKSDDAVGGNAMAIASLELITPTPFLSEKY 719

Query: 706 --GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
              +R + FVD+ T +  H    A+          + +  RVS+GV + W SPLG +   
Sbjct: 720 ANSVRTSVFVDAGTAWDTHWENTAETRAAGIPDYSDPNNIRVSSGVALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  +GDK +QF F IG
Sbjct: 780 YAQPFKKVDGDKSEQFQFNIG 800


>gi|330821652|ref|YP_004350514.1| putative outer membrane antigen [Burkholderia gladioli BSR3]
 gi|327373647|gb|AEA65002.1| putative outer membrane antigen [Burkholderia gladioli BSR3]
          Length = 771

 Score =  402 bits (1031), Expect = e-109,   Method: Composition-based stats.
 Identities = 157/779 (20%), Positives = 310/779 (39%), Gaps = 20/779 (2%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           +      S ++ ++              ++   +  I I G   +    + + +P+  G 
Sbjct: 1   MNARSLSSRRLRYLTFAGLGVTSVTACAADPFTISDIRIEGLQRIEPGSVFAYLPMKQGD 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
           + +D     A++ +YA G+F++VK+    +V+I+ + ER  I+ + FSG      D L  
Sbjct: 61  TYNDDLASEAIRKLYATGFFNDVKVATEGTVVIVQVQERPAISSIDFSGIKEFDKDNLTK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +          YD+  V+     +K+ Y + GY    V      +    ++I + + EG
Sbjct: 121 ALSSVGLARGRYYDKSLVDKAEQELKRQYLTRGYYAAEVTTNITPVDANRVSILFSVAEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKI  + F+GN  +  + L   +     + +  + K D+YSKE+++ D E +R++Y D
Sbjct: 181 PSAKIRQVNFIGNHTFKTSTLLDEMQLSTPNWFSWYTKNDLYSKEKLTGDLENVRSYYLD 240

Query: 251 RGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRS 310
           RGY      S  +        + +            +    S     ++  L  L++I++
Sbjct: 241 RGYLEFNFDSTQVSISPDKKDMYLTITVHEGQPYTISKVQLSGNLLDRQAELQKLVKIKA 300

Query: 311 GNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           G  ++  +++ +++ +          F  V  +   D     V +  ++D G  +YV+ I
Sbjct: 301 GERFSAAKLQATTKAVVDKLGEYGYAFATVNAQPEIDQVTHKVGLTLVVDPGHRVYVRHI 360

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            I GN ++ D V+RRE+   E    +   +  +K RI   GYF++V+IS +P    +D V
Sbjct: 361 NITGNSRTRDEVVRREMRQMESAWFDSGRLALSKDRINRLGYFTDVDISTVPVEGTTDQV 420

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV----- 485
            + V V +   GS+ +   Y   +G  +   +  +N FG G    +              
Sbjct: 421 DVNVKVTEKPTGSISLGVGYGSGEGPIISASVSQDNVFGSGTSLSVTVNTATTYRTLAVE 480

Query: 486 --QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKY 543
               Y                   L  +   D S  +    A+++  +P +E+ +  F  
Sbjct: 481 QVDPYFTIDGIRRITDVYYRTSEPLYYSSTTDTSFRVITYGASMKFGIPFSETDTVFFGI 540

Query: 544 DLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYD 603
            L   +    S   +    Y         +  + +     +  D+ ++P +G  + ++ +
Sbjct: 541 GLEQNRLDVDSTTPQSYIDYVNSFGRVSNNVPA-TVGWSRDNRDSTLIPSRGYFLQANAE 599

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
           Y      + Y +   +A Y+Y  +    +  + + GYG  +   K   +F  +       
Sbjct: 600 YGTPIAATTYVKSDLQAQYYYSFARGFILGLNFQGGYGKGLE-GKPYPIFKNYYAGGIGS 658

Query: 664 LRGFAYKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH 722
           +RG+    +GPR       IGG      +  ++ P+P       LR   FVD   ++ + 
Sbjct: 659 VRGYESSSLGPRDATTNDPIGGSKMVVGNIELTVPLPGTGYDRTLRVFTFVDGGNVWGSE 718

Query: 723 VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                       +  R S G  + W SP+G + +  G P+    GD+ Q+F F+IG   
Sbjct: 719 GNSIGA------NGLRYSYGAGLEWISPIGPLKIDLGFPVVKHTGDQYQKFQFQIGTSF 771


>gi|83719831|ref|YP_442559.1| OMP85 family outer membrane protein [Burkholderia thailandensis
           E264]
 gi|167619597|ref|ZP_02388228.1| outer membrane protein, OMP85 family [Burkholderia thailandensis
           Bt4]
 gi|257138768|ref|ZP_05587030.1| OMP85 family outer membrane protein [Burkholderia thailandensis
           E264]
 gi|83653656|gb|ABC37719.1| outer membrane protein, OMP85 family [Burkholderia thailandensis
           E264]
          Length = 768

 Score =  402 bits (1031), Expect = e-109,   Method: Composition-based stats.
 Identities = 156/747 (20%), Positives = 317/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    S
Sbjct: 29  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGS 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     
Sbjct: 149 TRGFYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             +   D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +
Sbjct: 329 NAQPEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            I  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 449 GISQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTN 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E+ +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++     +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  +
Sbjct: 568 PLTIGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
            + GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 FQAGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|170723235|ref|YP_001750923.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           putida W619]
 gi|169761238|gb|ACA74554.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           putida W619]
          Length = 784

 Score =  402 bits (1031), Expect = e-109,   Method: Composition-based stats.
 Identities = 166/785 (21%), Positives = 326/785 (41%), Gaps = 29/785 (3%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG    D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVE 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           + ++++  G+F ++++     VLII+++ER  ++ +   GN  +  + L   ++      
Sbjct: 61  STRSLFKTGFFQDIQLNRDGDVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +    L ++  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFDDEELAQLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNVNEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN ++ 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPQPNDEDHTVDIMFVVDPGKRAYVNRINYRGNTKTE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPPVPGTDDQVDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I   NF G G +  +           Y F   DPYF  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQTNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYFTA 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G++      +   LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRSTDYDDLDVDVASYAVDSLGAGVSLGYPISETSRLTYGLSVQQDKIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            +  +  I+  L + G  F +   S     +TL+  ++  +G   S + +    G D  +
Sbjct: 540 GRYTVDEIFDFLDQEGDNFLNFKASIGWSESTLNKGVLATRGHSQSLTLESTIPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +++  R   F  ++++  +      GYG        L  ++ +       +RGF    +G
Sbjct: 600 YKLDYRGQLFKPINNEYTLRLHTELGYGDGYGGTSGLPFYENYYAGGFNSVRGFKDSSLG 659

Query: 674 PR-----------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSA 716
           PR                        GG +       + FP+P V ++  LR + F D  
Sbjct: 660 PRSTPSTGAANRPGTELDPDQDPLPFGGNVLVQGGVELLFPLPFVKDQRSLRTSVFWDVG 719

Query: 717 TLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFR 776
            ++  +     D  +   S    S G+ + W + LG +     +P++  +    Q F F 
Sbjct: 720 NVFDTNCGSKPDCAKVGFSDMASSVGLGVTWITALGPLSFSLAMPVKKPDDADTQVFQFS 779

Query: 777 IGNRM 781
           +G   
Sbjct: 780 LGQTF 784


>gi|53723731|ref|YP_103187.1| OMP85 family outer membrane protein [Burkholderia mallei ATCC
           23344]
 gi|238562449|ref|ZP_00440471.2| outer membrane protein assembly complex, YaeT protein [Burkholderia
           mallei GB8 horse 4]
 gi|251767205|ref|ZP_04820007.1| outer membrane protein, OMP85 family [Burkholderia mallei PRL-20]
 gi|254200139|ref|ZP_04906505.1| outer membrane protein, OMP85 family [Burkholderia mallei FMH]
 gi|254206477|ref|ZP_04912829.1| outer membrane protein, OMP85 family [Burkholderia mallei JHU]
 gi|52427154|gb|AAU47747.1| outer membrane protein, OMP85 family [Burkholderia mallei ATCC
           23344]
 gi|147749735|gb|EDK56809.1| outer membrane protein, OMP85 family [Burkholderia mallei FMH]
 gi|147753920|gb|EDK60985.1| outer membrane protein, OMP85 family [Burkholderia mallei JHU]
 gi|238522663|gb|EEP86106.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           mallei GB8 horse 4]
 gi|243063489|gb|EES45675.1| outer membrane protein, OMP85 family [Burkholderia mallei PRL-20]
          Length = 769

 Score =  402 bits (1031), Expect = e-109,   Method: Composition-based stats.
 Identities = 154/747 (20%), Positives = 316/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I     
Sbjct: 30  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDGKASEAIRALYATGFFNDVRIATQGG 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     
Sbjct: 150 TRGFYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             +   D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +
Sbjct: 330 NAQPEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            I  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 450 GISQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTN 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E+ +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++     +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  +
Sbjct: 569 PLTIGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
            + GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 FQAGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   G+ + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|206578332|ref|YP_002240335.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           pneumoniae 342]
 gi|226708911|sp|B5Y1J4|YAET_KLEP3 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|206567390|gb|ACI09166.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           pneumoniae 342]
          Length = 809

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 172/807 (21%), Positives = 318/807 (39%), Gaps = 52/807 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         + +L ++  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKISGVQVTGDLAGHSAEIEALTKVEPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +    I K        + RV+++   + + + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMENDIKKLLGRYGYAYPRVQSQPEINDSDKTVKLHVNVDAGNRYYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKDRLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +            V +  P+ E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFDANDADLSDYTNKSYGTDVTLGFPVNEYNTLRAGVGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF---------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ ++            +  + +    YN LD    P +G  ++ +    
Sbjct: 541 PQVAMWRYLNSMGQYPDNTNDRNSFSANDFTFNYGWTYNKLDRGFFPTEGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + +D   V  G  RFGYG  I   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDNDHQWVVLGRTRFGYGDGIG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV---------------------------DKKYAIGGKIYSSASAAVSF 696
           +RGF    IGP+                                A+GG   + AS  +  
Sbjct: 660 VRGFQSNTIGPKAVYFPSSSRHDGDSGYTNDCKSTESAPCKSDDAVGGNAMAVASLELIT 719

Query: 697 PMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSPL 751
           P P + ++    +R + F D  T++  H      G      + S  R+S G+ + W SPL
Sbjct: 720 PTPFISDKYANSVRTSVFWDMGTVWDTHWDSNAYGGYPDYSDPSNIRMSAGIAVQWMSPL 779

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P +  +GDK +QF F IG
Sbjct: 780 GPLVFSYAQPFKKYDGDKAEQFQFNIG 806


>gi|76811099|ref|YP_333967.1| OMP85 family outer membrane protein [Burkholderia pseudomallei
           1710b]
 gi|126439453|ref|YP_001059460.1| OMP85 family outer membrane protein [Burkholderia pseudomallei 668]
 gi|254179330|ref|ZP_04885929.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           1655]
 gi|254197401|ref|ZP_04903823.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           S13]
 gi|254260159|ref|ZP_04951213.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           1710a]
 gi|254297214|ref|ZP_04964667.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           406e]
 gi|76580552|gb|ABA50027.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           1710b]
 gi|126218946|gb|ABN82452.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           668]
 gi|157807262|gb|EDO84432.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           406e]
 gi|169654142|gb|EDS86835.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           S13]
 gi|184209870|gb|EDU06913.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           1655]
 gi|254218848|gb|EET08232.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           1710a]
          Length = 769

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 155/747 (20%), Positives = 317/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    S
Sbjct: 30  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGS 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     
Sbjct: 150 TRGFYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             +   D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +
Sbjct: 330 NAQPEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            I  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 450 GISQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTN 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E+ +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++     +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  +
Sbjct: 569 PLTIGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
            + GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 FQAGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   G+ + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|288937041|ref|YP_003441100.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           variicola At-22]
 gi|290512462|ref|ZP_06551828.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           sp. 1_1_55]
 gi|288891750|gb|ADC60068.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           variicola At-22]
 gi|289774803|gb|EFD82805.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           sp. 1_1_55]
          Length = 809

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 172/807 (21%), Positives = 318/807 (39%), Gaps = 52/807 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         + +L ++  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVTGDLAGHSAEIEALTKVEPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +    I K        + RV+++   + + + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMENDIKKLLGRYGYAYPRVQSQPEINDSDKTVKLHVNVDAGNRYYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKDRLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +            V +  P+ E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFDANDADLSDYTNKSYGTDVTLGFPVNEYNTLRAGVGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF---------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ ++            +  + +    YN LD    P +G  ++ +    
Sbjct: 541 PQVAMWRYLNSMGQYPDNTNDRNSFSANDFTFNYGWTYNKLDRGFFPTEGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + +D   V  G  RFGYG  I   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDNDHQWVVLGRTRFGYGDGIG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV---------------------------DKKYAIGGKIYSSASAAVSF 696
           +RGF    IGP+                                A+GG   + AS  +  
Sbjct: 660 VRGFQSNTIGPKAVYFPSSSRHDGDSGYTNDCKSTESAPCKSDDAVGGNAMAVASLELIT 719

Query: 697 PMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSPL 751
           P P + ++    +R + F D  T++  H      G      + S  R+S G+ + W SPL
Sbjct: 720 PTPFISDKYANSVRTSVFWDMGTVWDTHWDSNAYGGYPDYSDPSNIRMSAGIAVQWMSPL 779

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P +  +GDK +QF F IG
Sbjct: 780 GPLVFSYAQPFKKYDGDKAEQFQFNIG 806


>gi|121599789|ref|YP_993363.1| OMP85 family outer membrane protein [Burkholderia mallei SAVP1]
 gi|124386536|ref|YP_001029200.1| OMP85 family outer membrane protein [Burkholderia mallei NCTC
           10229]
 gi|126448492|ref|YP_001080870.1| OMP85 family outer membrane protein [Burkholderia mallei NCTC
           10247]
 gi|254177612|ref|ZP_04884267.1| outer membrane protein, OMP85 family [Burkholderia mallei ATCC
           10399]
 gi|254358115|ref|ZP_04974388.1| outer membrane protein, OMP85 family [Burkholderia mallei
           2002721280]
 gi|121228599|gb|ABM51117.1| outer membrane protein, OMP85 family [Burkholderia mallei SAVP1]
 gi|126241362|gb|ABO04455.1| outer membrane protein, OMP85 family [Burkholderia mallei NCTC
           10247]
 gi|148027242|gb|EDK85263.1| outer membrane protein, OMP85 family [Burkholderia mallei
           2002721280]
 gi|160698651|gb|EDP88621.1| outer membrane protein, OMP85 family [Burkholderia mallei ATCC
           10399]
 gi|261826016|gb|ABN02895.2| outer membrane protein, OMP85 family [Burkholderia mallei NCTC
           10229]
          Length = 768

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 154/747 (20%), Positives = 316/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I     
Sbjct: 29  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDGKASEAIRALYATGFFNDVRIATQGG 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     
Sbjct: 149 TRGFYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             +   D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +
Sbjct: 329 NAQPEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            I  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 449 GISQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTN 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E+ +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++     +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  +
Sbjct: 568 PLTIGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
            + GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 FQAGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   G+ + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|308185748|ref|YP_003929879.1| Outer membrane protein assembly factor yaeT precursor [Pantoea
           vagans C9-1]
 gi|308056258|gb|ADO08430.1| Outer membrane protein assembly factor yaeT precursor [Pantoea
           vagans C9-1]
          Length = 803

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 183/801 (22%), Positives = 325/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVNDDDVR 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + +++++A G F +V++    + LI+ + ER  I  + F+GN  +K+DQLK  +     R
Sbjct: 61  NTIRSLFATGNFEDVQVLRDGTTLIVQVKERPTIASITFTGNKAVKEDQLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G     VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYTANVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I               I +         +  L +I +G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKIAGVIVNGSMAGHSAEIEHLTKIPAGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV T+   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVATQPEINDADKTVKLHINVDAGNRYYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E+ K R+  TGYF  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVEQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      Y  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +              +  P+ E+ +              + 
Sbjct: 481 DGVSLGGRLFYNDFKADNADLSDYTNRSYGLDGTLGFPVNENNTLRVGLGYVHNDLSNMQ 540

Query: 555 EKEKIPSIY------TTLIEHGKF--SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +            L + G+F     + +    YNTLD    P  G   + +     
Sbjct: 541 PQVAMWRYLDSVGKPQQLNDKGEFSADDFTFNYGWTYNTLDRGFFPTSGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+ +++       +  ++ D   V     R GYG  +   K +  ++ F    +  +
Sbjct: 601 PGSDNSFYKATLDTQQYVPINQDRTWVLLGRGRVGYGDGLG-GKEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRVD-------------------KKYAIGGKIYSSASAAVSFPMPLVPERA 705
           RGF    IGP+                        A+GG   + AS  +  P P + E+ 
Sbjct: 660 RGFQSNTIGPKAAYYNNNSSNCRIADPNGVCKSDDAVGGNAMAIASLELITPTPFLSEKY 719

Query: 706 --GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
              +R + FVD+ T +  H    A+          + +  RVS+GV + W SPLG +   
Sbjct: 720 ANSVRTSVFVDTGTAWDTHWENTAETRAAGIPDYSDPNNIRVSSGVALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P++  +GDK +QF F IG
Sbjct: 780 YAQPIKKVDGDKSEQFQFNIG 800


>gi|161524438|ref|YP_001579450.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           multivorans ATCC 17616]
 gi|189350807|ref|YP_001946435.1| outer membrane protein [Burkholderia multivorans ATCC 17616]
 gi|160341867|gb|ABX14953.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           multivorans ATCC 17616]
 gi|189334829|dbj|BAG43899.1| outer membrane protein [Burkholderia multivorans ATCC 17616]
          Length = 769

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 159/747 (21%), Positives = 321/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 30  PFVVQDIKIEGLQRVEPGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S + L   +     
Sbjct: 150 TRGFYAAEVKTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSGIKLSGNLLDREAELNKLIKIKPGDRFSAEKLQQTTKAIVDKLGEYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 330 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 450 GVSQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTN 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDIDSNTPQSYQDYVEKFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 569 PLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQAQYYYSFSRGFILGLN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDSKTNDPIGGSKMVVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   G+ + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|238893173|ref|YP_002917907.1| outer membrane protein assembly factor YaeT [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262044752|ref|ZP_06017799.1| protective surface antigen D15 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330001656|ref|ZP_08304082.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           sp. MS 92-3]
 gi|238545489|dbj|BAH61840.1| putative outer membrane antigen [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259037902|gb|EEW39126.1| protective surface antigen D15 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537598|gb|EGF63818.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           sp. MS 92-3]
          Length = 809

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 170/807 (21%), Positives = 317/807 (39%), Gaps = 52/807 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         + +L ++  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKFSGVQVTGNLAGHSAEIEALTKVEPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +    I K        + RV+++   + + + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMENDIKKLLGRYGYAYPRVQSQPEINDSDKTVKLHVNVDAGNRYYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKDRLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +            + +  P+ E  +              + 
Sbjct: 481 DGVSLGGRVFYNDFDANDADLSDYTNKSYGTDITLGFPVNEYNTLRAGVGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF---------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ ++            +  + +    YN LD    P +G  ++ +    
Sbjct: 541 PQVAMWRYLNSMGQYPDNTNDRNSFSANDFTFNYGWTYNKLDRGFFPTEGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + +D   V  G  RFGYG  I   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDNDHQWVVLGRTRFGYGDGIG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV---------------------------DKKYAIGGKIYSSASAAVSF 696
           +RGF    IGP+                                A+GG   + AS  +  
Sbjct: 660 VRGFQSNTIGPKAVYFPASSRHDDDDSYDNECKSTESAPCKSDDAVGGNAMAVASLELIT 719

Query: 697 PMPLVPERA--GLRGAFFVDSATLYANHVALG---ADKLEGNDSFWRVSTGVEIMWNSPL 751
           P P + ++    +R + F D  T++  H             + S  R+S G+ + W SPL
Sbjct: 720 PTPFISDKYANSVRTSVFWDMGTVWDTHWDSSAYAGYPDYSDPSNIRMSAGIAVQWMSPL 779

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P +  +GDK +QF F IG
Sbjct: 780 GPLVFSYAQPFKKYDGDKAEQFQFNIG 806


>gi|254189284|ref|ZP_04895795.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           Pasteur 52237]
 gi|157936963|gb|EDO92633.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           Pasteur 52237]
          Length = 768

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 155/747 (20%), Positives = 317/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    S
Sbjct: 29  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGS 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     
Sbjct: 149 TRGFYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             +   D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +
Sbjct: 329 NAQPEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            I  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 449 GISQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTN 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E+ +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++     +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  +
Sbjct: 568 PLTIGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
            + GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 FQAGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   G+ + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|152968771|ref|YP_001333880.1| outer membrane protein assembly factor YaeT [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|166227559|sp|A6T4X9|YAET_KLEP7 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|150953620|gb|ABR75650.1| putative outer membrane antigen [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 809

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 170/807 (21%), Positives = 316/807 (39%), Gaps = 52/807 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         + +L ++  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKFSGVQVTGNLAGHSAEIEALTKVEPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +      I K        + RV+++   + + + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTRMENDIKKLLGRYGYAYPRVQSQPEINDSDKTVKLHVNVDAGNRYYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKDRLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +            + +  P+ E  +              + 
Sbjct: 481 DGVSLGGRVFYNDFDANDADLSDYTNKSYGTDITLGFPVNEYNTLRAGVGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF---------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ ++            +  + +    YN LD    P +G  ++ +    
Sbjct: 541 PQVAMWRYLNSMGQYPDNTNDRNSFSANDFTFNYGWTYNKLDRGFFPTEGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + +D   V  G  RFGYG  I   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDNDHQWVVLGRTRFGYGDGIG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV---------------------------DKKYAIGGKIYSSASAAVSF 696
           +RGF    IGP+                                A+GG   + AS  +  
Sbjct: 660 VRGFQSNTIGPKAVYFPASSRHDDDDSYDNECKSTESAPCKSDDAVGGNAMAVASLELIT 719

Query: 697 PMPLVPERA--GLRGAFFVDSATLYANHVALG---ADKLEGNDSFWRVSTGVEIMWNSPL 751
           P P + ++    +R + F D  T++  H             + S  R+S G+ + W SPL
Sbjct: 720 PTPFISDKYANSVRTSVFWDMGTVWDTHWDSSAYAGYPDYSDPSNIRMSAGIAVQWMSPL 779

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P +  +GDK +QF F IG
Sbjct: 780 GPLVFSYAQPFKKYDGDKAEQFQFNIG 806


>gi|170733367|ref|YP_001765314.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           cenocepacia MC0-3]
 gi|254247891|ref|ZP_04941212.1| surface antigen (D15):Surface antigen variable number [Burkholderia
           cenocepacia PC184]
 gi|124872667|gb|EAY64383.1| surface antigen (D15):Surface antigen variable number [Burkholderia
           cenocepacia PC184]
 gi|169816609|gb|ACA91192.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           cenocepacia MC0-3]
          Length = 769

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 160/747 (21%), Positives = 320/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 30  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S + L   +     
Sbjct: 150 TRGFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSGIKLSGNLLDREAELNKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 330 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 450 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTS 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 569 PLTVAWSRDARDSALIPSRGYFTQANMEYGVPVGKIQYYKADLQAQYYYSFSRGFILGLN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|107028809|ref|YP_625904.1| surface antigen (D15) [Burkholderia cenocepacia AU 1054]
 gi|116690032|ref|YP_835655.1| surface antigen (D15) [Burkholderia cenocepacia HI2424]
 gi|105897973|gb|ABF80931.1| surface antigen (D15) [Burkholderia cenocepacia AU 1054]
 gi|116648121|gb|ABK08762.1| surface antigen (D15) [Burkholderia cenocepacia HI2424]
          Length = 769

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 159/747 (21%), Positives = 320/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V++    +
Sbjct: 30  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRVATQGN 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S + L   +     
Sbjct: 150 TRGFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSGIKLSGNLLDREAELNKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 330 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 450 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTS 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNQFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 569 PLTVAWSRDARDSALIPSRGYFTQANMEYGVPVGKIQYYKADLQAQYYYSFSRGFILGLN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|322831596|ref|YP_004211623.1| outer membrane protein assembly complex, YaeT protein [Rahnella sp.
           Y9602]
 gi|321166797|gb|ADW72496.1| outer membrane protein assembly complex, YaeT protein [Rahnella sp.
           Y9602]
          Length = 806

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 192/805 (23%), Positives = 328/805 (40%), Gaps = 51/805 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAIKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVTDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNSLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+ +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTIGSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHAFTTDDLISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K G  +   I EGE Y +  + +  ++       + SL +I  G LYN  
Sbjct: 241 DSTQVSLTPDKKGIYITLNITEGEQYKLSGVEVTGSMAG-HSAEVQSLTKIDKGELYNGA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +    I +        + RV T+   + A + V +   +D G+  YV+ I  EGND 
Sbjct: 300 KVTKMENDIKQMLGRYGYAYPRVTTQPEINDADKTVKLHINVDAGNRFYVRHIRFEGNDT 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S DSV+RRE+   EG  +   ++++ K R+   GYF  V++         D V +   VK
Sbjct: 360 SKDSVLRREMRQMEGAWLGNDLVDKGKERLNRLGYFETVDVDTQRVPGSPDQVDVVYKVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVE 493
           + + GS      Y  + G+  +  +  +N+ G G    ++     +              
Sbjct: 420 ERNTGSFNFGVGYGTESGVSFQVGVQQDNWLGTGNSVGISGTKNDYQTYAEFTITDPYFT 479

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        D +    +  S           +  PI E+ S     D        +
Sbjct: 480 VDGVSLGGRIFYNDFKADDADLSSYTNRSYGIGGNLGFPINENNSLRLGLDYVHNDLSNM 539

Query: 554 SEKEKIPSI------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
             +  +                         +    +    YN LD    P  G   S +
Sbjct: 540 EPQIAMFRYLNSVGLKPPVTTSDNADADFSANDFFANLGWGYNNLDRGYFPTSGTKASLN 599

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLS--DDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
                 G D++Y++I   ++ +  L+   D  ++G  R GY   +   K +  +D F   
Sbjct: 600 GKVTVPGSDNEYYKITFDSTSYMPLNQDRDWVLMGRARAGYADGLG-GKEVPFYDNFYAG 658

Query: 660 SNYYLRGFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLV 701
            +  +RGF    IGP+                   +   A+GG   +  SA +  P P V
Sbjct: 659 GSSSVRGFQSNTIGPKAAYYKCTTANTSYSGCPIDNSNDAVGGNAMAVLSAELIVPTPFV 718

Query: 702 PERA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGM 753
            E+    LR + FVDS T++          +             RVS+G+ + W SPLG 
Sbjct: 719 SEKYANSLRTSLFVDSGTVWDTGWENTPQTIAAGVPDYSKPGNIRVSSGLALQWMSPLGP 778

Query: 754 MGVYYGIPLRHREGDKIQQFGFRIG 778
           +   Y  P++  EGDK +QF F IG
Sbjct: 779 LVFSYAQPVKKYEGDKAEQFQFNIG 803


>gi|227357242|ref|ZP_03841599.1| outer membrane protein assembly factor [Proteus mirabilis ATCC
           29906]
 gi|227162505|gb|EEI47494.1| outer membrane protein assembly factor [Proteus mirabilis ATCC
           29906]
          Length = 821

 Score =  401 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 189/800 (23%), Positives = 319/800 (39%), Gaps = 44/800 (5%)

Query: 22  SFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
           +  M  +++   + G +  YGS+  +V+ I+  G   V     L  +PV VG S+SD D+
Sbjct: 20  TMAMKKLLIASLLLGSATAYGSDGFVVQDIQFEGLQRVAVGAALLNMPVRVGDSVSDDDI 79

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RS 138
              +++++A G F +V++    +VLI+ + ER  I  + FSGN  +K+D LK  +     
Sbjct: 80  SRTIRSLFATGNFDDVRVLRDGNVLIVQVKERPTIASITFSGNKAIKEDMLKQNLDASNI 139

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R     D   +      ++  Y S+G  N  VKV    +    +++  V  EGV A I  
Sbjct: 140 RIGETLDRTMLANIEKGLEDFYYSVGKYNATVKVVVTPLPRNRVDLKLVFAEGVSATIQQ 199

Query: 199 IRFVGNKNYSHARLERVISIRTSGYFSFGKTD-VYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  VGNK +S A L     +R    +     D  Y K++++ D E +R+FY DRGYA   
Sbjct: 200 INIVGNKAFSTAELVNRFQLRDDVPWWNLAADEKYQKQKLAGDLETLRSFYLDRGYARFD 259

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           + S  +        + I    +         +  +       K +  LI+I  G+LYN  
Sbjct: 260 IESTNVSLTPDKKGIYITINLKEGDKYTVESTEINGNTAGYTKEIEDLIQIAPGSLYNGA 319

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ ++  +I          + RV T    +   + V +   +D G+  YV++I   GND 
Sbjct: 320 QVTKTENEIKNLLGRYGYAYPRVMTNPEINDENKTVKLHVNVDAGNRFYVRQIRFAGNDI 379

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + DSV+RRE+   EG  +   ++E+ K R+   GYF  V           D V +   VK
Sbjct: 380 TKDSVLRREMRQMEGAWLGSDLVEQGKERLNRLGYFETVETETQRIPGSPDQVDIVYRVK 439

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVE 493
           + + GS+     +  + G+  +  +  +N+ G G    + A    ++             
Sbjct: 440 ERNTGSLNFGVGFGTESGVSFQVGVTQDNWLGTGNAVAINASKNDYSTYAELSVTDPYFT 499

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG-- 551
                        D +    +              +  PI E  S               
Sbjct: 500 VNGVSLGGRIFYNDFRANDADLSGYTNKSYGLDGTLGFPINEYNSARLGLGYTHNGLSRM 559

Query: 552 ------AISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
                     +    +      E      +++S    +N L+    P  G   + S    
Sbjct: 560 EPQVAMWRYLESMGENPGFDKRESFNADDYTVSMGWTFNNLNRGFFPTSGARSNLSGRIT 619

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++      +Y L +    V     R GYG  +   K L  ++ F    +  
Sbjct: 620 IPGSDNKYYKVTWDGMAYYPLDEKESWVTLFKGRLGYGDGLG-GKELPFYENFYAGGSGT 678

Query: 664 LRGFAYKGIGPRVD-----------------KKYAIGGKIYSSASAAVSFPMPLVPERA- 705
           +RGF    IGP+                      A+GG   + AS  +  P P + ++  
Sbjct: 679 VRGFRSNNIGPKAIYLKKIAKDGSTIIDPSLSSDAVGGNAMAVASFELITPTPFIDDKYS 738

Query: 706 -GLRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEIMWNSPLGMMGVYY 758
             +R + FVD+ T++  +               G  S  RVSTGV + W SPLG +   Y
Sbjct: 739 SSVRTSMFVDAGTVWDTNWNSTNSNWTAGMPDFGKASNIRVSTGVALQWLSPLGPLVFSY 798

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             P++  EGDK +QF F IG
Sbjct: 799 AKPIKDYEGDKSEQFQFNIG 818


>gi|134296020|ref|YP_001119755.1| surface antigen (D15) [Burkholderia vietnamiensis G4]
 gi|134139177|gb|ABO54920.1| surface antigen (D15) [Burkholderia vietnamiensis G4]
          Length = 768

 Score =  401 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 159/747 (21%), Positives = 320/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V++    +
Sbjct: 29  PFVVQDIKIEGLQRVEPGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRVATQGN 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S + L   +     
Sbjct: 149 TRGFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSTLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GQPYTVSGIKLSGNLLDREAELTKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 329 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 449 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTS 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 568 PLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQAQYYYSFSRGFILGLN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFIDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|320014186|gb|ADV97757.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 795

 Score =  401 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 190/793 (23%), Positives = 328/793 (41%), Gaps = 38/793 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V  I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVNDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++    + LI+ + ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  KTIRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            N  I S      +     L +I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYVTINITEGPQFKLNSVIVSGNLAGHQSEAEKLTKIEPGELFNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + I K        + RV T+   +   + V +   +D G+  YV+ I  EGND S
Sbjct: 301 VTRMEDDIKKMLGRYGYAYPRVVTQPEINDDDKTVKLHINVDAGNRFYVRHIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGAADLVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
            + GS+     Y  + G+  +  +  +N+ G G    +      +        ++  + +
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLMDPYFTV 480

Query: 499 G----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +   A   +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGADGTLGFPINENNSLRVGVGYVHNDLSDML 540

Query: 555 EKEKIPSIY--------TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +                E       +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLESVGERPGYDGREGFTTDDFTLNLGWTYNNLDRGFFPTSGVKSSVNTKITV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDD--SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++++++    S +  L++D    ++G  R GYG  I S K +  ++ F    +  +
Sbjct: 601 PGSDNEFYKVTFDTSAYQPLNEDRSWVLLGRGRLGYGDGIGS-KEMPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPR-----------VDKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAF 711
           RGF    IGP+            +   A+GG   + AS  +  P P + E+    +R + 
Sbjct: 660 RGFWSNNIGPKAAYYANGGATVTNSTDAVGGNAMAVASIELITPTPFISEKYSNSVRTSI 719

Query: 712 FVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHR 765
           F+DS T++  +    A          G  S  RVS GV + W SPLG +   Y  P++  
Sbjct: 720 FIDSGTVWDTNWENTAKTRAAGIPDYGKASNIRVSAGVALQWMSPLGPLVFSYAKPVKDY 779

Query: 766 EGDKIQQFGFRIG 778
           EGDK +QF F IG
Sbjct: 780 EGDKSEQFQFNIG 792


>gi|221198314|ref|ZP_03571360.1| outer membrane protein, OMP85 family [Burkholderia multivorans
           CGD2M]
 gi|221208253|ref|ZP_03581257.1| outer membrane protein, OMP85 family [Burkholderia multivorans
           CGD2]
 gi|221215465|ref|ZP_03588429.1| outer membrane protein, OMP85 family [Burkholderia multivorans
           CGD1]
 gi|221164649|gb|EED97131.1| outer membrane protein, OMP85 family [Burkholderia multivorans
           CGD1]
 gi|221171901|gb|EEE04344.1| outer membrane protein, OMP85 family [Burkholderia multivorans
           CGD2]
 gi|221182246|gb|EEE14647.1| outer membrane protein, OMP85 family [Burkholderia multivorans
           CGD2M]
          Length = 769

 Score =  401 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 159/747 (21%), Positives = 321/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 30  PFVVQDIKIEGLQRVEPGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S + L   +     
Sbjct: 150 TRGFYAAEVKTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSGIKLSGNLLDREAELNKLIKIKPGDRFSAEKLQQTTKAIVDKLGEYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 330 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 450 GVSQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTN 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDIDSNTPQSYQDYVNQFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 569 PLTVAWSRDARDSALIPSRGYFTQANIEYGVPVGKIQYYKADLQAQYYYSFSRGFILGLN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDSKTNDPIGGSKMVVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   G+ + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|197286123|ref|YP_002151995.1| outer membrane protein assembly factor YaeT [Proteus mirabilis
           HI4320]
 gi|194683610|emb|CAR44503.1| outer membrane protein assembly factor [Proteus mirabilis HI4320]
          Length = 802

 Score =  401 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 189/800 (23%), Positives = 318/800 (39%), Gaps = 45/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   + G +  YGS+  +V+ I+  G   V     L  +PV VG S+SD D+ 
Sbjct: 1   MAMKKLLIASLLLGSATAYGSDGFVVQDIQFEGLQRVAVGAALLNMPVRVGDSVSDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +++++A G F +V++    +VLI+ + ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  RTIRSLFATGNFDDVRVLRDGNVLIVQVKERPTIASITFSGNKAIKEDMLKQNLDASNIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
                D   +      ++  Y S+G  N  VKV    +    +++  V  EGV A I  I
Sbjct: 121 IGETLDRTMLANIEKGLEDFYYSVGKYNATVKVVVTPLPRNRVDLKLVFAEGVSATIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTD-VYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S A L     +R    +     D  Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSTAELVNRFQLRDDVPWWNLAADEKYQKQKLAGDLETLRSFYLDRGYARFDI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I    +         +  +       K +  LI+I  G+LYN  +
Sbjct: 241 ESTNVSLTPDKKGIYITINLKEGDKYTVESTEINGNTAGYTKEIEDLIQIAPGSLYNGAQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + ++  +I          + RV T    +   + V +   +D G+  YV++I   GND +
Sbjct: 301 VTKTENEIKNLLGRYGYAYPRVMTNPEINDENKTVKLHVNVDAGNRFYVRQIRFAGNDIT 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E+ K R+   GYF  V           D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVEQGKERLNRLGYFETVETETQRIPGSPDQVDIVYRVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +  +  +N+ G G    + A    ++              
Sbjct: 421 RNTGSLNFGVGFGTESGVSFQVGVTQDNWLGTGNAVAINASKNDYSTYAELSVTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG--- 551
                       D +    +              +  PI E  S                
Sbjct: 481 NGVSLGGRIFYNDFRANDADLSGYTNKSYGLDGTLGFPINEYNSARLGLGYTHNGLSRME 540

Query: 552 -----AISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                    +    +      E      +++S    +N L+    P  G   + S     
Sbjct: 541 PQVAMWRYLESMGENPGFDKRESFNADDYTVSLGWTFNNLNRGFFPTSGARSNLSGRITI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++Y+++      +Y L +    V     R GYG  +   K L  ++ F    +  +
Sbjct: 601 PGSDNKYYKVTWDGMAYYPLDEKESWVTLFKGRLGYGDGLG-GKELPFYENFYAGGSGTV 659

Query: 665 RGFAYKGIGPRVD------------------KKYAIGGKIYSSASAAVSFPMPLVPERA- 705
           RGF    IGP+                       A+GG   + AS  +  P P + ++  
Sbjct: 660 RGFRSNNIGPKAIYLKKITKDDGSTIIDPSLSSDAVGGNAMAVASFELITPTPFIDDKYS 719

Query: 706 -GLRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEIMWNSPLGMMGVYY 758
             +R + FVD+ T++  +               G  S  RVSTGV + W SPLG +   Y
Sbjct: 720 SSVRTSMFVDAGTVWDTNWNSTNSNWTAGMPDFGKASNIRVSTGVALQWLSPLGPLVFSY 779

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             P++  EGDK +QF F IG
Sbjct: 780 AKPIKDYEGDKSEQFQFNIG 799


>gi|329296129|ref|ZP_08253465.1| outer membrane protein assembly factor YaeT [Plautia stali
           symbiont]
          Length = 803

 Score =  401 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 179/801 (22%), Positives = 321/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  IPV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADDFVVKDIHFEGLQRVAVGAALLSIPVRVGDTVNDDDIR 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + +++++A G F +V++    + LI+ + E   I  + FSGN  +K+DQLK  +     R
Sbjct: 61  NTIRSLFATGNFEDVQVLRDGTTLIVQVKESPTIASITFSGNKAVKEDQLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G     VK     +    +++ +V +EGV AKI  I
Sbjct: 121 VGEALDRTTLSSIEKGLEDFYYSVGKYTASVKAIATPLPRNRVDLKFVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           ++       Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWYVVGDRKYQKQKLAGDFETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I               I +         +  L +I +  LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVKITEGDQYKIAGVIVNGSMASHSAEIEHLTQIPNSELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV  +   + A + V +   +D G+  YV+++  E ND S
Sbjct: 301 VTQMEDDIKKLLGRYGYAYPRVVMQPEINDADKTVKLHINVDAGNRYYVRKVRFEVNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+  TGYF  V++         D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRTGYFETVDVDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      Y  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGYGTESGVSFQVGVTQDNWLGTGNTVGISGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +              +  P+ E+ +              + 
Sbjct: 481 DGVSLGGRLFYNDFKADDADLSDYTNKSYGVDGTLGFPVNENNTLRVGLGYVHNDLSNMR 540

Query: 555 EKEKIPSIY------TTLIEHGKF--SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +            L + G F     + +    YNTLD    P +G   + +     
Sbjct: 541 PQVAMWRYLDSVGRHQELNDDGDFSADDFTFNYGWTYNTLDRGFFPTRGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+ +++       +  L+ D   V  G  R GYG  +   K +  ++ F       +
Sbjct: 601 PGSDNSFYKATLDTQQYVPLNRDGTWVVLGRGRVGYGDGLG-GKEMPFYENFYAGGYSTV 659

Query: 665 RGFAYKGIGPRVD-------------------KKYAIGGKIYSSASAAVSFPMPLVPERA 705
           RGF    IGP+                        A+GG   + AS  +  P P + E+ 
Sbjct: 660 RGFKSNTIGPKAAYLNDRSSSCNLTDPDGICKSDDAVGGNAMAIASLELITPTPFLSEKY 719

Query: 706 --GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
              +R + F+D+ T++       A+          + +  RVS G+ + W SPLG +   
Sbjct: 720 ANSVRTSVFMDAGTVWDTKWQNTAETRAAGIPDYSDPNNIRVSAGLALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P++  EGDK +QF F IG
Sbjct: 780 YAQPVKKVEGDKAEQFQFNIG 800


>gi|206560445|ref|YP_002231209.1| outer membrane protein assembly factor YaeT [Burkholderia
           cenocepacia J2315]
 gi|198036486|emb|CAR52383.1| Outer membrane protein assembly factor YaeT [Burkholderia
           cenocepacia J2315]
          Length = 769

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 160/747 (21%), Positives = 321/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 30  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S + L   +     
Sbjct: 150 TRGFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSGIKLSGNLLDREAELNKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 330 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P +  +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTNVDVTTVPVDGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 450 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTS 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 569 PLTVAWSRDARDSALIPSRGYFTQANIEYGVPVGKIQYYKADLQAQYYYSFSRGFILGLN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|251790737|ref|YP_003005458.1| outer membrane protein assembly factor YaeT [Dickeya zeae Ech1591]
 gi|247539358|gb|ACT07979.1| outer membrane protein assembly complex, YaeT protein [Dickeya zeae
           Ech1591]
          Length = 805

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 186/803 (23%), Positives = 328/803 (40%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFLVKDIHFEGLQRVAVGAALLSMPVRVGDTVTDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L+I + ER  I  L FSGN  +K++ LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDSLLIQVKERPTIASLTFSGNKAVKEEMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYSATVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK++S   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKSFSSDELISRFQLRDEVPWWNVVGDRKYEKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  +           +  L RI+ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINISEGNQYKLSGVMVRGNLVGHATEIEDLTRIQPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+   + A + V +   +D G+   V+R+  EGND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPEINDADKTVRLNINVDAGNRFTVRRVRFEGNDVS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGGWLGNDLVQQGKERLNRLGYFESVDTETQRVPGTPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGSLNFGVGFGTESGISFQAGVQQDNWLGTGNSVGISGTRNDYQTYIELSMTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA-- 552
                       + +    +          A   +  PI E+ S     D          
Sbjct: 481 DGVSLGGRIFYNNFKALDADLSDYTNQSYGAGTTLGFPINENNSLRVGLDYVHNSLSDMK 540

Query: 553 --------ISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
                   +++    P   TT       +   ++    YN LD    P  G   + +   
Sbjct: 541 PQVAMWRYLNKAGVDPDPSTTSSASFDANDFFLTSGWTYNNLDRGYFPTAGNRANLNSKV 600

Query: 605 AGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNY 662
              G D++Y+++   ++ ++ LS+  +  ++   + GY   + S K +  +D F    + 
Sbjct: 601 TVPGSDNEYYKLTFDSASYFPLSESHNWVLMARTKAGYADGL-SGKEVPFYDNFFGGGSS 659

Query: 663 YLRGFAYKGIGPRVDK-------------------KYAIGGKIYSSASAAVSFPMPLVPE 703
            +RGF    IGP+                        A+GG   ++ASA +  P P + +
Sbjct: 660 SVRGFRSNTIGPKAAYYTNCANQSVSSCSIDGSKMSDAVGGNAMATASAELIVPTPFISD 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R +FFVD+ T++  H    A  L             R+S+G+ + W SPLG + 
Sbjct: 720 KYSSSVRTSFFVDAGTVWDTHWENTAQTLAAGVPDYSTPGNIRMSSGLAVQWMSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  EGD+ +QF F IG
Sbjct: 780 FSYAQPFKKYEGDRSEQFQFNIG 802


>gi|168244991|ref|ZP_02669923.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|194447664|ref|YP_002044214.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|226708916|sp|B4TK52|YAET_SALHS RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|194405968|gb|ACF66187.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|205336215|gb|EDZ22979.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
          Length = 803

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 174/801 (21%), Positives = 322/801 (40%), Gaps = 46/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + +L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIENLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSLDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNKLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
            +  +     ++ +           + +    YN LD    P  G  ++ +      G D
Sbjct: 541 PQIAMDRYLESMGDPDASDFAADDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           ++Y+++    + +  + +D   V  G  R+GYG  +   K +  ++ F    +  +RGF 
Sbjct: 601 NEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVRGFQ 659

Query: 669 YKGIGPRV-------------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
              IGP+                              A+GG   + AS     P P + E
Sbjct: 660 SNTIGPKAVYKNGAHTSWDDNDDYEDCTQESGCKSDDAVGGNAMAVASLEFITPTPFISE 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGADKLE----GNDSFWRVSTGVEIMWNSPLGMMGVY 757
           +    +R +FF D  T++  +    +   +     +    R+S G+ + W SPLG +   
Sbjct: 720 KYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDYSDPGNIRMSAGIALQWMSPLGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P +  +GDK +QF F IG
Sbjct: 780 YAQPFKKYDGDKAEQFQFNIG 800


>gi|268590524|ref|ZP_06124745.1| outer membrane protein assembly complex, YaeT protein [Providencia
           rettgeri DSM 1131]
 gi|291314110|gb|EFE54563.1| outer membrane protein assembly complex, YaeT protein [Providencia
           rettgeri DSM 1131]
          Length = 804

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 192/802 (23%), Positives = 328/802 (40%), Gaps = 47/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG +  YGS+  +V+ I   G   V     L  +PV VG S+ + D+ 
Sbjct: 1   MAMKKLLIASLLFGSATAYGSDGFVVKDIRFEGLQRVAVGAALLNMPVRVGDSVDNDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++++++ G F +V++    + LI+ + ER  I  + F+GN ++KDD LK  +     R
Sbjct: 61  RSIRSLFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFTGNKSVKDDMLKQNLEASNIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+      ++  Y S+G  N  VK     +    +++ +V  EGV A+I  I
Sbjct: 121 VGEALDRTTIANIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKFVFSEGVSAQIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNKNY+ A L   + +R    +     D  Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKNYTTAELVNKLQLRDDVPWWNLAADQKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         +  LI I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKISGVEVNGNTADHLTEIQELITITPGELYNGAQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +     KI   F      + RV T+   + A + V +   ID G+  YV+ I  +GND S
Sbjct: 301 VTSMENKIKDMFGRYGYAYPRVMTQPEINDADKTVKLHLNIDAGNRFYVREIRFQGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E  K R+  TGYF  V++         D V +   VK+
Sbjct: 361 KDTVLRREMRQMEGAWLGNDLVELGKERLNRTGYFETVDVETQRVPGSPDQVDVIYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +  +  +N+ G G    + A    ++              
Sbjct: 421 RNTGSMNFGIGFGTESGVSFQVGVTQDNWLGTGNAVGINASKNDYSTNVEFSFTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +    +         +  P  E+ S          +   + 
Sbjct: 481 NGVSLGGRIFYNDFSAKDADLSGYNNKTYGLDSFLSFPFNENNSFRVGAGYVHNRLSDMR 540

Query: 555 EKEKIPSIYTTL------------IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
            +  +     ++             E       +++    YN+L+    P  G   + S 
Sbjct: 541 AQAAMWDYLDSMGKNPPVTENGRNKESFDADDFTLNLGWTYNSLNRGFFPTSGNKTNVSG 600

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y+++    + +Y L +D   V  G  + GYG  I S K +  ++ F    
Sbjct: 601 KVTIPGSDNEYYKLRFDTAQYYPLDEDETWVVLGRAQAGYGDGIGS-KQMPFYENFYAGG 659

Query: 661 NYYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLVPER 704
           +  +RGF    IGP+                     A+GG    +AS  +  P P + E+
Sbjct: 660 SSTIRGFRSNNIGPKAVYLKKINGKDGPEPGSPSSDAVGGNAMYAASFELITPTPFIDEK 719

Query: 705 A--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGV 756
               +R + FVD+ T++  +               G  S  R S GV + W SPLG +  
Sbjct: 720 YSNSVRTSLFVDAGTVWDTNWNSIPAAWREGMPDYGKASNIRASAGVALQWMSPLGPLVF 779

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P++  EGDK +QF F IG
Sbjct: 780 SYAQPIKDYEGDKSEQFQFNIG 801


>gi|296101346|ref|YP_003611492.1| outer membrane protein assembly factor yaeT [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295055805|gb|ADF60543.1| outer membrane protein assembly factor yaeT [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 805

 Score =  400 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 174/803 (21%), Positives = 325/803 (40%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRPGDTVNDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISTFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + SL +I+ G+LY+  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLSGVEVSGNLAGHSAEIESLTKIQPGDLYSGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+T+   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDGIKKLLGRYGYAYPRVQTQPEINDADKTVKLHVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGINGTKNDYQTYSEFSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +  S           +  P+ E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSSYTNKSYGVDGTLGFPVNEYNTLRAGLGYVHNDLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKF---------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ +                + +    YN LD    P +G  ++ +    
Sbjct: 541 PQVAMWRYLDSIGQSASTSSDNNGFAADDFTFNYGWTYNRLDRGYFPTEGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++++++    + ++ + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEFYKLTLDTASYFPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV--------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
           +RGF    IGP+                         A+GG   + AS     P P + +
Sbjct: 660 VRGFQSNNIGPKAVYYGGNDEDNCASRDPKQVCSSDDAVGGNAMAVASLEFITPTPFISD 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R +FF D+ T++  +    A           +    R+S G+ + W SPLG + 
Sbjct: 720 KYANSVRTSFFWDAGTVWDTNWENTAQMRAAGVPDYSDPGNIRMSAGIALQWMSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GDK +QF F IG
Sbjct: 780 FSYAQPFKKYDGDKSEQFQFNIG 802


>gi|183597588|ref|ZP_02959081.1| hypothetical protein PROSTU_00871 [Providencia stuartii ATCC 25827]
 gi|188023085|gb|EDU61125.1| hypothetical protein PROSTU_00871 [Providencia stuartii ATCC 25827]
          Length = 804

 Score =  400 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 189/801 (23%), Positives = 323/801 (40%), Gaps = 45/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG +  YGS+  +V+ I   G   V     L  +PV VG SI + D+ 
Sbjct: 1   MAMKKLLIASLLFGSATAYGSDGFVVKDIRFEGLQRVAVGAALLNMPVRVGDSIDNEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++++++ G F +V++    + LI+ + ER  I  + F+GN ++KDD LK  +     R
Sbjct: 61  RSIRSLFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFTGNKSVKDDMLKQNLEASNIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   +      ++  Y S+G  N  VK     +    +++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTKIANIEKGLEDFYYSVGKYNATVKAVATPLPRNRVDLKFVFSEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNKNY+ A L     +R    +     D  Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NVVGNKNYTTAELVNKFQLRDDVPWWNLAADQKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         +  LI I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKDIYITINVTEGDQYKISGVEINGNTADHLTEIQELITITPGELYNGTQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +     KI          + RV T+   +   + V +   ID G+  YV++I  +GND S
Sbjct: 301 VTSMENKIKDLLGRYGYAYPRVMTQPEINDEDKTVKLHVNIDAGNRFYVRQIRFQGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E  K R+  TG+F  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDLVELGKERLNRTGFFETVDVETQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +  +  +N+ G G    + A    ++              
Sbjct: 421 RNTGSMNFGVGFGTESGVSFQVGVSQDNWLGTGNAVGINASKNDYSTNVEMSFTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +              +  P  E+ S              + 
Sbjct: 481 NGVSLGGRVFYNDFRAKDADLSGYTNKTYGLDTFLSFPFNENNSFRVGAGYVHNSLSDMR 540

Query: 555 EKEKIPSIYTTL------------IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
            +  +     ++             E       +++    YN+L+    P  G   S S 
Sbjct: 541 PQAAMWDYLYSMGDKPPINDDGRNKEKFNADDFTVNLGWTYNSLNRGFFPTSGNKTSVSG 600

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSN 661
                G D++Y+++    + +Y +++D   V   R   G      +K +  ++ F    +
Sbjct: 601 KITVPGSDNEYYKLRFDTAQYYPINEDETWVILGRAQAGYGDGLGSKQMPFYENFYAGGS 660

Query: 662 YYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLVPERA 705
             LRGF    IGP+                     A+GG    +AS  +  P P + E+ 
Sbjct: 661 STLRGFRSNNIGPKAVYLKNVNGKGEPEPGSPSSDAVGGNAMYAASFELITPTPFIDEKY 720

Query: 706 G--LRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVY 757
              +R + FVD+ T++  +               G  +  RVSTGV + W SPLG +   
Sbjct: 721 SNTVRTSLFVDAGTVWDTNWNSINADWRKGMPDYGKATNVRVSTGVALQWMSPLGPLVFS 780

Query: 758 YGIPLRHREGDKIQQFGFRIG 778
           Y  P++  EGDK +QF F IG
Sbjct: 781 YAQPIKDYEGDKSEQFQFNIG 801


>gi|254252067|ref|ZP_04945385.1| surface antigen D15 [Burkholderia dolosa AUO158]
 gi|124894676|gb|EAY68556.1| surface antigen D15 [Burkholderia dolosa AUO158]
          Length = 768

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 159/747 (21%), Positives = 319/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 29  PFVVQDIKIEGLQRVEPGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S + L   +     
Sbjct: 149 TRGFYAAEVKTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSTLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSGIKLSGNLLDREAELNKLIKIKPGDRFSAEKLQQTTKAIVDKLGEYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D     V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 329 NAQPDIDQVNHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 449 GVSQDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTS 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 568 PLTVAWSRDARDSALIPSRGYFTQANIEYGVPVGKIQYYKADLQAQYYYSFSRGFILGLN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGNSTGANGLRYGYGVGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|170699881|ref|ZP_02890911.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria IOP40-10]
 gi|170135203|gb|EDT03501.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria IOP40-10]
          Length = 768

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 160/747 (21%), Positives = 321/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 29  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S ++L   +     
Sbjct: 149 TRGFYAAEVKTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSKLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSGIKLSGNLLDREAELTKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 329 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVTVKVDEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 449 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTS 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNQFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 568 PLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQAQYYYSFSRGFILGMN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|207723362|ref|YP_002253761.1| outer membrane protein [Ralstonia solanacearum MolK2]
 gi|207743236|ref|YP_002259628.1| outer membrane protein [Ralstonia solanacearum IPO1609]
 gi|206588561|emb|CAQ35524.1| outer membrane protein [Ralstonia solanacearum MolK2]
 gi|206594633|emb|CAQ61560.1| outer membrane protein [Ralstonia solanacearum IPO1609]
          Length = 765

 Score =  399 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 162/768 (21%), Positives = 316/768 (41%), Gaps = 18/768 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           F +  +            +     +++ I + G   V    +   +PV VG++ +D    
Sbjct: 7   FPLSMLAASVLTVCAGQAHAVEPFVIKDIRVEGVQRVEPGTVFGYLPVKVGETFTDDKGA 66

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++ +Y  G+F +V+I+   +VL++ + ER  I+ L F G      D L+  +      
Sbjct: 67  ESIRALYNTGFFKDVQIRAEGNVLVVRVEERPAISQLEFIGIKEFDKDTLRRSLRGVGVA 126

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            A  YD+  ++     +K+ Y S GY    V+     +    + +T+ ++EG  AKI  I
Sbjct: 127 EARYYDKSLIDRAEQELKRQYVSRGYYAADVQTTVTPVDANRVAVTFTVDEGPVAKIRQI 186

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L   +     +    + K D+YSK++++ D EA+R+FY DRGY    +
Sbjct: 187 NIVGNKAFSEGDLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSFYLDRGYLEFAI 246

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +     ++  +  LI+++ G++++  +
Sbjct: 247 ESTQVSITPDKKDIYLTLNIHEGEQYKVSDIKLTGELLSKQAEMEKLIKLKQGDVFSSAK 306

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  +++ I+    +    F  +  +   D   R V +  ++D G  +YV+R+ + GN ++
Sbjct: 307 LSATTKAITDLLGTYGYAFATINPQPQIDQKSRTVALTLVVDPGRRVYVRRVNVVGNSKT 366

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   E    +   ++ ++ RI  TGYF++ NI+       SD V + V+V +
Sbjct: 367 RDEVVRREMRQMESSWFDGEKLQLSQNRINRTGYFTDTNITTEDVPGTSDQVDVNVNVTE 426

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
              G + +   +     + +   I  +N FG G    L     +          +  + +
Sbjct: 427 KPTGQISLGVGFSSTDKLVLSAGIRQDNVFGSGTSLGLDVNTSKSNRTIAVTQYDPYFTV 486

Query: 499 G-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                 + +         +  D    I  +   ++  VP +E+ +  F            
Sbjct: 487 DGISRSTELYYRTYRPLYYTGDQDYRIVQQGGNIKFGVPFSETDTVFFGIGYERTTIDVT 546

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           S    +   Y         ++  I+     +  D+ +VP +G    ++ +    GGD QY
Sbjct: 547 SNTPLVYQNYVAKNGR-ISNNFPITIGWSKDQRDSALVPTRGRYQQANLEVGIPGGDLQY 605

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +R   +  YFY +S    +  +   GYG      K+  +F  +       +RG+    +G
Sbjct: 606 YRAYYQHQYFYPVSKSFTLAFNNEVGYGHGYG-GKDFPVFKNYYAGGIGSVRGYETSTLG 664

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           PR     A+GG      +    FP+P       +R   F D   ++A             
Sbjct: 665 PRDANGVAVGGASKFVGNMEFIFPLPGSGVDRTVRLFTFFDYGNVFAEGQPFKV------ 718

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R STG  + W SP+G + +  G P++ +  D+ Q+F F+IG   
Sbjct: 719 -GDMRYSTGFGLSWLSPIGPLKISMGFPIKKKAEDQTQRFQFQIGTAF 765


>gi|172060959|ref|YP_001808611.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria MC40-6]
 gi|171993476|gb|ACB64395.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria MC40-6]
          Length = 768

 Score =  399 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 159/747 (21%), Positives = 319/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 29  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S ++L   +     
Sbjct: 149 TRGFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSKLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSGIKLSGNLLDREAELTKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 329 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVTVKVDEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 449 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTS 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +             Y         ++ 
Sbjct: 509 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDTDDNTPASYKAYVNEFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 568 PLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQAQYYYSFSRGFILGMN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|115352095|ref|YP_773934.1| surface antigen (D15) [Burkholderia ambifaria AMMD]
 gi|115282083|gb|ABI87600.1| surface antigen (D15) [Burkholderia ambifaria AMMD]
          Length = 768

 Score =  399 bits (1024), Expect = e-108,   Method: Composition-based stats.
 Identities = 160/747 (21%), Positives = 321/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 29  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S ++L   +     
Sbjct: 149 TRGFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSKLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSGIKLSGNLLDREAELTKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 329 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVTVKVDEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 449 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTS 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNQFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 568 PLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQAQYYYSFSRGFILGMN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|300691596|ref|YP_003752591.1| outer membrane protein assembly factor, bacterial surface antigen
           domain (D15) [Ralstonia solanacearum PSI07]
 gi|299078656|emb|CBJ51314.1| putative outer membrane protein assembly factor, bacterial surface
           antigen domain (D15) [Ralstonia solanacearum PSI07]
          Length = 765

 Score =  399 bits (1024), Expect = e-108,   Method: Composition-based stats.
 Identities = 163/768 (21%), Positives = 316/768 (41%), Gaps = 18/768 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           F +  +            +     +++ I + G   V    +   +PV VG++ +D    
Sbjct: 7   FPLSVLAASVLTVCAGQAHAVEPFVIKDIRVEGVQRVEPGTVFGYLPVKVGETFTDDKGA 66

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++ +Y  G+F +V+I+   +VL++ + ER  I+ L F G      D L+  +      
Sbjct: 67  ESIRALYNTGFFKDVQIRAEGNVLVVRVEERPAISQLEFIGIKEFDKDTLRRSLRGVGVA 126

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            A  YD+  ++     +K+ Y S GY    V+     +    + +T+ ++EG  AKI  I
Sbjct: 127 EARYYDKSLIDRAEQELKRQYVSRGYYAADVQTTVTPVDANRVAVTFTVDEGPVAKIRQI 186

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L   +     +    + K D+YSK++++ D EA+R+FY DRGY    +
Sbjct: 187 NIVGNKAFSEGDLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSFYLDRGYLEFAI 246

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +     ++  +  LI+++ G++++  +
Sbjct: 247 ESTQVSITPDKKDIYLTLNIHEGEQYKVSDIKLTGELLSKQAEMEKLIKLKPGDVFSSAK 306

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  +++ I+    +    F  +  +   D   R V +  ++D G  +YV+R+ + GN ++
Sbjct: 307 LSATTKAITDLLGTYGYAFATINPQPQIDQKSRTVALTLVVDPGRRVYVRRVNVVGNSKT 366

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   E    +   ++ ++ RI  TGYF++ NI+       SD V + V+V +
Sbjct: 367 RDEVVRREMRQMESSWFDGEKLQLSQNRINRTGYFTDTNITTEDVPGTSDQVDVNVNVTE 426

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
              G + +   +     + +   I  +N FG G    L     +          +  + +
Sbjct: 427 KPTGQISLGVGFSSTDKLVLSAGIRQDNVFGSGTSLGLDVNTSKSNRTIAVTQYDPYFTV 486

Query: 499 G-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                 + +         +  D    I  +   ++  VP +E+ +  F            
Sbjct: 487 DGISRSTELYYRTYRPLYYTGDQDYRIVQQGGNIKFGVPFSETDTVFFGIGYERTTIDVT 546

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           S    +   Y         ++  I+     +  D+ +VP +G    ++ +    GGD QY
Sbjct: 547 SNTPLVYQNYVAKNGR-ISNNFPITIGWSKDQRDSALVPTRGRYQQANLEIGIPGGDLQY 605

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +R   +  YFY +S    +  +   GYG      K+  +F  +       +RG+    +G
Sbjct: 606 YRAYYQHQYFYPVSKSFTLAFNNEIGYGHGYG-GKDFPVFKNYYAGGIGSVRGYETSTLG 664

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           PR     AIGG      +    FP+P       +R   F D   ++A             
Sbjct: 665 PRDANGVAIGGASKFVGNMEFIFPLPGSGVDRTVRLFTFFDYGNVFAEGQPFKV------ 718

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R STG  + W SP+G + +  G P++ +  D+ Q+F F+IG   
Sbjct: 719 -GDMRYSTGFGLSWLSPIGPLKISMGFPIKKKAQDQAQRFQFQIGTAF 765


>gi|323959938|gb|EGB55585.1| outer membrane protein [Escherichia coli H489]
          Length = 810

 Score =  399 bits (1024), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMDEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|226200104|ref|ZP_03795650.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           Pakistan 9]
 gi|225927788|gb|EEH23829.1| putative protective surface antigen D15 [Burkholderia pseudomallei
           Pakistan 9]
          Length = 738

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/744 (20%), Positives = 315/744 (42%), Gaps = 17/744 (2%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I     V+I
Sbjct: 2   VQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGGVVI 61

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYASIG 164
           + + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y + G
Sbjct: 62  VQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYLTRG 121

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRTSGY 223
           +    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     + +
Sbjct: 122 FYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTPNWF 181

Query: 224 FSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIY 283
             + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +         
Sbjct: 182 SWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHEGEP 241

Query: 284 TVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTR 343
              +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V  +
Sbjct: 242 YTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATVNAQ 301

Query: 344 INRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERA 403
              D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +  +
Sbjct: 302 PEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRLALS 361

Query: 404 KRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHID 463
           K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +   I 
Sbjct: 362 KDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSAGIS 421

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLEDGSL 518
            +N FG G    +     +         V+  + +      + +         +  + S 
Sbjct: 422 QDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTNSSF 481

Query: 519 DINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSIS 578
            I      ++  +P +E+ +  F       +    S   +    Y         ++  ++
Sbjct: 482 RIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTVPLT 540

Query: 579 QSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRF 638
                +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  + + 
Sbjct: 541 IGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLNFQA 600

Query: 639 GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAVSFP 697
           GYG  I +     +F  +       +RG+    +GPR       IGG      +  ++FP
Sbjct: 601 GYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIELTFP 658

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
           +P       LR   F+D   ++ N             +  R   G+ + W SP+G + + 
Sbjct: 659 LPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPLKLS 714

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
            G PL+  EGD+ Q+F F+IG   
Sbjct: 715 LGFPLQKHEGDQYQKFQFQIGTAF 738


>gi|226941202|ref|YP_002796276.1| outer membrane protein [Laribacter hongkongensis HLHK9]
 gi|226716129|gb|ACO75267.1| probable outer membrane protein [Laribacter hongkongensis HLHK9]
          Length = 767

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 186/749 (24%), Positives = 320/749 (42%), Gaps = 10/749 (1%)

Query: 42  GSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKI 101
            +   +VR I + G        + + +P+ VG + +D     A+K ++A G+F +V+I+ 
Sbjct: 20  AATPFVVRDIRVEGLQRTEPGTVFNYLPLKVGDTFTDTRAQDAIKALFATGFFDDVRIES 79

Query: 102 VDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQ 158
              V+I+ + ER ++  L  +G      DQLK  ++      +  +D+  ++  V  +K+
Sbjct: 80  ESDVVIVSVDERPVVAQLSITGAKEFDKDQLKKALKENGFAESRIFDQALLDQAVQELKR 139

Query: 159 AYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS- 217
            Y + G  +V +K     +    + +   I EG  A+I  I FVGN+ +S   L   +  
Sbjct: 140 QYFTKGKYSVEIKPTVTKLDRNRVAVALDISEGPAARIKRIDFVGNQAFSADDLSEQMQL 199

Query: 218 IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQI 277
                +  F K D YS+++++ D E +RAFY ++GY    + S  +        + I   
Sbjct: 200 ATPGWFSWFTKDDQYSRQKLTGDLEKLRAFYLNQGYFEFNIDSTQVSISPDKEDMFITVN 259

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
                    +    +    + +  LL L+ ++ G+ +   +I +S   I+    +    F
Sbjct: 260 VSEGKKYTVSDVRLAGDMIVPEAELLPLLVVKKGDTFTRDKITDSVTAITDRLGAEGYAF 319

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
             +      D  K  V   + +D G   YV++I I GN ++ D VIRRE+   E    + 
Sbjct: 320 ANINAVPEVDKEKGEVGFTFFVDPGRRTYVRKINIVGNTRTRDEVIRREMRQMEAGWYDA 379

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMG 457
           + I+R+K R+   GYF++VN+      D +D V +   V +   G+V +   Y  D+G+ 
Sbjct: 380 AKIKRSKERLDLLGYFTDVNVETPAVPDTADQVDVNFKVTEKPTGNVTLGAGYAQDEGLI 439

Query: 458 VEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGS 517
           +   I  +NFFG G     +        +    S  DPYF    +S G+DL         
Sbjct: 440 LSAGISQSNFFGSGKAVSASFNTS-KLNRYLNLSFTDPYFTNDGVSIGYDLYTRRYSPNK 498

Query: 518 LDINDESAAVR---MIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSS 574
            D            +      +   +    L   Q    +           + + G  + 
Sbjct: 499 TDTYQYQTDTTGAAVRFGFPITEYDTINTSLGVEQVKVKTFAGSPQRYKDYVNQFGDNNL 558

Query: 575 HSI-SQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV 633
           + +       +T D+ + P KG +   + + A  G D QY RI +   +F+ LS    + 
Sbjct: 559 NYLAKVGWGRDTRDSFLWPTKGRVSRINLEVALPGSDIQYGRIVASQQFFWPLSKTFTLA 618

Query: 634 GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAA 693
            +   G      S  ++  F  F +     +RGF    IGPR +   A G    +  +A 
Sbjct: 619 LNGEIGAVQSYGSTSSVPFFQNFYLGGIGSVRGFETGSIGPRDELNDAYGATRRAIVNAE 678

Query: 694 VSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGND-SFWRVSTGVEIMWNSPLG 752
           V FP P + +   LR + FVD+ TL+    A  AD    +     R STGV + W SPLG
Sbjct: 679 VLFPFPGMKDDKTLRMSGFVDAGTLWGGDYATAADGKPLSWQDNLRYSTGVALSWLSPLG 738

Query: 753 MMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            M   +  PL+  EGD+IQ+F F +G   
Sbjct: 739 PMKFSFAYPLKKEEGDQIQRFQFTLGTVF 767


>gi|78066790|ref|YP_369559.1| surface antigen (D15) [Burkholderia sp. 383]
 gi|77967535|gb|ABB08915.1| surface antigen (D15) [Burkholderia sp. 383]
          Length = 769

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 159/747 (21%), Positives = 319/747 (42%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 30  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 89

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 90  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 149

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +  + L   +     
Sbjct: 150 TRGFYAAEVKTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTP 209

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 210 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIDSTQVSISPDKKDMYLTVTLHE 269

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 270 GEPYTVSGIKLSGNLLDREAELNKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 329

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 330 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 389

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 390 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVNVKVDEKPTGAITLGAGFSSTDKVVLSA 449

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +   
Sbjct: 450 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTS 509

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 510 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNQFGR-VSNTV 568

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 569 PLTIAWSRDARDSALIPSRGYFTQANMEYGVPVGKIQYYKADLQAQYYYSFSRGFILGMN 628

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 629 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMLVGNIEL 686

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 687 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 742

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 743 KLSLGFPLQKHEGDQYQKFQFQIGTAF 769


>gi|104783187|ref|YP_609685.1| surface antigen family outer membrane protein [Pseudomonas
           entomophila L48]
 gi|95112174|emb|CAK16901.1| putative outer membrane protein, bacterial surface antigen family
           [Pseudomonas entomophila L48]
          Length = 787

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 166/788 (21%), Positives = 327/788 (41%), Gaps = 32/788 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG  + D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGDQVDDRRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           + ++++  G+F ++++    +VLII+++ER  ++ +   GN  +  + L   ++      
Sbjct: 61  STRSLFKTGFFQDIQLNRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKIKINEGTVAAIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +    L ++  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFDDETLGQLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +S+ I++   +    F  V      +     VDI +++D G   YV RI   GN ++ 
Sbjct: 301 TTTSDLITRRLGNEGYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPPVPGTDDQVDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I   NF G G +  +           Y F   DPYF  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQTNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYFTA 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G++          LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRSTNYDDLDVDVASYAVDSLGAGVSLGYPISETSRLTYGLTVQQDKLKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G  F +   S     +TL+  ++  +G   S + +    G D  +
Sbjct: 540 GKYTVDEIFDFVDKEGDNFLNFKASIGWSESTLNKGVLATRGHSQSLTLESTIPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +++  R   F  +++D  +      GYG        L  ++ +       +RGF    +G
Sbjct: 600 YKLDYRGQLFKPINNDYTLRLHTELGYGDGFGGTSGLPFYENYYAGGFNSVRGFKDSSLG 659

Query: 674 PR--------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFV 713
           PR                           GG +       + FP+P V ++  LR + F 
Sbjct: 660 PRSTPSRGEGNPGGKPGTIADPDQDPLPFGGNVLVQGGVELLFPLPFVKDQRSLRTSVFW 719

Query: 714 DSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQF 773
           D   ++  +     D  +   S    S G+ + W + LG +     +P++  +    Q F
Sbjct: 720 DVGNVFDTNCGSKPDCAKVGFSDMASSVGLGVTWITALGPLSFSLAMPIKKPDDADTQVF 779

Query: 774 GFRIGNRM 781
            F +G   
Sbjct: 780 QFSLGQTF 787


>gi|269101947|ref|ZP_06154644.1| outer membrane protein assembly factor YaeT precursor
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268161845|gb|EEZ40341.1| outer membrane protein assembly factor YaeT precursor
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 807

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 180/807 (22%), Positives = 306/807 (37%), Gaps = 48/807 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSN-TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
             M  +++   + G S  + +    +V  I   G   V     L ++PV VG ++   D+
Sbjct: 1   MAMKKLLVASLLLGSSVAHSAEQNFVVDDIRFEGLQRVTLGAALLKMPVRVGDTVDSQDV 60

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---S 138
              ++++YA G F +V++    + LII + ER  I  + F+GN  +K+DQLK  +     
Sbjct: 61  SSLIRSLYASGNFEDVQVYRDGNTLIIQVHERPTIASITFAGNKAIKEDQLKENLNSADL 120

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R   A D  T++     ++  Y S+G  N  V+     +    +++ +V  EGV AKI  
Sbjct: 121 RVGEALDRTTLSKIEKGLEDFYYSVGKYNATVEAVVTPLPRNRVDLKFVFTEGVSAKIKQ 180

Query: 199 IRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  +GN  +S A +    +      +++F   + Y K+ ++ D EA+R  Y + GY   +
Sbjct: 181 INILGNHVFSDADIRSKFNLKANVPWWNFMANEKYQKQVLAGDLEALRTMYLNDGYLKYR 240

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           + S  +        V I                        +  L  L+  ++G++YN  
Sbjct: 241 LDSTQVSISPDKKGVYITLKVHEGEQYKVKSVQFRGDTVNSQAELDKLVDFKAGDVYNGA 300

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++    E + +        + +V+T    D A + V +   ID G  +YV++IE  GN  
Sbjct: 301 KVTALEEAVKRKLGEAGYAYPQVQTIPEFDDATKEVSLVVNIDPGKRVYVRKIEFAGNAS 360

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RRE+   EG  +N   IE  K+R+  TG+F  V++  +      D V +R  VK
Sbjct: 361 TKDEVLRREMRQMEGTWLNAKNIETGKQRLNRTGFFENVDVETVRVPGSDDQVDVRYKVK 420

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVE 493
           + +AGSV     Y  + G+  +  +  +NF G G R  + A    +              
Sbjct: 421 EANAGSVNFGVGYGTESGISFQAGLTQDNFLGTGNRFGINAMMNDYQKNVSLEYKDPYFT 480

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        + + ++             ++    P  E     F       +    
Sbjct: 481 IDGISLGGKVYYNEFEASNANISDYTNQSYGTSLTWGFPFNELNFFDFGLGYDHNKISNT 540

Query: 554 SEKEKIPSIYTTLIEHGKF-----SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
            E  +I                       S S   N L+    P  G    +S      G
Sbjct: 541 QEYYQIEKFKRAHGFDRDDGSIVLDDFYWSASWTRNNLNRGYFPTSGNYQRASLRMTIPG 600

Query: 609 GDSQYHRIGSRASYFYLL--SDDSDIVGSLRFGYGCVIPSNKN-----LQLFDQFSVSSN 661
            D+QY++       +  L  S D  ++   R GYG       N     L  ++ F     
Sbjct: 601 SDAQYYKAQYDVRQYIPLTQSQDFSLLLRGRLGYGNGYGKTDNGSDQLLPFYENFYAGGF 660

Query: 662 YYLRGFAYKGIGPR--------------------VDKKYAIGGKIYSSASAAVSFPMPLV 701
             LRGF    +GP+                         A GG   + AS  +  P P V
Sbjct: 661 STLRGFRSNTVGPKAVYVGGCPAGGGISGNNNCYTGTDDAAGGNAQALASMELIVPTPFV 720

Query: 702 PERA--GLRGAFFVDSATLYANHVALGADK-----LEGNDSFWRVSTGVEIMWNSPLGMM 754
            E     +R + FVD+ T++     L            +    R S G  + W SP+G +
Sbjct: 721 SEEFRNQIRTSIFVDAGTVWDTEYDLKDSSGKYLYDYSDPGMIRASYGAALQWMSPMGPL 780

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
                 P++  +GD  + F F IG   
Sbjct: 781 VFSLAKPIKKYDGDDEELFTFTIGQTF 807


>gi|171318098|ref|ZP_02907267.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria MEX-5]
 gi|171096722|gb|EDT41607.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           ambifaria MEX-5]
          Length = 768

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 160/747 (21%), Positives = 322/747 (43%), Gaps = 17/747 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
             +V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    +
Sbjct: 29  PFVVQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGN 88

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           V+I+ + ER  I  + F+G      D L   +          YD+  V+     +K+ Y 
Sbjct: 89  VVIVQVQERPAIASIDFTGTKEFDKDNLTKALRAVGLADGRYYDKALVDKAEQELKRQYL 148

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRT 220
           + G+    VK     +    ++I + + EG  AKI  I F+GNK +S ++L   +     
Sbjct: 149 TRGFYAAEVKTTITPVDANRVSILFAVAEGPSAKIRQINFIGNKAFSTSKLRDEMQLSTP 208

Query: 221 SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           + +  + K D+YSKE+++ D EA+R++Y +RGY    + S  +        + +      
Sbjct: 209 NWFSWYTKNDLYSKEKLTGDLEAVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVTLHE 268

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
                 +    S     ++  L  LI+I+ G+ ++ ++++++++ I          F  V
Sbjct: 269 GEPYTVSGIKLSGNLLDREAELNKLIKIKPGDRFSAEKLQQTTKSIVDKLGEYGYAFATV 328

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
             + + D A   V++  ++D    +YV+RI + GN ++ D V+RRE+   E    + + +
Sbjct: 329 NAQPDIDQANHKVNLNLVVDPSRRVYVRRINVVGNTRTRDEVVRREMRQLESSWFDSNRL 388

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
             +K R+   GYF+ V+++ +P    +D V + V V +   G++ +   +     + +  
Sbjct: 389 ALSKDRVNRLGYFTNVDVTTVPVEGTNDQVDVTVKVDEKPTGAITLGAGFSSTDKVVLSA 448

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLED 515
            +  +N FG G    +     +         V+  + +      + +         +  +
Sbjct: 449 GVSQDNVFGSGTSLSVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVYYRTYQPLYYSTN 508

Query: 516 GSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSH 575
            S  I      ++  +P +E  +  F       +    S   +    Y         ++ 
Sbjct: 509 SSFRIISAGGNLKFGIPFSEVDTVYFGAGFEQNRLDVDSNTPQSYQDYVNQFGR-VSNTV 567

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            ++ +   +  D+ ++P +G    ++ +Y    G  QY++   +A Y+Y  S    +  +
Sbjct: 568 PLTVAWSRDARDSALIPSRGYFTQANVEYGVPVGKIQYYKADLQAQYYYSFSRGFILGMN 627

Query: 636 LRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAV 694
           L+ GYG  I +     +F  +       +RG+    +GPR       IGG      +  +
Sbjct: 628 LQGGYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIEL 685

Query: 695 SFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMM 754
           +FP+P       LR   F+D   ++ N             +  R   GV + W SP+G +
Sbjct: 686 TFPLPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGVGLAWISPIGPL 741

Query: 755 GVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +  G PL+  EGD+ Q+F F+IG   
Sbjct: 742 KLSLGFPLQKHEGDQYQKFQFQIGTAF 768


>gi|15799859|ref|NP_285871.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O157:H7 EDL933]
 gi|15829433|ref|NP_308206.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O157:H7 str. Sakai]
 gi|16128170|ref|NP_414719.1| outer membrane protein assembly factor, forms pores; required for
           OM biogenesis; in BamABCD OM protein complex
           [Escherichia coli str. K-12 substr. MG1655]
 gi|24111612|ref|NP_706122.1| outer membrane protein assembly factor YaeT [Shigella flexneri 2a
           str. 301]
 gi|26246123|ref|NP_752162.1| outer membrane protein assembly factor YaeT [Escherichia coli
           CFT073]
 gi|30061734|ref|NP_835905.1| outer membrane protein assembly factor YaeT [Shigella flexneri 2a
           str. 2457T]
 gi|74310797|ref|YP_309216.1| outer membrane protein assembly factor YaeT [Shigella sonnei Ss046]
 gi|82542776|ref|YP_406723.1| outer membrane protein assembly factor YaeT [Shigella boydii Sb227]
 gi|89107057|ref|AP_000837.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|91209247|ref|YP_539233.1| outer membrane protein assembly factor YaeT [Escherichia coli
           UTI89]
 gi|110640396|ref|YP_668124.1| outer membrane protein assembly factor YaeT [Escherichia coli 536]
 gi|110804229|ref|YP_687749.1| outer membrane protein assembly factor YaeT [Shigella flexneri 5
           str. 8401]
 gi|157155563|ref|YP_001461346.1| outer membrane protein assembly factor YaeT [Escherichia coli
           E24377A]
 gi|157159642|ref|YP_001456960.1| outer membrane protein assembly factor YaeT [Escherichia coli HS]
 gi|168755790|ref|ZP_02780797.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4401]
 gi|168770349|ref|ZP_02795356.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4486]
 gi|168782069|ref|ZP_02807076.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4076]
 gi|168789286|ref|ZP_02814293.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC869]
 gi|170021470|ref|YP_001726424.1| outer membrane protein assembly factor YaeT [Escherichia coli ATCC
           8739]
 gi|170079813|ref|YP_001729133.1| hypothetical protein ECDH10B_0157 [Escherichia coli str. K-12
           substr. DH10B]
 gi|187733865|ref|YP_001878979.1| outer membrane protein assembly factor YaeT [Shigella boydii CDC
           3083-94]
 gi|188495809|ref|ZP_03003079.1| outer membrane protein, OMP85 family [Escherichia coli 53638]
 gi|191172808|ref|ZP_03034345.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli F11]
 gi|193063191|ref|ZP_03044282.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli E22]
 gi|193067756|ref|ZP_03048723.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli E110019]
 gi|208808320|ref|ZP_03250657.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4206]
 gi|208813245|ref|ZP_03254574.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4045]
 gi|209400867|ref|YP_002268785.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4115]
 gi|209917367|ref|YP_002291451.1| outer membrane protein assembly factor YaeT [Escherichia coli SE11]
 gi|215485338|ref|YP_002327769.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217324563|ref|ZP_03440647.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. TW14588]
 gi|218552758|ref|YP_002385671.1| outer membrane protein assembly factor YaeT [Escherichia coli IAI1]
 gi|218557118|ref|YP_002390031.1| outer membrane protein assembly factor YaeT [Escherichia coli S88]
 gi|218693642|ref|YP_002401309.1| outer membrane protein assembly factor YaeT [Escherichia coli
           55989]
 gi|218698597|ref|YP_002406226.1| outer membrane protein assembly factor YaeT [Escherichia coli
           IAI39]
 gi|218703431|ref|YP_002410950.1| outer membrane protein assembly factor YaeT [Escherichia coli
           UMN026]
 gi|227884910|ref|ZP_04002715.1| outer membrane protein assembly factor YaeT [Escherichia coli
           83972]
 gi|237704336|ref|ZP_04534817.1| outer membrane protein assembly factor yaeT [Escherichia sp.
           3_2_53FAA]
 gi|238899575|ref|YP_002925371.1| hypothetical protein BWG_0169 [Escherichia coli BW2952]
 gi|253774796|ref|YP_003037627.1| outer membrane protein assembly factor YaeT [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037596|ref|ZP_04871673.1| outer membrane protein assembly factor yaeT [Escherichia sp.
           1_1_43]
 gi|254160296|ref|YP_003043404.1| outer membrane protein assembly factor YaeT [Escherichia coli B
           str. REL606]
 gi|254791310|ref|YP_003076147.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O157:H7 str. TW14359]
 gi|256021609|ref|ZP_05435474.1| outer membrane protein assembly factor YaeT [Shigella sp. D9]
 gi|256025489|ref|ZP_05439354.1| outer membrane protein assembly factor YaeT [Escherichia sp.
           4_1_40B]
 gi|260842409|ref|YP_003220187.1| Omp85 family protein [Escherichia coli O103:H2 str. 12009]
 gi|260853387|ref|YP_003227278.1| Omp85 family protein [Escherichia coli O26:H11 str. 11368]
 gi|260866326|ref|YP_003232728.1| Omp85 family protein [Escherichia coli O111:H- str. 11128]
 gi|261226931|ref|ZP_05941212.1| hypothetical protein EscherichiacoliO157_20412 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255335|ref|ZP_05947868.1| Omp85 family protein [Escherichia coli O157:H7 str. FRIK966]
 gi|291280999|ref|YP_003497817.1| outer membrane protein assembly factor yaeT precursor [Escherichia
           coli O55:H7 str. CB9615]
 gi|293403246|ref|ZP_06647343.1| outer membrane protein assembly factor yaeT [Escherichia coli
           FVEC1412]
 gi|293408269|ref|ZP_06652109.1| outer membrane protein assembly complex [Escherichia coli B354]
 gi|293418062|ref|ZP_06660684.1| outer membrane protein assembly complex [Escherichia coli B185]
 gi|298378782|ref|ZP_06988666.1| outer membrane protein assembly factor yaeT [Escherichia coli
           FVEC1302]
 gi|300816217|ref|ZP_07096440.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 107-1]
 gi|300824100|ref|ZP_07104220.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 119-7]
 gi|300900785|ref|ZP_07118929.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 198-1]
 gi|300901996|ref|ZP_07120023.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 84-1]
 gi|300920141|ref|ZP_07136592.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 115-1]
 gi|300932131|ref|ZP_07147416.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 187-1]
 gi|300938584|ref|ZP_07153317.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 21-1]
 gi|300949791|ref|ZP_07163765.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 116-1]
 gi|300956060|ref|ZP_07168385.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 175-1]
 gi|300984937|ref|ZP_07177202.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 200-1]
 gi|300993602|ref|ZP_07180458.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 45-1]
 gi|301025943|ref|ZP_07189427.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 69-1]
 gi|301028670|ref|ZP_07191891.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 196-1]
 gi|301049910|ref|ZP_07196835.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 185-1]
 gi|301305313|ref|ZP_07211409.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 124-1]
 gi|301330025|ref|ZP_07222709.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 78-1]
 gi|301646500|ref|ZP_07246375.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 146-1]
 gi|306815223|ref|ZP_07449372.1| outer membrane protein assembly factor YaeT [Escherichia coli
           NC101]
 gi|307311375|ref|ZP_07591017.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli W]
 gi|309796354|ref|ZP_07690763.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 145-7]
 gi|312966314|ref|ZP_07780540.1| outer membrane assembly complex, YaeT protein [Escherichia coli
           2362-75]
 gi|312970278|ref|ZP_07784460.1| outer membrane assembly complex, YaeT protein [Escherichia coli
           1827-70]
 gi|331651082|ref|ZP_08352110.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli M718]
 gi|331661248|ref|ZP_08362180.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli TA206]
 gi|331661551|ref|ZP_08362475.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli TA143]
 gi|331666418|ref|ZP_08367299.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli TA271]
 gi|331671683|ref|ZP_08372481.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli TA280]
 gi|331680756|ref|ZP_08381415.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli H591]
 gi|331681562|ref|ZP_08382199.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli H299]
 gi|332282851|ref|ZP_08395264.1| outer membrane protein assembly factor yaeT [Shigella sp. D9]
 gi|71164816|sp|P0A942|YAET_ECO57 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|71164817|sp|P0A941|YAET_ECOL6 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|71164818|sp|P0A940|YAET_ECOLI RecName: Full=Outer membrane protein assembly factor yaeT; AltName:
           Full=Omp85; Flags: Precursor
 gi|71164819|sp|P0A943|YAET_SHIFL RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|84027742|sp|Q3Z5I1|YAET_SHISS RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|122424954|sp|Q1RG12|YAET_ECOUT RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|123048458|sp|Q0T832|YAET_SHIF8 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|123344364|sp|Q0TLF6|YAET_ECOL5 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|123560532|sp|Q325W3|YAET_SHIBS RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|166919049|sp|A7ZHR7|YAET_ECO24 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|166919050|sp|A7ZWC3|YAET_ECOHS RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|189040681|sp|B1IQG4|YAET_ECOLC RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708901|sp|B7MBF8|YAET_ECO45 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708902|sp|B5Z0F6|YAET_ECO5E RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708903|sp|B7NID9|YAET_ECO7I RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708904|sp|B7M1Y0|YAET_ECO8A RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708905|sp|B1XD46|YAET_ECODH RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708906|sp|B7N844|YAET_ECOLU RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708907|sp|B6HZF1|YAET_ECOSE RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708920|sp|B2U320|YAET_SHIB3 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|254807338|sp|B7UIM2|YAET_ECO27 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|254807339|sp|B7LGN8|YAET_ECO55 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|259710198|sp|C4ZRR9|YAET_ECOBW RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|4567046|gb|AAD23568.1|AF120927_1 outer membrane antigen Oma90 [Shigella flexneri]
 gi|12512902|gb|AAG54479.1|AE005193_9 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|15529632|gb|AAL01379.1|AF407013_1 outer membrane protein [Escherichia coli]
 gi|26106520|gb|AAN78706.1|AE016755_206 Unknown protein from 2D-page spots M62/M63/O3/O9/T35 precursor
           [Escherichia coli CFT073]
 gi|1552754|gb|AAB08606.1| hypothetical protein [Escherichia coli]
 gi|1786374|gb|AAC73288.1| outer membrane protein assembly factor, forms pores; required for
           OM biogenesis; in BamABCD OM protein complex
           [Escherichia coli str. K-12 substr. MG1655]
 gi|13359635|dbj|BAB33602.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24050380|gb|AAN41829.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30039976|gb|AAP15710.1| hypothetical protein S0170 [Shigella flexneri 2a str. 2457T]
 gi|73854274|gb|AAZ86981.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81244187|gb|ABB64895.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85674369|dbj|BAA77852.2| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|91070821|gb|ABE05702.1| protein with possible extracytoplasmic function [Escherichia coli
           UTI89]
 gi|110341988|gb|ABG68225.1| putative outer membrane antigen [Escherichia coli 536]
 gi|110613777|gb|ABF02444.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|157065322|gb|ABV04577.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli HS]
 gi|157077593|gb|ABV17301.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli E24377A]
 gi|169756398|gb|ACA79097.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli ATCC 8739]
 gi|169887648|gb|ACB01355.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|187430857|gb|ACD10131.1| outer membrane protein assembly complex, YaeT protein [Shigella
           boydii CDC 3083-94]
 gi|188491008|gb|EDU66111.1| outer membrane protein, OMP85 family [Escherichia coli 53638]
 gi|189000478|gb|EDU69464.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4076]
 gi|189357088|gb|EDU75507.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4401]
 gi|189360697|gb|EDU79116.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4486]
 gi|189371106|gb|EDU89522.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC869]
 gi|190906958|gb|EDV66560.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli F11]
 gi|192931099|gb|EDV83702.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli E22]
 gi|192959168|gb|EDV89604.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli E110019]
 gi|208728121|gb|EDZ77722.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4206]
 gi|208734522|gb|EDZ83209.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4045]
 gi|209162267|gb|ACI39700.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. EC4115]
 gi|209745774|gb|ACI71194.1| hypothetical protein ECs0179 [Escherichia coli]
 gi|209745776|gb|ACI71195.1| hypothetical protein ECs0179 [Escherichia coli]
 gi|209745778|gb|ACI71196.1| hypothetical protein ECs0179 [Escherichia coli]
 gi|209745780|gb|ACI71197.1| hypothetical protein ECs0179 [Escherichia coli]
 gi|209745782|gb|ACI71198.1| hypothetical protein ECs0179 [Escherichia coli]
 gi|209910626|dbj|BAG75700.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215263410|emb|CAS07730.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217320784|gb|EEC29208.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli O157:H7 str. TW14588]
 gi|218350374|emb|CAU96057.1| outer membrane protein assembly factor [Escherichia coli 55989]
 gi|218359526|emb|CAQ97064.1| outer membrane protein assembly factor [Escherichia coli IAI1]
 gi|218363887|emb|CAR01552.1| outer membrane protein assembly factor [Escherichia coli S88]
 gi|218368583|emb|CAR16320.1| outer membrane protein assembly factor [Escherichia coli IAI39]
 gi|218430528|emb|CAR11394.1| outer membrane protein assembly factor [Escherichia coli UMN026]
 gi|222032007|emb|CAP74746.1| Outer membrane protein assembly factor yaet [Escherichia coli LF82]
 gi|226840702|gb|EEH72704.1| outer membrane protein assembly factor yaeT [Escherichia sp.
           1_1_43]
 gi|226902248|gb|EEH88507.1| outer membrane protein assembly factor yaeT [Escherichia sp.
           3_2_53FAA]
 gi|227838048|gb|EEJ48514.1| outer membrane protein assembly factor YaeT [Escherichia coli
           83972]
 gi|238860428|gb|ACR62426.1| conserved protein [Escherichia coli BW2952]
 gi|242376008|emb|CAQ30691.1| BamA, subunit of Outer Membrane Protein Assembly Complex
           [Escherichia coli BL21(DE3)]
 gi|253325840|gb|ACT30442.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972197|gb|ACT37868.1| hypothetical protein ECB_00175 [Escherichia coli B str. REL606]
 gi|253976406|gb|ACT42076.1| hypothetical protein ECD_00175 [Escherichia coli BL21(DE3)]
 gi|254590710|gb|ACT70071.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257752036|dbj|BAI23538.1| Omp85 family protein [Escherichia coli O26:H11 str. 11368]
 gi|257757556|dbj|BAI29053.1| Omp85 family protein [Escherichia coli O103:H2 str. 12009]
 gi|257762682|dbj|BAI34177.1| Omp85 family protein [Escherichia coli O111:H- str. 11128]
 gi|260450619|gb|ACX41041.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli DH1]
 gi|281177402|dbj|BAI53732.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|281599532|gb|ADA72516.1| Outer membrane protein assembly factor yaeT precursor [Shigella
           flexneri 2002017]
 gi|284919952|emb|CBG33007.1| outer membrane protein assembly factor [Escherichia coli 042]
 gi|290760872|gb|ADD54833.1| Outer membrane protein assembly factor yaeT precursor [Escherichia
           coli O55:H7 str. CB9615]
 gi|291430161|gb|EFF03175.1| outer membrane protein assembly factor yaeT [Escherichia coli
           FVEC1412]
 gi|291430780|gb|EFF03778.1| outer membrane protein assembly complex [Escherichia coli B185]
 gi|291472520|gb|EFF15002.1| outer membrane protein assembly complex [Escherichia coli B354]
 gi|294489921|gb|ADE88677.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli IHE3034]
 gi|298281116|gb|EFI22617.1| outer membrane protein assembly factor yaeT [Escherichia coli
           FVEC1302]
 gi|299878302|gb|EFI86513.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 196-1]
 gi|300298339|gb|EFJ54724.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 185-1]
 gi|300306587|gb|EFJ61107.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 200-1]
 gi|300317090|gb|EFJ66874.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 175-1]
 gi|300355734|gb|EFJ71604.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 198-1]
 gi|300395742|gb|EFJ79280.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 69-1]
 gi|300405882|gb|EFJ89420.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 84-1]
 gi|300406525|gb|EFJ90063.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 45-1]
 gi|300412838|gb|EFJ96148.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 115-1]
 gi|300450823|gb|EFK14443.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 116-1]
 gi|300456466|gb|EFK19959.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 21-1]
 gi|300460107|gb|EFK23600.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 187-1]
 gi|300523377|gb|EFK44446.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 119-7]
 gi|300531424|gb|EFK52486.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 107-1]
 gi|300839418|gb|EFK67178.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 124-1]
 gi|300843936|gb|EFK71696.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 78-1]
 gi|301075286|gb|EFK90092.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 146-1]
 gi|305850885|gb|EFM51340.1| outer membrane protein assembly factor YaeT [Escherichia coli
           NC101]
 gi|306908354|gb|EFN38852.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli W]
 gi|307552027|gb|ADN44802.1| protein with possible extracytoplasmic function [Escherichia coli
           ABU 83972]
 gi|307629753|gb|ADN74057.1| outer membrane protein assembly factor YaeT [Escherichia coli
           UM146]
 gi|308120058|gb|EFO57320.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 145-7]
 gi|309700385|emb|CBI99673.1| outer membrane protein assembly factor [Escherichia coli ETEC
           H10407]
 gi|310337776|gb|EFQ02887.1| outer membrane assembly complex, YaeT protein [Escherichia coli
           1827-70]
 gi|312289557|gb|EFR17451.1| outer membrane assembly complex, YaeT protein [Escherichia coli
           2362-75]
 gi|312944785|gb|ADR25612.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|313646762|gb|EFS11221.1| outer membrane assembly complex, YaeT protein [Shigella flexneri 2a
           str. 2457T]
 gi|315059395|gb|ADT73722.1| outer membrane protein assembly factor [Escherichia coli W]
 gi|315134867|dbj|BAJ42026.1| outer membrane protein assembly factor [Escherichia coli DH1]
 gi|315254979|gb|EFU34947.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 85-1]
 gi|315285256|gb|EFU44701.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 110-3]
 gi|315294581|gb|EFU53928.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 153-1]
 gi|315300681|gb|EFU59908.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 16-3]
 gi|315616338|gb|EFU96956.1| outer membrane assembly complex, YaeT protein [Escherichia coli
           3431]
 gi|320186599|gb|EFW61324.1| Outer membrane protein assembly factor YaeT precursor [Shigella
           flexneri CDC 796-83]
 gi|320190297|gb|EFW64947.1| Outer membrane protein assembly factor YaeT precursor [Escherichia
           coli O157:H7 str. EC1212]
 gi|320196946|gb|EFW71567.1| Outer membrane protein assembly factor YaeT precursor [Escherichia
           coli WV_060327]
 gi|320200297|gb|EFW74883.1| Outer membrane protein assembly factor YaeT precursor [Escherichia
           coli EC4100B]
 gi|320639983|gb|EFX09568.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O157:H7 str. G5101]
 gi|320644753|gb|EFX13797.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O157:H- str. 493-89]
 gi|320652909|gb|EFX21147.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O157:H- str. H 2687]
 gi|320658297|gb|EFX26026.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320668920|gb|EFX35715.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323157986|gb|EFZ44088.1| outer membrane assembly complex, YaeT protein [Escherichia coli
           EPECa14]
 gi|323160203|gb|EFZ46162.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli E128010]
 gi|323165878|gb|EFZ51660.1| outer membrane assembly complex, YaeT protein [Shigella sonnei 53G]
 gi|323170969|gb|EFZ56618.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli LT-68]
 gi|323176492|gb|EFZ62084.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli 1180]
 gi|323181685|gb|EFZ67099.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli 1357]
 gi|323190423|gb|EFZ75698.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli RN587/1]
 gi|323380046|gb|ADX52314.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli KO11]
 gi|323935017|gb|EGB31390.1| outer membrane protein [Escherichia coli E1520]
 gi|323939947|gb|EGB36145.1| outer membrane protein [Escherichia coli E482]
 gi|323945654|gb|EGB41703.1| outer membrane protein [Escherichia coli H120]
 gi|323950824|gb|EGB46701.1| outer membrane protein [Escherichia coli H252]
 gi|323955138|gb|EGB50913.1| outer membrane protein [Escherichia coli H263]
 gi|323964930|gb|EGB60396.1| outer membrane protein [Escherichia coli M863]
 gi|323970656|gb|EGB65912.1| outer membrane protein [Escherichia coli TA007]
 gi|323975655|gb|EGB70751.1| outer membrane protein [Escherichia coli TW10509]
 gi|324008239|gb|EGB77458.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 57-2]
 gi|324014105|gb|EGB83324.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 60-1]
 gi|324017816|gb|EGB87035.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 117-3]
 gi|324118297|gb|EGC12192.1| outer membrane protein [Escherichia coli E1167]
 gi|326339768|gb|EGD63576.1| Outer membrane protein assembly factor YaeT precursor [Escherichia
           coli O157:H7 str. 1044]
 gi|326345102|gb|EGD68845.1| Outer membrane protein assembly factor YaeT precursor [Escherichia
           coli O157:H7 str. 1125]
 gi|327255156|gb|EGE66759.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli STEC_7v]
 gi|331051536|gb|EGI23585.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli M718]
 gi|331052290|gb|EGI24329.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli TA206]
 gi|331061466|gb|EGI33429.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli TA143]
 gi|331066629|gb|EGI38506.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli TA271]
 gi|331071528|gb|EGI42885.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli TA280]
 gi|331072219|gb|EGI43555.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli H591]
 gi|331081783|gb|EGI52944.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli H299]
 gi|332098783|gb|EGJ03743.1| outer membrane protein assembly complex, YaeT protein [Shigella
           boydii 3594-74]
 gi|332105203|gb|EGJ08549.1| outer membrane protein assembly factor yaeT [Shigella sp. D9]
 gi|332341510|gb|AEE54844.1| outer membrane protein assembly factor YaeT [Escherichia coli
           UMNK88]
 gi|332762025|gb|EGJ92296.1| outer membrane protein assembly complex, YaeT protein [Shigella
           flexneri 2747-71]
 gi|332765025|gb|EGJ95253.1| outer membrane protein assembly complex, YaeT protein [Shigella
           flexneri K-671]
 gi|333011016|gb|EGK30435.1| outer membrane protein assembly complex, YaeT protein [Shigella
           flexneri K-272]
 gi|333021811|gb|EGK41060.1| outer membrane protein assembly complex, YaeT protein [Shigella
           flexneri K-227]
 gi|333022227|gb|EGK41466.1| outer membrane protein assembly complex, YaeT protein [Shigella
           flexneri K-304]
          Length = 810

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|300923031|ref|ZP_07139098.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 182-1]
 gi|300420658|gb|EFK03969.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli MS 182-1]
          Length = 810

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 177/808 (21%), Positives = 318/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +         T     
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTTPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|331645320|ref|ZP_08346431.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli M605]
 gi|330910027|gb|EGH38537.1| outer membrane protein assembly factor YaeT precursor [Escherichia
           coli AA86]
 gi|331046077|gb|EGI18196.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli M605]
          Length = 810

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKISFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|320173342|gb|EFW48545.1| Outer membrane protein assembly factor YaeT precursor [Shigella
           dysenteriae CDC 74-1112]
          Length = 810

 Score =  399 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNKYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|117622462|ref|YP_851375.1| outer membrane protein assembly factor YaeT [Escherichia coli APEC
           O1]
 gi|166227557|sp|A1A7M1|YAET_ECOK1 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|115511586|gb|ABI99660.1| putative outer membrane protein [Escherichia coli APEC O1]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQARNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|168235003|ref|ZP_02660061.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|194443720|ref|YP_002039464.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194734363|ref|YP_002113247.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|205351561|ref|YP_002225362.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|226708915|sp|B5RHG2|YAET_SALG2 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708917|sp|B4SV06|YAET_SALNS RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|226708919|sp|B4TYD7|YAET_SALSV RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|194402383|gb|ACF62605.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194709865|gb|ACF89086.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197291808|gb|EDY31158.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|205271342|emb|CAR36135.1| outer membrane protein precursor [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326626588|gb|EGE32931.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 178/808 (22%), Positives = 316/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNSLSNME 540

Query: 555 EKEKIPSIY---------TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +                         + +    YN LD    P +G  I+ +    
Sbjct: 541 PQVAMWRYLASMGQYPSTNDQDNSFSTDDFTFNYGWTYNKLDRGYFPTEGTRINLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + +D   V  G  RFGYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDNDHKWVILGRTRFGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYYPYNPKNYDADEDYDCATQDGAKDMCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + E+    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISEKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|170683955|ref|YP_001742305.1| outer membrane protein assembly factor YaeT [Escherichia coli
           SMS-3-5]
 gi|226708908|sp|B1LGX9|YAET_ECOSM RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|170521673|gb|ACB19851.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli SMS-3-5]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 175/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    +N LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTFNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPYSPNGYDPSNDYACATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|333010672|gb|EGK30105.1| outer membrane protein assembly complex, YaeT protein [Shigella
           flexneri VA-6]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 316/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V  EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFREGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|332095116|gb|EGJ00148.1| outer membrane protein assembly complex, YaeT protein [Shigella
           boydii 5216-82]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGVKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|320180916|gb|EFW55838.1| Outer membrane protein assembly factor YaeT precursor [Shigella
           boydii ATCC 9905]
 gi|332762181|gb|EGJ92450.1| outer membrane protein assembly complex, YaeT protein [Shigella
           flexneri 4343-70]
 gi|333009146|gb|EGK28602.1| outer membrane protein assembly complex, YaeT protein [Shigella
           flexneri K-218]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDVGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|170768624|ref|ZP_02903077.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           albertii TW07627]
 gi|170122728|gb|EDS91659.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           albertii TW07627]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLHVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTANQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSNDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             +    R+S GV + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPGNIRMSAGVALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|82775567|ref|YP_401914.1| outer membrane protein assembly factor YaeT [Shigella dysenteriae
           Sd197]
 gi|309787149|ref|ZP_07681761.1| outer membrane assembly complex, YaeT protein [Shigella dysenteriae
           1617]
 gi|123563474|sp|Q32JT2|YAET_SHIDS RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|81239715|gb|ABB60425.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308924727|gb|EFP70222.1| outer membrane assembly complex, YaeT protein [Shigella dysenteriae
           1617]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 177/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +I+D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTINDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDVGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|146310379|ref|YP_001175453.1| outer membrane protein assembly factor YaeT [Enterobacter sp. 638]
 gi|166919051|sp|A4W6S2|YAET_ENT38 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|145317255|gb|ABP59402.1| surface antigen (D15) [Enterobacter sp. 638]
          Length = 805

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 175/803 (21%), Positives = 323/803 (40%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRQGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISTFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + SL +++ G LY+  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVEVSGNLAGHSAEIESLTKLQPGELYSGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+T+   +   + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDGIKKLLGRYGYAYPRVQTQPEINDTDKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVAGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGINGTKNDYQTYSEFSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +  S           +  PI E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSSYTNKSYGLDGTLGFPINEYNTLRAGLGYVHNDLSNMQ 540

Query: 555 EKEKIPSIYTTLIEHGK---------FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ +                + +    YN LD    P +G  ++ +    
Sbjct: 541 PQVAMWRYLDSIGQAASKSSDNNGFAADDFTFNYGWTYNRLDRGFFPTEGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++++++    + ++ + DD   V  G  R+GYG  +   K L  ++ F    +  
Sbjct: 601 VPGSDNEFYKLTLDTASYFPIDDDHKWVVLGRTRWGYGDGLG-GKELPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV--------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
           +RGF    IGP+                         A+GG     AS  +  P P + +
Sbjct: 660 VRGFQSNNIGPKAVYYGGNDKDNCNKTSSSEVCSSDDAVGGNAMGVASLEIITPTPFISD 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R +FF D+ T++  +    A           + S  R+S G+ + W SPLG + 
Sbjct: 720 KYANSVRTSFFWDAGTVWDTNWENTAQMKAAGVPDYSDPSNIRMSAGIALQWMSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GDK +QF F IG
Sbjct: 780 FSYAQPFKKYDGDKAEQFQFNIG 802


>gi|75421431|sp|Q9S341|YAET_PHOLU RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|5689866|emb|CAB51929.1| outer membrane antigen [Photorhabdus luminescens]
          Length = 797

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 188/795 (23%), Positives = 325/795 (40%), Gaps = 40/795 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG +A YG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSAAAYGADGFVVQDIHFEGLQRVAVGAALLNMPVRVGDTVSDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
             +  ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  RTIHALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASHVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   ++     ++  Y S+G  N  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTMLSNIERGLEDFYYSVGKYNASVKAVVTPLPRNRVDLKLVFAEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK++S   L     +R    +     D  Y K++++ D EA+R+FY DRGYA   +
Sbjct: 181 NIVGNKSFSSDELLNRFQLRDDVPWWNLTADQKYQKQKLTGDLEALRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +      +  +  L  I  G+LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTINMTEGDQYKISGIDLNGNMAGYQSEITKLAAIEPGSLYNGTQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +    I          + RV T+   +   + V +   ID G+  YV++I   GND +
Sbjct: 301 VTKMENDIKNLLGRYGYAYPRVMTQPEINDQDKTVKLHVNIDAGNRFYVRKIRFSGNDTT 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   E   +   ++E  K R+   GYF  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMERAWLGSDLVELGKERLNRLGYFETVDVETQRIPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +     +N+ G G    + A    ++              
Sbjct: 421 RNTGSLNFGVGFGTESGVSFQIGAQQDNWLGTGNAVGINASKNDYSTYAELSFTDPYFTI 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    E           +  +  PI E+ S +F  +        + 
Sbjct: 481 NGVSLGGRVFYNDFRADDAELSGYTNQSYGISGFLGFPINENNSLNFGLNYIHNSLSDML 540

Query: 555 EKEKIPSIYTTLIEH--------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ E          K    +++    YN LD    P  G+  + +     
Sbjct: 541 PQVAMWRYLRSMGEKPDLESKAEFKADDFALTMGWTYNNLDRGFFPTSGVKSTLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++++++    S +Y ++DD   V  G  R GYG  +   K L  ++ F    +  +
Sbjct: 601 PGSDNEFYKVTLDTSAYYPINDDRTWVILGRSRLGYGDGLG-GKELPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV-------------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRG 709
           RGF    IGP+                + A+GG   + AS  +  P P +  +    +R 
Sbjct: 660 RGFRSNNIGPKAIYLYKDGSPKKESPSRDAVGGNAMAVASLELITPTPFLDSKYSNSVRT 719

Query: 710 AFFVDSATLYANHVALG------ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
           +FF+DS T++                        RVS G+ + W SPLG +   Y  P++
Sbjct: 720 SFFIDSGTVWDTDWNDSAVMKSKGIPDYSKPGNIRVSAGIALQWMSPLGPLVFSYAKPIK 779

Query: 764 HREGDKIQQFGFRIG 778
             EGD+ +QF F IG
Sbjct: 780 DYEGDRSEQFQFNIG 794


>gi|168230532|ref|ZP_02655590.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|194469303|ref|ZP_03075287.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194455667|gb|EDX44506.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|205335046|gb|EDZ21810.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 177/808 (21%), Positives = 316/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIEKLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  PI E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNSLSNME 540

Query: 555 EKEKIPSIY---------TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +                         + +    YN LD    P +G  I+ +    
Sbjct: 541 PQVAMWRYLASMGQYPSTNDQDNSFSTDDFTFNYGWTYNKLDRGYFPTEGTRINLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + +D   V  G  RFGYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDNDHKWVILGRTRFGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYYPYNPKNYDADEDYDCATQDGAKDMCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + E+    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISEKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|332097595|gb|EGJ02572.1| outer membrane protein assembly complex, YaeT protein [Shigella
           dysenteriae 155-74]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDILKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|242240388|ref|YP_002988569.1| outer membrane protein assembly factor YaeT [Dickeya dadantii
           Ech703]
 gi|242132445|gb|ACS86747.1| outer membrane protein assembly complex, YaeT protein [Dickeya
           dadantii Ech703]
          Length = 807

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 183/805 (22%), Positives = 326/805 (40%), Gaps = 50/805 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG +++D D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVTDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L+I + ER  I  L FSGN ++K++ LK  +     R
Sbjct: 61  NIIRALFATGNFEDVRVLRDGNALLIQVKERPTIASLTFSGNKSVKEEMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EG+ AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYSATVKAVVTPLPRNRVDLKLVFTEGISAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK+++   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKSFNSDELISRFQLRDEVPWWNVVGDRKYEKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  +           +  L RI+ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLSGVVVRGDLAGHASEIEGLTRIQPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+   + + + V +   +D G+   V RI  EGND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPEINDSDKTVRLSINVDAGNRFTVHRIRFEGNDVS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGGWLGNDLVQQGKERLNRLGYFESVDVETQRVPGTPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGSLNFGIGFGTESGVSFQAGVQQDNWLGTGNSVGISGTRNAYQTYVELSMTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA-- 552
                       + +    +              +  PI E+ S     D          
Sbjct: 481 DGVSLGGRIFYNNFKAYDADLADYTNRSYGVGSTLGFPINENNSLRLALDYVHNDLSDMK 540

Query: 553 -----------ISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
                      +    ++ +   +   +   +   ++    YN LD    P  G   S +
Sbjct: 541 PQVGMWRYLDKVGTHPEVVTSSNSSTSNYAANDFFLTPGWTYNDLDRGYFPTAGNRASLN 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLL--SDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
                 G D++Y++    ++ ++ L  S +  ++   R GYG  +   K +  +D F   
Sbjct: 601 VKVTVPGSDNEYYKATFDSASYFPLTESKNWVLMARTRVGYGDGLG-GKEVPFYDNFFAG 659

Query: 660 SNYYLRGFAYKGIGPRVD------------------KKYAIGGKIYSSASAAVSFPMPLV 701
            +  +RGF    IGP+                       A+GG   + ASA    P P +
Sbjct: 660 GSSSVRGFRSNTIGPKAAYYQCSSSDSSYSTCPVSKSSDAVGGNAMAVASAEFIVPTPFI 719

Query: 702 PERA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGM 753
            ++    +R +FFVD+ T++  H    A  +             R+S+G+ + W SPLG 
Sbjct: 720 SDKYASSVRTSFFVDTGTVWDTHWENTAATIAAGIPDYSQPGNIRMSSGIAVQWMSPLGP 779

Query: 754 MGVYYGIPLRHREGDKIQQFGFRIG 778
           +   Y  P +  EGDK +QF F IG
Sbjct: 780 LVFSYAQPFKKHEGDKSEQFQFNIG 804


>gi|291614106|ref|YP_003524263.1| outer membrane protein assembly complex, YaeT protein [Sideroxydans
           lithotrophicus ES-1]
 gi|291584218|gb|ADE11876.1| outer membrane protein assembly complex, YaeT protein [Sideroxydans
           lithotrophicus ES-1]
          Length = 760

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 188/769 (24%), Positives = 331/769 (43%), Gaps = 19/769 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +   +A+   ++V       ++ I + G        + S +PV VG ++ D    
Sbjct: 1   MNLIKLAGLFALLYSTSVMAIEPFTIKDIRVEGIQRTEPGTVFSYLPVKVGDTMDDEHAT 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
            ++  ++A G+F +V++K   SVLI+ + ER  +  +  +G  +    QL   ++     
Sbjct: 61  ASLHALFATGFFKDVELKAEGSVLIVVVKERPTVASVEINGVKDFPKSQLLDNLKYVGLA 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
               +D+  +    + +K+ Y + G  +V+VK     +    + +++ +EEG  +KI  I
Sbjct: 121 EGRIFDKSALEKSENELKRQYIARGKYSVVVKTTVKDLERNRVAVSFNVEEGSASKIRLI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK YS   L   +       +  F K D YSK+++S D E++R FY + GY    +
Sbjct: 181 NIVGNKAYSEKDLLDTMQLTTPGWFSWFSKNDQYSKQKLSADMESLRTFYMNSGYMDFTI 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K    +   I EG+ YTV +I +  T   +  + +  LI I+ G++++  
Sbjct: 241 ESTQVSISPDKKDIFITLNISEGDKYTVSDIKVAGTQAVLSHEEMRKLIGIQPGDVFSRD 300

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            I ES+ KI +        F  V      D AK  V   +++D     Y++RI I GND+
Sbjct: 301 AITESTRKIGERLGEEGYAFANVNAAPEIDKAKHQVAFTFVVDPLQRAYIRRINITGNDK 360

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D VIRRE    EG     S I+++K+R+   G+FS+VN+   P     D + L + V 
Sbjct: 361 TRDEVIRREFRQMEGGWFATSKIKKSKQRLDRLGFFSDVNVDTSPVQGTGDQLDLNLKVA 420

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
           + S G+  I   Y   + + +   +  +N FG G              Q Y+ S  +PY+
Sbjct: 421 ERSTGNFSIGAGYSSLEKLTLMAGVTQSNVFGTGNSLSTQINTS-KLNQVYSVSYTNPYY 479

Query: 498 LGSPISAGFDLQKTHLE-----DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA 552
               IS GFD+ K               +   A VR  VPIT+     +         G 
Sbjct: 480 TDDGISRGFDVYKRRTNATQITVSQYTSDTYGAGVRYGVPITDDQMFHYGLSFEQTTIGL 539

Query: 553 ISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQ 612
            S   +    Y         +    +     +T D+ I   +G++ +S  + +    D +
Sbjct: 540 TSLSPQRFVDYINTFGPTNRNELG-TIGWSQDTRDSAIFTTEGVMQNSYIELSIPSSDQR 598

Query: 613 YHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGI 672
           Y++   +  +F+ LS    ++ +  FG          L  F  F       +RG+    +
Sbjct: 599 YYKWTYQNQWFHPLSRSFTLMTNANFGVAGGYG-GMPLPFFKNFYAGGVGSVRGYDPNSL 657

Query: 673 GPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEG 732
           GPR    Y++GG   +  +  + FPMP + +   LR + F+D   ++ +   +       
Sbjct: 658 GPRDINNYSLGGNKLAVGNIELLFPMPGMEKEKSLRLSAFLDGGEIFGSGGQVPGTD--- 714

Query: 733 NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                R STG+ + W SP G + + +  PL  +  DKIQ   F +G+  
Sbjct: 715 ---GMRYSTGLALTWFSPAGPLKLSWARPLNKQPQDKIQNLQFTLGSMF 760


>gi|307136777|ref|ZP_07496133.1| outer membrane protein assembly factor YaeT [Escherichia coli H736]
 gi|331640631|ref|ZP_08341779.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli H736]
 gi|331040377|gb|EGI12584.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli H736]
          Length = 810

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 318/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|194428310|ref|ZP_03060852.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli B171]
 gi|194413685|gb|EDX29965.1| outer membrane protein assembly complex, YaeT protein [Escherichia
           coli B171]
          Length = 810

 Score =  398 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 316/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV +I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVCKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|283783961|ref|YP_003363826.1| outer membrane protein assembly factor [Citrobacter rodentium
           ICC168]
 gi|282947415|emb|CBG86960.1| outer membrane protein assembly factor [Citrobacter rodentium
           ICC168]
          Length = 809

 Score =  398 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 180/807 (22%), Positives = 321/807 (39%), Gaps = 52/807 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + SL +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNVTEGDQYTLSGVQVSGNLAGHSAEIESLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGVGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYSELSITNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +            V +  PI E  +          +   + 
Sbjct: 481 DGVSLGGRIFYNDFRADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNRLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ ++               + +    YN LD    P +G  I+ +    
Sbjct: 541 PQLAMWRYLNSMGQYPDPTNDSNSFTADDFTFNYGWTYNKLDRGFFPTEGTRINLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + DD   V  G  R+GYG  I S K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDDDHKWVVLGRTRWGYGDGIGS-KEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV---------------------------DKKYAIGGKIYSSASAAVSF 696
           +RGF    IGP+                                A+GG   + AS     
Sbjct: 660 VRGFQSNTIGPKAVYLPASSRHDGDDDYDNECASTNTAPCQSDDAVGGNAMAVASLEFIT 719

Query: 697 PMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSPL 751
           P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SPL
Sbjct: 720 PTPFISDKYANSVRTSFFWDMGTVWDTNWDSSGYSGYPDYSDPSNIRMSAGIALQWMSPL 779

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P +  +GDK +QF F IG
Sbjct: 780 GPLVFSYAQPFKKYDGDKAEQFQFNIG 806


>gi|161504657|ref|YP_001571769.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189040682|sp|A9MPI4|YAET_SALAR RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|160866004|gb|ABX22627.1| hypothetical protein SARI_02778 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 810

 Score =  398 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 183/808 (22%), Positives = 321/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + +L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVEVSGNLAGHSAEIENLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +          + V +  PI E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGSDVTLGFPINEYNTLRAGVGYVHNSLSNME 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P +G  I+ +    
Sbjct: 541 PQVAMWRYLYSMGEHPNTDDQNNSFKTDDFTFNYGWTYNKLDRGFFPTEGTRINLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + DD   V  G  RFGYG      K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDDDHKWVILGRTRFGYGDGFG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHAASNYDPDDDYECATQDGAKDMCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + E+    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISEKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|300704223|ref|YP_003745826.1| outer membrane protein assembly factor, bacterial surface antigen
           domain (d15) [Ralstonia solanacearum CFBP2957]
 gi|299071887|emb|CBJ43216.1| putative outer membrane protein assembly factor, bacterial surface
           antigen domain (D15) [Ralstonia solanacearum CFBP2957]
          Length = 755

 Score =  398 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 160/763 (20%), Positives = 314/763 (41%), Gaps = 18/763 (2%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           +            +     +++ I + G   V    +   +PV VG++ +D     +++ 
Sbjct: 2   LAASVLTVCAGQAHAVEPFVIKDIRVEGVQRVEPGTVFGYLPVKVGETFTDDKGAESIRA 61

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAY 144
           +Y  G+F +V+I+   +VL++ + ER  I+ L F G      D L+  +       A  Y
Sbjct: 62  LYNTGFFKDVQIRAEGNVLVVRVEERPAISQLEFIGIKEFDKDTLRRSLRGVGVAEARYY 121

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
           D+  ++     +K+ Y S GY    V+     +    + +T+ ++EG  AKI  I  VGN
Sbjct: 122 DKSLIDRAEQELKRQYVSRGYYAADVQTTVTPVDANRVAVTFTVDEGPVAKIRQINIVGN 181

Query: 205 KNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL 263
           K +S   L   +     +    + K D+YSK++++ D EA+R+FY DRGY    + S  +
Sbjct: 182 KAFSEGDLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSFYLDRGYLEFAIESTQV 241

Query: 264 FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESS 323
                   + +            +    +     ++  +  LI+++ G++++  ++  ++
Sbjct: 242 SITPDKKDIYLTLNIHEGEQYKVSDIKLTGELLSKQAEMEKLIKLKQGDVFSSAKLSATT 301

Query: 324 EKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVI 383
           + I+    +    F  +  +   D   R V +  ++D G  +YV+R+ + GN ++ D V+
Sbjct: 302 KAITDLLGTYGYAFATINPQPQIDQKSRTVALTLVVDPGRRVYVRRVNVVGNSKTRDEVV 361

Query: 384 RRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS 443
           RRE+   E    +   ++ ++ RI  TGYF++ NI+       SD V + V+V +   G 
Sbjct: 362 RREMRQMESSWFDGEKLQLSQNRINRTGYFTDTNITTEDVPGTSDQVDVNVNVTEKPTGQ 421

Query: 444 VGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG---- 499
           + +   +     + +   I  +N FG G    L     +          +  + +     
Sbjct: 422 ISLGVGFSSTDKLVLSAGIRQDNVFGSGTSLGLDVNTSKSNRTIALTQYDPYFTVDGISR 481

Query: 500 -SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEK 558
            + +         +  D    I  +   ++  VP +E+ +  F            +    
Sbjct: 482 STELYYRTYRPLYYTGDQDYRIVQQGGNIKFGVPFSETDTVFFGIGYERTTIDVTANTPL 541

Query: 559 IPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
           +   Y         ++  I+     +  D+ +VP +G    ++ +    GGD QY+R   
Sbjct: 542 VYQNYVAKNGR-ISNNFPITIGWSKDQRDSALVPTRGRYQQANLEVGIPGGDLQYYRAYY 600

Query: 619 RASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDK 678
           +  YFY +S    +  +   GYG      K+  +F  +       +RG+    +GPR   
Sbjct: 601 QHQYFYPVSKSFTLAFNNEVGYGHGYG-GKDFPVFKNYYAGGIGSVRGYETSTLGPRDAN 659

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
             A+GG      +    FP+P       +R   F D   ++A                 R
Sbjct: 660 GVAVGGASKFVGNMEFIFPLPGSGVDRTVRLFTFFDYGNVFAEGQPFKV-------GDMR 712

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            STG  + W SP+G + +  G P++ +  D+ Q+F F+IG   
Sbjct: 713 YSTGFGLSWLSPIGPLKISMGFPIKKKAEDQTQRFQFQIGTAF 755


>gi|218688052|ref|YP_002396264.1| outer membrane protein assembly factor YaeT [Escherichia coli ED1a]
 gi|254807340|sp|B7MP37|YAET_ECO81 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|218425616|emb|CAR06402.1| outer membrane protein assembly factor [Escherichia coli ED1a]
          Length = 810

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDAVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|134277705|ref|ZP_01764420.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           305]
 gi|134251355|gb|EBA51434.1| outer membrane protein, OMP85 family [Burkholderia pseudomallei
           305]
          Length = 738

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 155/744 (20%), Positives = 316/744 (42%), Gaps = 17/744 (2%)

Query: 48  VRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLI 107
           V+ I+I G   V    + + +P+  G + +D     A++ +YA G+F++V+I    SV+I
Sbjct: 2   VQDIKIEGLQRVEAGSVFAYLPIKQGDTFTDDKASEAIRALYATGFFNDVRIATQGSVVI 61

Query: 108 IDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQAYASIG 164
           + + ER  I  + F+G      D L   ++         YD+  V+     +K+ Y + G
Sbjct: 62  VQVQERPAIASIDFTGIKEFDKDNLNKALKAVGLSQGRYYDKALVDKAEQELKRQYLTRG 121

Query: 165 YLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRTSGY 223
           +    V      +    ++I + + EG  AKI  I F+GNK +  + L   +     + +
Sbjct: 122 FYAAEVSTTVTPVDANRVSILFAVAEGPSAKIRQINFIGNKAFKTSTLRDEMQLSTPNWF 181

Query: 224 FSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIY 283
             + K D+YSKE+++ D E +R++Y +RGY    + S  +        + +         
Sbjct: 182 SWYTKNDLYSKEKLTGDLENVRSYYLNRGYLEFNIESTQVSISPDKKDMYLTVALHEGEP 241

Query: 284 TVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTR 343
              +    +     ++  L  L++I+ G+ ++ ++++++++ I          F  V  +
Sbjct: 242 YTVSSVKLAGNLLDRQAELEKLVKIKPGDRFSAEKLQQTTKAIVDKLGQYGYAFATVNAQ 301

Query: 344 INRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERA 403
              D A   V +  ++D    +YV+RI I GN ++ D V+RRE+   E    + S +  +
Sbjct: 302 PEIDQATHKVGLTLVVDPSRRVYVRRINIVGNTRTRDEVVRREMRQLESSWFDSSRLALS 361

Query: 404 KRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHID 463
           K R+   GYF++V+++ +P    +D V + V V +   G++ +   +     + +   I 
Sbjct: 362 KDRVNRLGYFTDVDVTTVPVEGTNDQVDVNVKVAEKPTGAITLGAGFSSTDKVVLSAGIS 421

Query: 464 DNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLEDGSL 518
            +N FG G    +     +         V+  + +      + +         +  + S 
Sbjct: 422 QDNVFGSGTSLAVNVNTAKSYRTLTVTQVDPYFTVDGIKRITDVFYRTYQPLYYSTNSSF 481

Query: 519 DINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSIS 578
            I      ++  +P +E+ +  F       +    S   +    Y         ++  ++
Sbjct: 482 RIITAGGNLKFGIPFSETDTVYFGAGFEQNRLDVDSNTPQSYQDYVNEFGR-VSNTVPLT 540

Query: 579 QSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRF 638
                +  D+ ++P +G    ++ +Y    G  QY+++  +  Y+Y  +    +  + + 
Sbjct: 541 IGWSRDARDSALIPSRGYFTQANAEYGVPVGKIQYYKMDVQGQYYYSFARGFILGLNFQA 600

Query: 639 GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAVSFP 697
           GYG  I +     +F  +       +RG+    +GPR       IGG      +  ++FP
Sbjct: 601 GYGNGIGN--PYPIFKNYYAGGIGSVRGYEPSSLGPRDTKTNDPIGGSKMVVGNIELTFP 658

Query: 698 MPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVY 757
           +P       LR   F+D   ++ N             +  R   G+ + W SP+G + + 
Sbjct: 659 LPGTGYDRTLRVFTFLDGGNVWGN----APGGTSTGANGLRYGYGIGLAWISPIGPLKLS 714

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
            G PL+  EGD+ Q+F F+IG   
Sbjct: 715 LGFPLQKHEGDQYQKFQFQIGTAF 738


>gi|157147391|ref|YP_001454710.1| outer membrane protein assembly factor YaeT [Citrobacter koseri
           ATCC BAA-895]
 gi|166227556|sp|A8ALB1|YAET_CITK8 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|157084596|gb|ABV14274.1| hypothetical protein CKO_03189 [Citrobacter koseri ATCC BAA-895]
          Length = 809

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 181/810 (22%), Positives = 322/810 (39%), Gaps = 58/810 (7%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + +L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIENLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYTELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  +               S
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNSL---S 537

Query: 555 EKEKIPSIYTTLIEHGKF------------SSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
             +   +++  L   G++            +  + +    YN LD    P +G  ++ + 
Sbjct: 538 NMQPQVAMWRYLNSMGEYPSNTNDRNSFSANDFTFNYGWTYNKLDRGFFPTEGTRVNLNG 597

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y++     + +  + DD   V  G  R+GYG  I   K +  ++ F    
Sbjct: 598 KVTIPGSDNEYYKATLDTATYVPIDDDHKWVVLGRTRWGYGDGIG-GKEMPFYENFYAGG 656

Query: 661 NYYLRGFAYKGIGPRV---------------------------DKKYAIGGKIYSSASAA 693
           +  +RGF    IGP+                                A+GG   + AS  
Sbjct: 657 SSTVRGFQSNTIGPKAVYYPASSRHDGDDDYDNDCKSTETAPCKSDDAVGGNAMAVASLE 716

Query: 694 VSFPMPLVPERA--GLRGAFFVDSATLYANHVALG---ADKLEGNDSFWRVSTGVEIMWN 748
              P P + ++    +R +FF D  T++  +             + S  R+S G+ + W 
Sbjct: 717 FITPTPFISDKYANSVRTSFFWDVGTVWDTNWDSNAYAGYPDYSDPSNIRMSAGIALQWM 776

Query: 749 SPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           SPLG +   Y  P +  +GDK +QF F IG
Sbjct: 777 SPLGPLVFSYAQPFKKYDGDKSEQFQFNIG 806


>gi|200389068|ref|ZP_03215680.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204926691|ref|ZP_03217893.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|199606166|gb|EDZ04711.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204323356|gb|EDZ08551.1| outer membrane protein assembly complex, YaeT protein [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|322616048|gb|EFY12965.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322620831|gb|EFY17691.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322623818|gb|EFY20655.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322627266|gb|EFY24057.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322630573|gb|EFY27337.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322638209|gb|EFY34910.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640694|gb|EFY37345.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322645522|gb|EFY42049.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648184|gb|EFY44651.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322657135|gb|EFY53418.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657505|gb|EFY53777.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663825|gb|EFY60025.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322666658|gb|EFY62836.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672184|gb|EFY68296.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676505|gb|EFY72576.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322679403|gb|EFY75448.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686270|gb|EFY82254.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323193450|gb|EFZ78658.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323197528|gb|EFZ82663.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323201203|gb|EFZ86272.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323209598|gb|EFZ94531.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323212150|gb|EFZ96974.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323216455|gb|EGA01181.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323223355|gb|EGA07690.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323225916|gb|EGA10136.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323228543|gb|EGA12672.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323236844|gb|EGA20920.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323239656|gb|EGA23703.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323242297|gb|EGA26326.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323249959|gb|EGA33855.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252389|gb|EGA36240.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323255672|gb|EGA39425.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262891|gb|EGA46441.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323265377|gb|EGA48873.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323271836|gb|EGA55254.1| outer membrane protein assembly factor YaeT [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 810

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 178/808 (22%), Positives = 317/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + +L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHSAEIENLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+++   + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGINGTKNDYQTYSELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNTLRAGLGYVHNSLSNME 540

Query: 555 EKEKIPSIY---------TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +                         + +    YN LD    P +G  I+ +    
Sbjct: 541 PQVAMWRYLASMGQYPSTNDQDNSFSTDDFTFNYGWTYNKLDRGYFPTEGTRINLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y++     + +  + +D   V  G  RFGYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKATLDTATYVPIDNDHKWVILGRTRFGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYYPYNPKNYDADEDYDCATQDGAKDMCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + E+    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISEKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|293476834|ref|ZP_06665242.1| outer membrane protein assembly complex [Escherichia coli B088]
 gi|291321287|gb|EFE60729.1| outer membrane protein assembly complex [Escherichia coli B088]
 gi|332768680|gb|EGJ98860.1| outer membrane assembly complex, YaeT protein [Shigella flexneri
           2930-71]
          Length = 808

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/806 (21%), Positives = 317/806 (39%), Gaps = 53/806 (6%)

Query: 25  MGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHA 84
           M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ + 
Sbjct: 1   MKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNT 60

Query: 85  VKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSA 141
           ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R  
Sbjct: 61  IRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVG 120

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
            + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I  
Sbjct: 121 ESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINI 180

Query: 202 VGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSS 260
           VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   + S
Sbjct: 181 VGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDS 240

Query: 261 QVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIK 320
             +        + +            +    S         +  L +I  G LYN  ++ 
Sbjct: 241 TQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVT 300

Query: 321 ESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYD 380
           +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S D
Sbjct: 301 KMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKD 360

Query: 381 SVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLS 440
           +V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+ +
Sbjct: 361 AVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERN 420

Query: 441 AGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPY 496
            GS      Y  + G+  +  +  +N+ G GY   +      +                 
Sbjct: 421 TGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDG 480

Query: 497 FLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
                     D Q    +            V +  PI E  S              +  +
Sbjct: 481 VSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQ 540

Query: 557 EKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
             +     ++ EH          K    + +    YN LD    P  G  ++ +      
Sbjct: 541 VAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIP 600

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  +R
Sbjct: 601 GSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSSTVR 659

Query: 666 GFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVSFP 697
           GF    IGP+                                 A+GG   + AS     P
Sbjct: 660 GFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITP 719

Query: 698 MPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSPLG 752
            P + ++    +R +FF D  T++  +             + S  R+S G+ + W SPLG
Sbjct: 720 TPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLG 779

Query: 753 MMGVYYGIPLRHREGDKIQQFGFRIG 778
            +   Y  P +  +GDK +QF F IG
Sbjct: 780 PLVFSYAQPFKKYDGDKAEQFQFNIG 805


>gi|320663607|gb|EFX30891.1| outer membrane protein assembly factor YaeT [Escherichia coli
           O55:H7 str. USDA 5905]
          Length = 810

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 175/808 (21%), Positives = 318/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDD--SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD    ++G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDRKWVVLGRTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|323526480|ref|YP_004228633.1| outer membrane protein assembly complex protein YaeT [Burkholderia
           sp. CCGE1001]
 gi|323383482|gb|ADX55573.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1001]
          Length = 770

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 158/774 (20%), Positives = 317/774 (40%), Gaps = 15/774 (1%)

Query: 18  YFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSIS 77
           + P  F    +I           + +   +V+ I I G   V    + + +P+  G + +
Sbjct: 2   FKPHRFVPKTVITAALAAHGLVAHATTPFVVQDIRIEGLQRVEPGTVFAYLPIKQGDTFT 61

Query: 78  DADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV- 136
           D     A++ +YA G+F++VKI    +V+I+ ++ER  I  + F+G +    + L   + 
Sbjct: 62  DDKASEAIRALYATGFFNDVKIATEGNVVIVQVLERPAIGTIDFAGIHEFDKENLTKALR 121

Query: 137 --RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
                    YD+  V+     +K+ Y + GY    V      I    +++ + + EG  A
Sbjct: 122 AVGLSQGRYYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVSVLFSVAEGPSA 181

Query: 195 KINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGY 253
           KI  I F+GNK +S   L   +     + +  + K D+Y+K++++ D E IR++Y +RGY
Sbjct: 182 KIRQINFIGNKAFSTGTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLENIRSYYLNRGY 241

Query: 254 AAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
               + S  +        + +            +    +     ++  L  LI+I+ G+ 
Sbjct: 242 LEFNIESTQVSITPDKKDMYLTVTLHEGEPYTISSIKLAGNLLDREPELAKLIKIKPGDR 301

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           ++ ++++ +++ I          F  V  +   D A   VD+   +D    +YV+RI + 
Sbjct: 302 FSAEKLQSTTKAIVDKLGEYGYAFATVNAQPQIDQANHKVDLTLQVDPSRRVYVRRINVV 361

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE+   E    + + +  +K RI   GYF++V+++ +P     D V + 
Sbjct: 362 GNTRTRDEVVRREMRQLESSWFDSNRLALSKDRINRLGYFTDVDVTTVPVEGTPDQVDVD 421

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V +   G++ +   +     + +   +  +N FG G    +     +         V+
Sbjct: 422 VKVAEKPTGAITLGAGFSSTDKVVLSAGVSQDNVFGSGTSLSVNVNTAKTYRTLTVTQVD 481

Query: 494 DPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
             + +      + +         +  D S  I      ++  +P +E  +  F   L   
Sbjct: 482 PYFTVDGIKRITDVYYRTYQPLYYSTDSSFKIVTMGGDLKFGIPFSEVDTVYFGAGLEQN 541

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
           +    +        Y         ++  ++     +  D+ +VP +G    ++ +Y    
Sbjct: 542 KLDVDANTPASYKQYVQDFGR-VSNNVPVTVGWSRDARDSALVPSRGYFTQANAEYGTPI 600

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           G +QY++    A Y+Y  +    +  + +          K   +F  +       +RG+ 
Sbjct: 601 GGTQYYKADINAQYYYSFARGFVLGFNFQG-GYGKGMGGKPYPIFKNYYAGGIGSVRGYE 659

Query: 669 YKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
              +GPR       IGG      +  ++FP+P       LR   F+D+  ++A      +
Sbjct: 660 PSSLGPRDKTTGDPIGGSKLLVGNIELTFPLPGTGYDRTLRVFTFLDAGNVWA---DASS 716

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                  +  R   GV + W SP+G + +  G PL    GD+ Q+F F+IG   
Sbjct: 717 AATSNGANGLRYGYGVGLAWISPIGPLKLSLGFPLTKHTGDQYQKFQFQIGTAF 770


>gi|261344728|ref|ZP_05972372.1| outer membrane protein assembly complex, YaeT protein [Providencia
           rustigianii DSM 4541]
 gi|282567170|gb|EFB72705.1| outer membrane protein assembly complex, YaeT protein [Providencia
           rustigianii DSM 4541]
          Length = 804

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 191/802 (23%), Positives = 335/802 (41%), Gaps = 47/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   + G +  YGS+  +V+ I   G   V     L  +PV VG S+ + D+ 
Sbjct: 1   MAMKKLLIASLLLGSATAYGSDGFVVKDIRFEGLQRVAVGAALLNMPVRVGDSVDNDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++++++ G F +V++    + LI+ + ER  I  + F+GN ++KDD LK  +     R
Sbjct: 61  RSIRSLFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFTGNKSVKDDMLKQNLEASNVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   +      ++  Y S+G  N  VK     +    +++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTKIANIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKFVFSEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNKNY  A L   + +R    +     D  Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKNYPTAELVNKLQLRDDVPWWNLAADQKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         +  LI I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKDIYITINITEGDQYKISGVEVNGNTAEHLADIKELITITPGELYNGAQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +   KI   F      + RV T+   + A + V +   +D G+  YV++I  +GND S
Sbjct: 301 VTQMENKIKDLFGRYGYAYPRVMTQPEINDADKTVKLHVNVDAGNRFYVRQIRFQGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E  K R+  TG+F  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDLVELGKERLNRTGFFETVDVETQRIPGSADQVDVIYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +  +  +N+ G G    + A    ++              
Sbjct: 421 RNTGSMNFGVGFGTESGVSFQVGVTQDNWLGTGNAVGINASRNDYSTNVEFSMTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +    +         +  P  E+ S              + 
Sbjct: 481 NGVSLGGRIFYNDFSAKDADLSGYNNKTYGLDSFLSFPFNENNSFRVGAGYVHNDLSDMR 540

Query: 555 EKEKIPSIYTTLIEH------------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
            +  +     ++ ++             +    +++    YN+L+    P  G   S S 
Sbjct: 541 AQAAMWDYLDSMGQNPPVTADGRNKESFRADDFTLNVGWTYNSLNRGFFPTSGNKTSVSG 600

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y+++    +++Y ++DD   V  G  + GYG  I S K +  ++ F    
Sbjct: 601 KVTVPGSDNEYYKLRFDTAHYYPINDDETWVVLGRAQAGYGDGIGS-KQMPFYENFYAGG 659

Query: 661 NYYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLVPER 704
           +  +RGF    IGP+                     A+GG    +AS  +  P P + E+
Sbjct: 660 SSSIRGFRSNNIGPKAVYLKSVNGVAVPEPGSPSSDAVGGNAMYTASFELITPTPFIDEK 719

Query: 705 A--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGV 756
               +R + FVD+ T++  +      +        GN +  RVSTG+ + W SPLG +  
Sbjct: 720 YANTIRTSLFVDAGTVWDTNWNSINPEWRKGMPDYGNATNVRVSTGLALQWISPLGPLVF 779

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P++  EGDK +QF F IG
Sbjct: 780 SYAQPIKDYEGDKSEQFQFNIG 801


>gi|212710389|ref|ZP_03318517.1| hypothetical protein PROVALCAL_01449 [Providencia alcalifaciens DSM
           30120]
 gi|212686971|gb|EEB46499.1| hypothetical protein PROVALCAL_01449 [Providencia alcalifaciens DSM
           30120]
          Length = 804

 Score =  397 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 192/802 (23%), Positives = 329/802 (41%), Gaps = 47/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   + G +  YGS+  +V+ I   G   V     L  +PV VG SI + D+ 
Sbjct: 1   MAMKKLLIASLLLGSATAYGSDGFVVKDIRFEGLQRVAVGAALLNMPVRVGDSIDNEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++++++ G F +V++    + LI+ + ER  I  + F+GN ++KDD LK  +     R
Sbjct: 61  RSIRSLFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFTGNKSVKDDMLKQNLEASNIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   +      ++  Y S+G  N  VK     +    +++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTKIANIEKGLEDFYYSVGKYNATVKAVVTPLPRNRVDLKFVFSEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNKNYS A L   + +R    +     D  Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKNYSTAELVNKLQLRDDVPWWNLAADQKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +         +  LI I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKDIYITINVTEGDQYKISGVDVNGNTAEHLADIQELITITPGELYNGAQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +   +I   F      + RV T+   + A + V +   +D G+  YV++I  +GND S
Sbjct: 301 VTQMENQIKDLFGRYGYAYPRVMTQPEINDADKTVKLHVNVDAGNRFYVRQIRFQGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E  K R+  TG+F  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDLVELGKERLNRTGFFETVDVETQRIPGSPDQVDVIYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +  +  +N+ G G    + A    ++              
Sbjct: 421 RNTGSMNFGVGFGTESGVSFQVGVTQDNWLGTGNAVGINASRNDYSTNVEFSMTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +    +         +  P  E+ S              + 
Sbjct: 481 NGVSLGGRIFYNDFSAKDADLSGYNNKTYGLDSTLSFPFNENNSFRIGAGYVHNDLSDMR 540

Query: 555 EKEKIPSIYTTL------------IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSY 602
            +  +     ++             E  +    +++    YN+L+    P  G   S S 
Sbjct: 541 AQAAMWDYLQSMGENPPVTKDGRNKESFRADDFTLNLGWTYNSLNRGFFPTSGNKTSVSG 600

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSS 660
                G D++Y+++    + +  L+DD   V  G  + GYG  I S K +  ++ F    
Sbjct: 601 KVTIPGSDNEYYKLRFDTAQYLPLNDDETWVVLGRAQAGYGDGIGS-KQMPFYENFYAGG 659

Query: 661 NYYLRGFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLVPER 704
           +  +RGF    IGP+                     A+GG    + S  +  P P V E+
Sbjct: 660 SSTIRGFRSNNIGPKAVYLKNINGKDGPEPGSPSSDAVGGNAMYAGSFELITPTPFVDEK 719

Query: 705 A--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGV 756
               +R + FVD+ T++  +               G  +  RVSTG+ + W SPLG +  
Sbjct: 720 YANTIRTSLFVDAGTVWDTNWNSINPAWRAGMPDYGTATNVRVSTGIALQWISPLGPLVF 779

Query: 757 YYGIPLRHREGDKIQQFGFRIG 778
            Y  P++  EGDK +QF F IG
Sbjct: 780 SYAQPIKDYEGDKSEQFQFNIG 801


>gi|307729339|ref|YP_003906563.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1003]
 gi|307583874|gb|ADN57272.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. CCGE1003]
          Length = 770

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 156/774 (20%), Positives = 316/774 (40%), Gaps = 15/774 (1%)

Query: 18  YFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSIS 77
           + P  F    +I           + +   +V+ I I G   V    + + +P+  G + +
Sbjct: 2   FKPHRFVPKTVITAALAAHGLVAHATTPFVVQDIRIEGLQRVEPGTVFAYLPIKQGDTFN 61

Query: 78  DADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV- 136
           D     A++ +YA G+F++VKI    +V+I+ ++ER  I  + F+G +    + L   + 
Sbjct: 62  DDKASEAIRALYATGFFNDVKIATEGNVVIVQVLERPAIGTIDFAGIHEFDKENLTKALR 121

Query: 137 --RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
                    YD+  V+     +K+ Y + GY    V      I    +++ + + EG  A
Sbjct: 122 AVGLSQGRYYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVSVLFSVAEGPSA 181

Query: 195 KINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGY 253
           KI  I F+GNK +S   L   +     + +  + K D+Y+K++++ D E IR++Y +RGY
Sbjct: 182 KIRQINFIGNKAFSTGTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLENIRSYYLNRGY 241

Query: 254 AAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
               + S  +        + +            +    +     ++  L  LI+I+ G+ 
Sbjct: 242 LEFNIESTQVSITPDKKDMYLTVTLHEGEPYTISSIKLAGNLLDREPELAKLIKIKPGDR 301

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           ++ ++++ +++ I          F  V  +   D     VD+   +D    +YV+RI + 
Sbjct: 302 FSAEKLQSTTKAIVDKLGEYGYAFATVNAQPQIDQTNHKVDLTLQVDPSRRVYVRRINVV 361

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE+   E    + + +  +K RI   GYF++V+++ +P     D V + 
Sbjct: 362 GNTRTRDEVVRREMRQLESSWFDSNRLALSKDRINRLGYFTDVDVTTVPVEGTPDQVDVD 421

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V +   G++ +   +     + +   +  +N FG G    +     +         V+
Sbjct: 422 VKVAEKPTGAITLGAGFSSTDKVVLSAGVSQDNVFGSGTSLAVNVNTAKTYRTLTVTQVD 481

Query: 494 DPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
             + +      + +         +  D S  I      ++  +P +E  +  F   L   
Sbjct: 482 PYFTVDGIKRITDVYYRTYQPLYYSTDSSFKIVTMGGDLKFGIPFSEVDTVYFGAGLEQN 541

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
           +    +        Y         ++  ++     +  D+ +VP +G    ++ +Y    
Sbjct: 542 KLDVDANTPASYKQYVQDFGR-VSNNVPVTVGWSRDARDSALVPSRGYFAQANAEYGTPI 600

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           G +QY++    A Y+Y  +    +  + +          K   +F  +       +RG+ 
Sbjct: 601 GSTQYYKADINAQYYYSFARGFVLGFNFQG-GYGKGMGGKPYPIFKNYYAGGIGSVRGYE 659

Query: 669 YKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
              +GPR       IGG      +  ++FP+P       LR   F+D+  ++A      +
Sbjct: 660 PSSLGPRDKTTGDPIGGSKLLVGNIELTFPLPGTGYDRTLRVFTFLDAGNVWA---DASS 716

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                  +  R   G+ + W SP+G + +  G PL    GD+ Q+F F+IG   
Sbjct: 717 AATSNGANGLRYGYGLGLAWISPIGPLKLSLGFPLTKHTGDQYQKFQFQIGTAF 770


>gi|150396357|ref|YP_001326824.1| surface antigen (D15) [Sinorhizobium medicae WSM419]
 gi|150027872|gb|ABR59989.1| surface antigen (D15) [Sinorhizobium medicae WSM419]
          Length = 777

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 269/778 (34%), Positives = 433/778 (55%), Gaps = 5/778 (0%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   R L      +     +     +  +++   +  +++ R+E+RGAT V  E + + 
Sbjct: 1   MKAGSRFLNAVSAFALSASMVATGTGVGLVASTSVAQAAVINRVEVRGATRVSAETVRAN 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           I +V G+S S+AD+D +VK +YA GYFS+V I +    L++ + E +++N + F+GN  +
Sbjct: 61  ITIVPGKSFSNADIDASVKRLYATGYFSDVSITVSGGSLVVSVSENQLVNQVVFNGNRKI 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KDD+L+ IVR++    Y E TV  D+  I+ AY++IG  +V V  Q   I+   +N+ +V
Sbjct: 121 KDDKLQGIVRTQPLGPYSEATVETDIQAIRDAYSAIGRSDVTVTTQVVPIAEGRVNLAFV 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRA 246
           I EG + KI  I FVGN+ YS  RL+ VI+ + SG FSF  + DVY+ +++  DEE +R 
Sbjct: 181 INEGERTKITQINFVGNEAYSDGRLQSVIATKESGIFSFLTRKDVYNPDKLRADEELLRQ 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++RG+A  +V S      +  + Y +   ++EG  Y  G ++I+ST++ +  + L  L
Sbjct: 241 FYYNRGFADFQVVSSEAALNEATNEYTVTITVEEGPRYDFGPVNIESTVEGVDAEELRGL 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           ++   G++Y  ++I+ +  +ISK   S   PF RV  R NRD A   + ++YL+DQG   
Sbjct: 301 VQSHEGSVYKAKDIQSTMSEISKRVASEGYPFARVTPRGNRDLANHTIAVDYLVDQGERA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RIEI GN ++ D VIRRE ++ EGD  N  M+ RAKRR+ A GYFS VNIS  P + 
Sbjct: 361 YVERIEIRGNTRTRDYVIRREFDVGEGDAFNQEMVARAKRRLEALGYFSSVNISTTPGSA 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
               +I+     Q +      A     D G  +     +   F    +    A       
Sbjct: 421 ADRVIIVVDVQDQSTGSFGIGAGYSAGDGGGFLVEASIEEKNFLGRGQYIRLAAGKGEDS 480

Query: 486 QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
           Q Y  S  +PYFLG  ++AGFDL K   +    + +       + V    + + S     
Sbjct: 481 QTYNVSFTEPYFLGYRLAAGFDLFKNENDFDDDNYSYNDQGFSLRVTAPITENLSTTLRY 540

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            + +     + +++ S Y  +++ G ++  SISQSI YNTLD+  +P +G+L S + ++A
Sbjct: 541 NYTELEYFGDTDELSSPYDRVVDGGTWTRSSISQSITYNTLDDAQLPHEGILASVTQEFA 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G GG S ++++  +A ++Y L D++DI+GSL    G +  ++  L++FDQF +  +  +R
Sbjct: 601 GLGGTSDFYKLTGKAKWYYTLHDEADIIGSLAGSAGHLFKTSGTLEVFDQFQLG-SNDIR 659

Query: 666 GFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAL 725
           GF   G+GPRV+   A+GG  Y +ASA  +FP+P +P  +G RGA FVD+ TLY N + L
Sbjct: 660 GFERNGVGPRVNNGDALGGTTYFTASAEATFPLPGLPRDSGFRGALFVDAGTLYDNDLEL 719

Query: 726 GAD--KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                 + GND+  R S GV ++W SP G + V Y +P+   + D+IQ F F I +  
Sbjct: 720 TGPGESVRGNDASLRASVGVSLIWASPFGPLRVDYAVPVAKEDFDEIQNFKFGINSSF 777


>gi|261338825|ref|ZP_05966683.1| hypothetical protein ENTCAN_05020 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318648|gb|EFC57586.1| outer membrane protein assembly complex, YaeT protein [Enterobacter
           cancerogenus ATCC 35316]
          Length = 805

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 178/803 (22%), Positives = 327/803 (40%), Gaps = 48/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRPGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T++     ++  Y S+G  +  VK     +    +++  V +EGV AKI  I
Sbjct: 121 VGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L           +++      Y K++++ D E +R++Y DRGYA   +
Sbjct: 181 NIVGNHAFSTDELISTFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         + SL +I+ G+LY+  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGEQYKLSGVEVSGNLAGHSAEIESLTKIQPGDLYSGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV+T+   + A++ V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDSIKKLLGRYGYAYPRVQTQPEINDAEKTVKLHVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +   +           
Sbjct: 421 RNTGSFNFGVGYGTESGVSFQVGVQQDNWLGTGYSVGINGTKNDYQTYSEFSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +  S           +  P+ E  +              + 
Sbjct: 481 DGVSLGGRIFYNDFKADDADLSSYTNKSYGVDGTLGFPVNEYNTLRAGLGYVHNDLSNMQ 540

Query: 555 EK-------EKIPSIYTTLIEHGKF--SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +       + I    +   ++  F     + +    YN LD    P +G  ++ +    
Sbjct: 541 PQVAMWRYLDSIGQSASKSSDNNGFAADDFTFNYGWTYNRLDRGFFPTQGSRVNLNGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++++++    + ++ + DD   V  G  R+GYG  +   K L  ++ F    +  
Sbjct: 601 IPGSDNEFYKVTLDTASYFPIDDDHKWVVLGRTRWGYGDGLG-GKELPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPR--------------------VDKKYAIGGKIYSSASAAVSFPMPLVPE 703
           +RGF    IGP+                         A+GG     AS     P P + +
Sbjct: 660 VRGFQSNNIGPKAVYYGGNDKDNCYKSSSSEVCSSDDAVGGNAMGVASLEFITPTPFISD 719

Query: 704 RA--GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMG 755
           +    +R + F D+ T++  +    A           + S  R+S G+ + W SPLG + 
Sbjct: 720 KYANSVRTSIFWDAGTVWDTNWENTAQMRAAGVPDYSDPSNIRMSAGIALQWMSPLGPLV 779

Query: 756 VYYGIPLRHREGDKIQQFGFRIG 778
             Y  P +  +GDK +QF F IG
Sbjct: 780 FSYAQPFKKYDGDKAEQFQFNIG 802


>gi|30249672|ref|NP_841742.1| surface antigen (D15) [Nitrosomonas europaea ATCC 19718]
 gi|30180709|emb|CAD85621.1| Bacterial surface antigen (D15) [Nitrosomonas europaea ATCC 19718]
          Length = 758

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 179/768 (23%), Positives = 319/768 (41%), Gaps = 19/768 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++ F+ILF++++ L  +  +++ +VR I + G        + S +PV VG  +      
Sbjct: 1   MKLRFLILFFSLYSLGCM-ANDSLVVRDIRVEGIQRTEAGTVFSYLPVKVGDVLDSKKAS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
            A+K +YA G+FS+VK+K    +LI+ + ER  I  +  +G      D+LK  ++     
Sbjct: 60  AAIKALYATGFFSDVKLKSEGGLLIVQVQERPAIAQISINGAKEFDKDKLKEGLKQAGLS 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +    +      +K+ Y S G   V +      +    + I + I+EG  A+I  I
Sbjct: 120 ESRIFSRSLLEKAEQELKRQYISRGKYAVKITTTTTPLERNRIGINFDIKEGKTARIKQI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +    L  + S         F K D YSK+++S D E +R++Y DRGY    +
Sbjct: 180 NIVGNHVFPEDDLVDLFSLKTPGFMTWFTKDDQYSKQKLSADLETLRSYYLDRGYLEFNI 239

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +    + ++ L  LI++  G ++  ++
Sbjct: 240 ESTQVSITPDMKDIYITVNVTEGPQYTVSDIKLAGELLVPEEELRKLIKLEPGGIFVREK 299

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + ES + IS    +    F  V      D   R     + ID G  +YV+RI I GN+++
Sbjct: 300 LTESIKLISDRLGNDGYAFANVNASPELDKETRKTAFTFFIDPGRRVYVRRINISGNERT 359

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D VIRRE    EG   +   I R+++R+    +F+ VNI   P  DV D V + V+V +
Sbjct: 360 RDEVIRREFRQMEGGWHSTEQINRSRQRVDRLDFFTGVNIETPPVADVPDQVDINVNVVE 419

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF---GRHAVQNYTFSVEDP 495
              G++     Y   +G+ + G I  NN  G G    L        +    ++       
Sbjct: 420 KPTGAIMFGAGYSDREGIILNGSIAQNNILGTGNFLSLQVNTGSVNKVISASFNNPYYTI 479

Query: 496 YFLGSPISAGFDLQKTHLEDG--SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
             +   + A      T         + +   A +R  +P+ E+   S        +    
Sbjct: 480 NGVSLGLEAFKRDINTRSLSSVGMFNTDTTGANIRFGIPVAENDIVSLGLGYEHTKIDLR 539

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            +  +    +         ++  I+ S   +  ++ I    GM      ++    GD  Y
Sbjct: 540 DDSPQRFKDFVDQFGK-TSNNLPITLSWARDRRNSAIWTTSGMTQRLFGEFGLPFGDLNY 598

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +++     +F+ ++    ++ +   G G    S+K L  F  F       +RG+    +G
Sbjct: 599 YKVSYEQRWFFPVTKMFTLMLNGEVGVGDGY-SDKPLPFFKNFFAGGFNSVRGYNINTLG 657

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           PR      +GG      +  V FP+P + E   +R + F D  T+  +   LG D     
Sbjct: 658 PRDSDDRVLGGSKRIVGNIEVLFPVPFMKEDKSVRLSAFADGGTIVNSFSGLGFDD---- 713

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
              +R S G+   W SP+G +      PL ++ GDK+Q+F F+ G   
Sbjct: 714 ---FRYSAGLAATWISPMGPLKFSVAQPLNNQSGDKLQRFQFQFGQTF 758


>gi|187928375|ref|YP_001898862.1| outer membrane protein assembly complex, YaeT protein [Ralstonia
           pickettii 12J]
 gi|187725265|gb|ACD26430.1| outer membrane protein assembly complex, YaeT protein [Ralstonia
           pickettii 12J]
          Length = 765

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 160/768 (20%), Positives = 315/768 (41%), Gaps = 18/768 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           F +  +            +     +V+ I + G   V    +   +PV VG++ +D    
Sbjct: 7   FPLSVLAASVLTVTAGQAHAVEPFVVKDIRVEGVQRVEPGTVFGYLPVKVGETFTDEKGA 66

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++ +Y  G+F +V+I+   +VL++ + ER  I+ L F G      + L+  +      
Sbjct: 67  ESIRALYNTGFFKDVQIRSEGNVLVVRVEERPAISQLEFIGFKEFDKEALRRTLRGVGVA 126

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            A  YD+  ++     IK+ Y S GY    V      +    ++IT+ ++EG  AKI  I
Sbjct: 127 EARYYDKSLIDRAEQEIKRQYVSRGYYAAEVTTTVTPVDANRVSITFTVDEGPTAKIRQI 186

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +    L   +     +    + K D+YSK++++ D EA+R+FY DRGY    +
Sbjct: 187 NIVGNKAFKEGDLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSFYLDRGYLEFAI 246

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +     ++  +  LI+++ G++++  +
Sbjct: 247 ESTQVSITPDKKDIYLTLNIHEGEQYKVSDIKLTGELLGKQAEMEKLIKLKQGDVFSSAK 306

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  +++ I+    +    F  +  +   +   R V +  ++D G  +YV+R+ + GN ++
Sbjct: 307 LSSTTKSITDLLGTYGYAFATINPQPQINQKDRTVALTLVVDPGRRVYVRRVNVVGNSKT 366

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   E    +   ++ ++ R+  TGYF++ NI+       +D V + V+V +
Sbjct: 367 RDEVVRREMRQMEASWFDGEKLQLSQNRVNRTGYFTDANITTEDVPGTTDQVDVNVNVTE 426

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
              G + +   +     + +   I  +N FG G    L     +          +  + +
Sbjct: 427 KPTGQINLGVGFSSTDKLVLSAGIRQDNVFGSGTSLGLDVNTSKSNRTIAVTQFDPYFTV 486

Query: 499 G-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                 + +         +  D    +  +   V+  VP +E+ +  F           +
Sbjct: 487 DGISRSTELYYRTYRPLYYTGDQDYRVVQQGGNVKFGVPFSETDTVFFGIGYERTTI-DV 545

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           +    +             ++  I+     +  D+ +VP +G    ++ ++   GGD QY
Sbjct: 546 TTNTPLAYQNYVAKNGRITNNFPITIGWSKDQRDSALVPTRGRYQQANLEFGIPGGDLQY 605

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            R   +  YFY LS    +  +   GYG      K+  +F  +       +RG+    +G
Sbjct: 606 FRAYYQHQYFYPLSKSFTMAFNNEIGYGHGYG-GKDFPVFKNYYAGGIGSVRGYETSTLG 664

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           PR     AIGG      +    FP+P       +R   F D   ++A             
Sbjct: 665 PRDANGVAIGGASKFVGNVEFIFPLPGSGVDRTVRLFTFFDYGNVFAEGQPYKL------ 718

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R STG  + W SP+G + +  G P++ +  D+ Q+F F+IG   
Sbjct: 719 -GDMRYSTGFGLSWLSPIGPLKISMGFPIKRKTQDQTQRFQFQIGTAF 765


>gi|253988133|ref|YP_003039489.1| outer membrane protein assembly factor YaeT [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779583|emb|CAQ82744.1| outer membrane protein assembly factor yaet precursor [Photorhabdus
           asymbiotica]
          Length = 797

 Score =  396 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 189/795 (23%), Positives = 328/795 (41%), Gaps = 40/795 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG +  YG+N  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATAYGANGFVVQDIHFEGLQRVAVGAALLNMPVRVGDTVSDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
             ++ ++A G F +V++    + LI+ + ER  I ++ FSGN ++KDD LK  +     R
Sbjct: 61  RTIQALFATGNFEDVRVLRDGNTLIVQVKERPTIANITFSGNKSVKDDMLKQNLEASHVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   ++     ++  Y S+G  N  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTMLSNIEKGLEDFYYSVGKYNASVKAVVTPLPRNRVDLKLVFAEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK++S   L     +R    +     D  Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKSFSSDELLNRFQLRDDIPWWNLTADQKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +      +  +  L  I  G+LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTLNITEGDQYKISGIDLNGNMAGYQSEITKLATIEPGSLYNGTQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +   +I          + RV T+   +   + V +   ID G+  YV++I   GND S
Sbjct: 301 VTKMESEIKNLLGRYGYAYPRVMTQPEINDQDKTVKLHVNIDAGNRFYVRKIRFSGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E  K R+   GYF  V++        SD V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSDLVELGKERLNRLGYFETVDVETQRIPGSSDQVDIVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +     +N+ G G    + A    ++              
Sbjct: 421 RNTGSMNFGIGFGTESGVSFQIGAQQDNWLGTGNSVGINASKNDYSTYAELSFTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    +              +  P+ E+ S +F+          + 
Sbjct: 481 NGVSLGGRVFYNDFRADDADLSGYTNKTYGLDGFLGFPVNENNSLNFRLGYVHNSLSDML 540

Query: 555 EKEKIPSIYTTLIEHGKF--------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ E   +           +++    YN LD    P  G+  + +     
Sbjct: 541 PQAAMWRYLNSMGEKPDYEKKAEFKADDFALTMGWTYNNLDRGFFPTSGVKSTLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D+++++I      +Y ++D    V  G  R GYG  +   K L  ++ F    +  +
Sbjct: 601 PGSDNKFYKITLDTFAYYPINDARTWVILGRGRLGYGDGLG-GKELPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV-------------DKKYAIGGKIYSSASAAVSFPMPLV--PERAGLRG 709
           RGF    IGP+                + AIGG   + AS  +  P P +       +R 
Sbjct: 660 RGFRSNNIGPKAIYLDKNGDPKKDSPSRDAIGGNAMAVASLELITPTPFLDGKYSNSVRT 719

Query: 710 AFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
           +FF+DS T++  + +  A                RVSTG+ + W SPLG +   Y  P++
Sbjct: 720 SFFIDSGTVWDTNWSDSATMRDRGIPDYSKPGNIRVSTGIALQWLSPLGPLVFSYAKPIK 779

Query: 764 HREGDKIQQFGFRIG 778
             EGD+ +QF F IG
Sbjct: 780 DYEGDRSEQFQFNIG 794


>gi|114331993|ref|YP_748215.1| surface antigen (D15) [Nitrosomonas eutropha C91]
 gi|114309007|gb|ABI60250.1| surface antigen (D15) [Nitrosomonas eutropha C91]
          Length = 758

 Score =  396 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 177/768 (23%), Positives = 317/768 (41%), Gaps = 19/768 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            +  F  LF+ ++ +     +++ +V+ I + G        I S +PV VG  +      
Sbjct: 1   MKFRFYALFFFLYSIGCA-ANDSFVVKDIRVEGIQRTEAGTIFSYLPVKVGDVLDSKKAS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
            A+K +YA G+FS+VK+K    +LI+ + ER  I  +  +G      D+LK  ++     
Sbjct: 60  AAIKALYATGFFSDVKLKSEGELLIVQVQERPAIAQITINGAKEFDKDKLKEGLKQAGLS 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +    +      +K+ Y S G   V +      +    + I + I+EG  A+I  I
Sbjct: 120 ESRIFSRSLLEKAEQELKRQYISRGKYAVKITTTTTPLERNRIGINFDIKEGKTARIKQI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +    L  + S         F K D YSK+++S D E +R++Y DRGY    +
Sbjct: 180 NIVGNHVFPEDDLTGLFSLKTPGFMTWFTKDDQYSKQKLSADLETLRSYYLDRGYLEFNI 239

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    +    + ++ L  LI++  G ++  ++
Sbjct: 240 ESTQVSITPDMKDIYITVNVTEGPQYTVSDIKLAGELLVPEEELRKLIKLEPGGVFVREK 299

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + ES + IS    +    F  V      D   R     + ID G  +YV+RI I GN+++
Sbjct: 300 LTESIKLISDRLGNDGYAFANVNASPELDKETRKTAFTFFIDPGRRVYVRRINISGNERT 359

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D VIRRE    EG   +   I R+++R+    +F+ VN+   P  DV D V + V+V +
Sbjct: 360 RDEVIRREFRQMEGGWHSTEQINRSRQRVDRLDFFTSVNVETPPVADVPDQVDINVNVVE 419

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF---GRHAVQNYTFSVEDP 495
              G++     Y   +G+ + G I  NN  G G    L        +    +++      
Sbjct: 420 KPTGAIMFGAGYSDREGIILNGSIAQNNILGTGNFLSLQVNTGSVNKIISASFSNPYYTI 479

Query: 496 YFLGSPISAGFDLQKTH--LEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
             +   + A      T      G  + +   A +R  +P+ E+   S        +    
Sbjct: 480 NGVSLGLEAFRRDINTRSLSRVGVFNTDTTGANIRFGIPVAENDMVSLGLGYEHTKIDLR 539

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           ++  +    +         ++  ++ S   +  D+ I    G+      ++    GD  Y
Sbjct: 540 NDSPQRFRDFVDQFGK-TSNNLPLTLSWARDRRDSAIWTTSGLTQRLFGEFGMPFGDLNY 598

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +++     +F+ +S    ++ +   G G    S K L  F  F       +RG+    +G
Sbjct: 599 YKVSYEQRWFFPVSRLFTLMLNGEVGVGDGY-SGKPLPFFKNFFAGGFNSVRGYNINTLG 657

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           PR +   A+GG      +  V FP+P + +   +R + F D  T+  +   LG D     
Sbjct: 658 PRDNNNLALGGSKRIVGNVEVLFPVPFMKDDKSVRLSAFADGGTIINSFSGLGFDD---- 713

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
              +R S G+   W SP+G +      PL  + GDK+Q+F F+ G   
Sbjct: 714 ---FRYSAGLAATWISPMGPLKFSVAQPLNDKPGDKLQRFQFQFGQTF 758


>gi|209964512|ref|YP_002297427.1| outer membrane protein, putative [Rhodospirillum centenum SW]
 gi|209957978|gb|ACI98614.1| outer membrane protein, putative [Rhodospirillum centenum SW]
          Length = 776

 Score =  396 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 181/783 (23%), Positives = 344/783 (43%), Gaps = 23/783 (2%)

Query: 14  LLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTS---IVRRIEIRGATNVGKEVILSRIPV 70
           ++ +       +G       +   +  +         VR I I G   +    + S + V
Sbjct: 1   MVSRVAAACLLIGSTTATSVLALTAGAFAQEAFSGGTVREIRIEGTQRIEAATVRSYLTV 60

Query: 71  VVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDD 130
             G   +   +D ++K+++A G F++V ++     L+++++E  IIN + F GN  +K D
Sbjct: 61  QTGDPFNAERIDESLKSLFATGLFADVTLRREGGTLVVNVVENPIINRVAFEGNRRVKTD 120

Query: 131 QLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEE 190
            L   V+ R    Y    V  DV  I + Y   G     V+ +   +    +++ + I+E
Sbjct: 121 DLVAEVQLRPRVVYTRTRVQNDVQRILEIYRRSGRFAARVEPKIVQLEQNRVDLIFEIDE 180

Query: 191 GVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYH 249
           G    +  I F+ N  +  + L  ++  + S ++ F    D Y  +R+++D E IR  Y 
Sbjct: 181 GPLTGVQRINFINNNIFDDSDLRDIMLTKESRWWRFLSSNDTYDPDRLNYDREQIRRHYL 240

Query: 250 DRGYAAVKV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRI 308
             GYA  +V S        +  + +   +DEG+ Y  G I IQS ++++  + L   I  
Sbjct: 241 RNGYADFRVLSMVAELTPDREDFFITMTVDEGKRYKFGEIKIQSDIKDLDGELLRPFILA 300

Query: 309 RSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVK 368
           +SG+ Y+   ++ S   +S      +  FV V   + R+  +  +D+ + I+Q   ++V+
Sbjct: 301 QSGDWYDADRVESSINLLSDALGDLQYAFVEVDPLLQRNEEEGTIDLLFEINQSPRVFVE 360

Query: 369 RIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSD 428
           RI+I GN ++ D VIRRE+ L+EGDP + + + R+++RI   G+F EV +         D
Sbjct: 361 RIDINGNVRTLDRVIRREMLLAEGDPFSITRVRRSEQRIKDLGFFEEVKVEPKEG-STPD 419

Query: 429 YVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNY 488
             ++ V V +   G + +   Y    G  V+  I + N  G+G   R +      + +  
Sbjct: 420 QSVITVEVSEQPTGEIQLGAGYSTTDGALVDFSIRERNLLGRGQDLRFSTMLSTRSQEFD 479

Query: 489 TFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
               E  +            +    +  ++  + ES  + +      S     +   ++ 
Sbjct: 480 VSFTEPYFMERDLAVGVDLFRVVRDDRDTITYDLESTGIVLRAGYPLSD--RLRQRFQYT 537

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
                 E   I +      + G  ++ SI Q + Y+  ++ + P  G  IS S ++AG G
Sbjct: 538 LSQNSIENVSIYASRFIRDQAGTTTTSSIEQLLFYDARNSRLRPTDGYFISLSNEFAGLG 597

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           G  +Y R    A+ ++ +  D  +  +   GY  ++   K++++ D+F +  +  LRGF 
Sbjct: 598 GSVRYLRNRLSAANYWNVYSDWVLSLTGEVGY--ILELGKDIRINDRFFLGGD-TLRGFE 654

Query: 669 YKGIGPRV---DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH--- 722
             G+GPR        A+GGK ++  S  ++ P+    +  G+    F D+ TL  +    
Sbjct: 655 PGGVGPRDLTNGNDDALGGKRFARTSLEMTVPLG--SDEMGVLAHAFADAGTLGDSGLKP 712

Query: 723 ----VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
                      +  ++   R S GV + W SP G + +   +PL  ++ D+ +QF F  G
Sbjct: 713 YVDPTDPTKSDVFRDEDALRASIGVGLSWKSPFGPIRIDLAMPLAKQDYDRTEQFRFSFG 772

Query: 779 NRM 781
            R 
Sbjct: 773 TRF 775


>gi|37524681|ref|NP_928025.1| outer membrane protein assembly factor YaeT [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|81420298|sp|Q7N8N9|YAET_PHOLL RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|36784106|emb|CAE12975.1| Probable outer membrane protein precursor YaeT [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 797

 Score =  396 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 189/795 (23%), Positives = 325/795 (40%), Gaps = 40/795 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG +  YG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATAYGADGFVVQDIHFEGLQRVAVGAALLNMPVRVGDTVSDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
             +  ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  RTIHALFATGNFEDVRVLRDSNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASHVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   ++     ++  Y S+G  N  VK     +    +++  V  EGV AKI  I
Sbjct: 121 IGEALDRTMLSNIERGLEDFYYSVGKYNASVKAVVTPLPRNRVDLKLVFAEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK++S   L     +R    +     D  Y K++++ D EA+R+FY DRGYA   +
Sbjct: 181 NIVGNKSFSSDELLNRFQLRDDVPWWNLTADQKYQKQKLTGDLEALRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +      +  +  L  I  G+LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTINITEGDQYKISGIDLNGNMAGYQSEITKLAAIEPGSLYNGTQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +    I          + RV T+   +   + V +   ID G+  YV++I   GND +
Sbjct: 301 VTKMENDIKNLLGRYGYAYPRVMTQPEINDQGKTVKLHVNIDAGNRFYVRKIRFSGNDTT 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   E   +   +IE  K R+   GYF  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMERAWLGSDLIELGKERLNRLGYFETVDVETQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+     +  + G+  +     +N+ G G    + A    ++              
Sbjct: 421 RNTGSLNFGVGFGTESGVSFQIGAQQDNWLGTGNSVGVNASKNDYSTYAELSFTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +    E              +  PI E+ S  F  +        + 
Sbjct: 481 NGVSLGGRVFYNDFRADDAELSGYTNQSYGIDGFLGFPINENNSLRFGLNYVHNSLSDML 540

Query: 555 EKEKIPSIYTTLIEHGKF--------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ E   +           +++    YN LD    P  G+  + +     
Sbjct: 541 PQAAMWRYLNSMGEKPDYKSKAEFKADDFALNVGWTYNNLDRGFFPTSGVKSTLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++++++    S +Y ++DD   V  G  R GYG  +   K L  ++ F    +  +
Sbjct: 601 PGSDNEFYKVTFDTSAYYPINDDRTWVILGRSRLGYGDGLG-GKELPFYENFYAGGSSTV 659

Query: 665 RGFAYKGIGPRV-------------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRG 709
           RGF    IGP+                + A+GG   + AS  +  P P +  +    +R 
Sbjct: 660 RGFRSNNIGPKAIYMNGKDDPKKDSPSRDAVGGNAMAVASLELITPTPFLDSKYSNSVRT 719

Query: 710 AFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
           +FF+DS T++  +    A          G     RVS G+ + W SPLG +   Y  P++
Sbjct: 720 SFFIDSGTVWDTYWNDSAAMKGSGIPDYGKPGNIRVSAGIALQWVSPLGPLVFSYAKPIK 779

Query: 764 HREGDKIQQFGFRIG 778
             EGD+ +QF F IG
Sbjct: 780 DYEGDRSEQFQFNIG 794


>gi|319943818|ref|ZP_08018099.1| OMP85 family outer membrane protein [Lautropia mirabilis ATCC
           51599]
 gi|319743051|gb|EFV95457.1| OMP85 family outer membrane protein [Lautropia mirabilis ATCC
           51599]
          Length = 755

 Score =  396 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 174/761 (22%), Positives = 307/761 (40%), Gaps = 20/761 (2%)

Query: 31  FYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYA 90
              +   +     +  ++R I ++G        +   +P+ VG   + A    A+K +YA
Sbjct: 5   LATLAWSAQALAFSPFVIRDIRVQGLQRTEAGTVFGYLPIRVGDEFTPARASEAIKALYA 64

Query: 91  MGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDED 147
            G+F +V++     VL++ + ER  I  +  SG+     + LK  +       A  +D  
Sbjct: 65  TGFFKDVQLARDGEVLVVRVEERPAIASVDVSGSREFDAEALKKAMRQAGLAEARIFDRS 124

Query: 148 TVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNY 207
            ++     I++ Y S G  +V +      ++   + ++  I+EG  A+I  IR +GNK +
Sbjct: 125 VLDRAEQEIRRQYLSRGKYSVKITSAVTPLARNRVAVSLAIDEGASARIAQIRILGNKVF 184

Query: 208 SHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDK 266
             + L   I     +    + KTD YS+E+++ D E +R+FY +RGY    + S  +   
Sbjct: 185 KESELLDQIKLTTPNWLSWYTKTDQYSREKLAGDLETLRSFYLNRGYLEFGIESTQVSID 244

Query: 267 QKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKI 326
                V +                       +++     + +R G+ ++ +++ +S +KI
Sbjct: 245 PDREKVYVTLTIREGERYKVRDLKFGGNTLGREEQFRKALALRPGDTFSGEKLTQSEKKI 304

Query: 327 SKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRE 386
           +    +    F  V      D  KR VD    ID G   YV+RI I GN ++ D VIRRE
Sbjct: 305 TDDLGAIGYAFASVNPVPTIDREKREVDYTLNIDPGRRAYVRRITIAGNQRTRDEVIRRE 364

Query: 387 LELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGI 446
           L   EG   +   I  ++ R+   GYF +V IS +P   V D V L V V +   G++  
Sbjct: 365 LRQFEGAWFDSDKIALSRDRVERLGYFQDVQISNVPVPGVPDQVDLLVKVTERPTGNMTF 424

Query: 447 ATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFLGSPI 502
              Y     + ++  +++ NF G G    +    G+               +        
Sbjct: 425 GAGYSTTDKLLLQVALNEPNFLGTGNTFGVEVNTGQTQRTASVSYVDPYFTNDGVSLGAD 484

Query: 503 SAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSI 562
                   ++   G   I    A +R+ +P TE    SF       Q    +       I
Sbjct: 485 LYSRTFNASNSGLGDYRIRSSGAGLRLGIPYTELDRLSFGLVFEQNQIKPGTTGLPQRYI 544

Query: 563 YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASY 622
                      +  ++     ++ D+  +P +G L   ++D    G D  Y+R   + ++
Sbjct: 545 DYVNQFGTTSDAWLLTFGWSRDSRDSGYMPTRGRLQRFNFDVTFPGQDLSYYRATYQHAW 604

Query: 623 FYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV-DKKYA 681
           +  ++ D   + S   GYG      K   +F  F       +RGF    +GPR      A
Sbjct: 605 YIPVTKDYTWLLSADLGYGRGFG-GKPYPVFKNFYAGGIGSVRGFGSNSLGPRDVKDNSA 663

Query: 682 IGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVST 741
           +GG     AS  + FP+P       +R   F D+  ++ NH   G           R S 
Sbjct: 664 LGGNASFVASTELLFPLPGTGNDKTVRAFLFADAGNVFDNHYDFG---------DLRYSA 714

Query: 742 GVEIMWNSPLG-MMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           G+ I W +P+G  + +  G PL+ + GD  Q+  F++G   
Sbjct: 715 GIGISWFAPIGADIKLSLGYPLKRKPGDDTQRVQFQLGTSF 755


>gi|299067467|emb|CBJ38666.1| putative outer membrane protein assembly factor, bacterial surface
           antigen domain (D15) [Ralstonia solanacearum CMR15]
          Length = 765

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 163/768 (21%), Positives = 318/768 (41%), Gaps = 18/768 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           F +  +            +     +++ I + G   V    +   +PV VG++ +D    
Sbjct: 7   FPLSMLAASVLTVCAGQAHAVEPFVIKDIRVEGVQRVEPGTVFGYLPVKVGETFTDDKGA 66

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++ +Y  G+F +V+I+   +VL++ + ER  I+ L F G      D L+  +      
Sbjct: 67  ESIRALYNTGFFKDVQIRAEGNVLVVRVEERPAISQLEFIGIKEFDKDTLRRSLRGVGVA 126

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            A  YD+  ++     +K+ Y S GY    V+     +    + IT+ ++EG  AKI  I
Sbjct: 127 EARYYDKSLIDRAEQELKRQYVSRGYYAADVQTTVTPVDANRVAITFTVDEGPVAKIRQI 186

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L   +     +    + K D+YSK++++ D EA+R+FY DRGY    +
Sbjct: 187 NIVGNKAFSEGDLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSFYLDRGYLEFAI 246

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +     ++  +  LI+++ G++++  +
Sbjct: 247 ESTQVSITPDKKDIYLTLNIHEGEQYKVSDIKLTGELLSKQAEMEKLIKLKQGDVFSSAK 306

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  +++ I+    +    F  +  +   +   R V +  ++D G  +YV+R+ + GN ++
Sbjct: 307 LSATTKAITDLLGTYGYAFATINPQPQINQKDRTVALTLVVDPGRRVYVRRVNVVGNSKT 366

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   E    +   ++ ++ RI  TGYF++ NI+      +SD V + V+V +
Sbjct: 367 RDEVVRREMRQMESSWFDSEKLQLSQNRINRTGYFTDTNITTEDVPGMSDQVDVNVNVTE 426

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
              G + +   +     + +   I  +N FG G    L     +          +  + +
Sbjct: 427 KPTGQISLGVGFSSTDKLVLSAGIRQDNVFGSGTSLGLDVNTSKSNRTIAVTQYDPYFTV 486

Query: 499 G-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                 + +         +  D    I  +   ++  VP +E+ +  F            
Sbjct: 487 DGISRSTELYYRTYRPLYYTGDQDYRIVQQGGNIKFGVPFSETDTVFFGIGYERTTIDVT 546

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           S    +   Y         ++  I+     +  D+ +VP +G    ++ ++   GGD QY
Sbjct: 547 SNTPLVYQNYVAKNGR-ISNNFPITIGWSKDQRDSALVPTRGRYQQANLEFGIPGGDLQY 605

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +R   +  YFY +S    +  +   GYG      K+  +F  +       +RG+    +G
Sbjct: 606 YRAYYQHQYFYPVSKSFTLAFNNEIGYGHGYG-GKDFPVFKNYYAGGIGSVRGYETSTLG 664

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           PR     AIGG      +    FP+P       +R   F D   ++A             
Sbjct: 665 PRDANGTAIGGASKFVGNMEFIFPLPGSGVDRTVRLFTFFDYGNVFAEGQPFKV------ 718

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R STG  + W SP+G + +  G P++ +  D+ Q+F F+IG   
Sbjct: 719 -GDMRYSTGFGLSWLSPIGPLKISMGFPIKRKAEDQTQRFQFQIGTAF 765


>gi|148549384|ref|YP_001269486.1| surface antigen (D15) [Pseudomonas putida F1]
 gi|148513442|gb|ABQ80302.1| surface antigen (D15) [Pseudomonas putida F1]
          Length = 786

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 169/787 (21%), Positives = 325/787 (41%), Gaps = 31/787 (3%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG    D  L  
Sbjct: 1   MKRLLLTAVMSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           + ++++  G+F ++++    +VLII+++ER  ++ +   GN  +  + L   ++      
Sbjct: 61  STRSLFKTGFFQDIQLSRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +    L ++  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 IVGNNVFDDETLGQLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN ++ 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+         D V +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPQVPGTDDQVDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  +NF G G +  +           Y F   DPYF  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQSNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYFTA 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVRMIV-----PITESISTSFKYDLRFLQYGAIS 554
             +S G++      +   LD++  S AV             S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRSTDYDDLDVDVASYAVDSYGAGVSLGYPISETSRLTYGLSVQQDKIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  L + G  F +   S     +TL+  ++  +G   S + +    G D  +
Sbjct: 540 GKYTVDEIFDFLEQEGDNFLNFKASIGWSESTLNKGVLATRGHSQSLTLESTVPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  R   F  ++ D  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRGQLFKPITSDYTLRLHTELGYGDGYGSTSGLPFYENYFAGGFNSVRGFKDSSLG 659

Query: 674 PR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
           PR                          GG +     A + FP+P V ++  LR + F D
Sbjct: 660 PRSTPSIGEAAGGKPGTIADPDQDPLPFGGNVLVQGGAELLFPLPFVKDQRSLRTSVFWD 719

Query: 715 SATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
              ++  +     D  +   S    S G+ + W + LG +     +P++  +    Q F 
Sbjct: 720 VGNVFDTNCGNKPDCEKVGFSGMASSVGLGVTWITALGPLSFSLAMPVKKPDDADTQVFQ 779

Query: 775 FRIGNRM 781
           F +G   
Sbjct: 780 FSLGQTF 786


>gi|313500233|gb|ADR61599.1| Surface antigen (D15) [Pseudomonas putida BIRD-1]
          Length = 786

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 169/787 (21%), Positives = 325/787 (41%), Gaps = 31/787 (3%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG    D  L  
Sbjct: 1   MKRLLLTAVMSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           + ++++  G+F ++++    +VLII+++ER  ++ +   GN  +  + L   ++      
Sbjct: 61  STRSLFKTGFFQDIQLSRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +    L ++  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 IVGNNVFDDETLGQLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN ++ 
Sbjct: 301 TSTSELITRRLGNEGYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+         D V +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPQVPGTDDQVDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  +NF G G +  +           Y F   DPYF  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQSNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYFTA 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVRMIV-----PITESISTSFKYDLRFLQYGAIS 554
             +S G++      +   LD++  S AV             S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRSTDYDDLDVDVASYAVDSYGAGVSLGYPISETSRLTYGLSVQQDKIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  L + G  F +   S     +TL+  ++  +G   S + +    G D  +
Sbjct: 540 GKYTVDEIFDFLEQEGDNFLNFKASIGWSESTLNKGVLATRGHSQSLTLESTVPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  R   F  ++ D  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRGQLFKPITSDYTLRLHTELGYGDGYGSTSGLPFYENYFAGGFNSVRGFKDSSLG 659

Query: 674 PR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
           PR                          GG +     A + FP+P V ++  LR + F D
Sbjct: 660 PRSTPSIGEAAGGKPGTIADPDQDPLPFGGNVLVQGGAELLFPLPFVKDQRSLRTSVFWD 719

Query: 715 SATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
              ++  +     D  +   S    S G+ + W + LG +     +P++  +    Q F 
Sbjct: 720 VGNVFDTNCGNKPDCEKVGFSGMASSVGLGVTWITALGPLSFSLAMPVKKPDDADTQVFQ 779

Query: 775 FRIGNRM 781
           F +G   
Sbjct: 780 FSLGQTF 786


>gi|253687345|ref|YP_003016535.1| outer membrane protein assembly complex, YaeT protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259710200|sp|C6DAJ1|YAET_PECCP RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|251753923|gb|ACT11999.1| outer membrane protein assembly complex, YaeT protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 809

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 183/807 (22%), Positives = 326/807 (40%), Gaps = 52/807 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ 
Sbjct: 1   MAIKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGGTLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   + +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +              +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINMTEGEQYKLSGVTVKGNLAGHSAEIEGLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+   + A + V +   +D G+  YV+ I  +GND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPEINDADKTVRLNINVDAGNRFYVRHIRFDGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E+ K R+   G+F  V++       V+D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGNDLVEQGKERLNRLGFFESVDVETQRVPGVADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      +  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISGTKNDYQTYVELSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA-- 552
                         + +  +              +  PI E+ S     D          
Sbjct: 481 DGVSLGGRIFYNKFEASDADLSDYTNVSYGVGSTLGFPINENNSLRVGLDYVHNDLSDMR 540

Query: 553 ----ISEKEKIPSIYTTLIEHGK-------FSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
               +        +   +++ G         +   ++    YN LD    P KG   S++
Sbjct: 541 PQVAMWRYLDSVGVNPAVVQEGNKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASAN 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
              A  G D++Y+++   ++ +Y L+D     ++G  R G+   +   K +  +D F   
Sbjct: 601 AKIAVPGSDNEYYKLTFDSASYYPLTDSGKWVVMGRTRAGFADGLG-GKEVPFYDNFYAG 659

Query: 660 SNYYLRGFAYKGIGPRVDK--------------------KYAIGGKIYSSASAAVSFPMP 699
            +  +RGF    IGP+                         A+GG   +  SA +  P P
Sbjct: 660 GSSTVRGFQSNTIGPKAAYYKCAVGATSYSNCPIDSTNLDDAVGGNAMAVLSAELIVPTP 719

Query: 700 LVPERA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPL 751
            + ++    +R +FFVD  T++  +       +          S +RVS+G+ + W SPL
Sbjct: 720 FISDKYASSVRTSFFVDGGTVWDTNWENTPATIAAGVPDYSKASNFRVSSGIALQWMSPL 779

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P++  +GDK +QF F IG
Sbjct: 780 GPLVFSYAQPVKKYDGDKSEQFQFNIG 806


>gi|17546131|ref|NP_519533.1| outer membrane signal peptide protein [Ralstonia solanacearum
           GMI1000]
 gi|17428427|emb|CAD15114.1| putative outer membrane signal peptide protein [Ralstonia
           solanacearum GMI1000]
          Length = 765

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 162/768 (21%), Positives = 319/768 (41%), Gaps = 18/768 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           F +  +            +     +++ I + G   V    +   +PV VG++ +D    
Sbjct: 7   FPLSMLAASVLTVCAGQAHAVEPFVIKDIRVEGVQRVEPGTVFGYLPVKVGETFTDDKGA 66

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++ +Y  G+F +V+I+   +VL++ + ER  I+ L F G      D L+  +      
Sbjct: 67  ESIRALYNTGFFKDVQIRAEGNVLVVRVEERPAISQLEFIGIKEFDKDTLRRSLRGVGVA 126

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            A  YD+  ++     +K+ Y S GY    V+     +    +++T+ ++EG  AKI  I
Sbjct: 127 EARYYDKSLIDRAEQELKRQYVSRGYYAADVQTTVTPVDANRVSVTFTVDEGPVAKIRQI 186

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L   +     +    + K D+YSK++++ D EA+R+FY DRGY    +
Sbjct: 187 NIVGNKAFSEGDLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSFYLDRGYLEFAI 246

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +     ++  +  LI+++ G++++  +
Sbjct: 247 ESTQVSITPDKKDIYLTLNIHEGEQYKVSDIKLTGELLSKQAEMEKLIKLKQGDVFSSAK 306

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  +++ I+    +    F  +  +   +   R V +  ++D G  +YV+R+ + GN ++
Sbjct: 307 LSATTKAITDLLGTYGYAFATINPQPQINQKDRTVALTLVVDPGRRVYVRRVNVVGNSKT 366

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   E    +   ++ ++ RI  TGYF++ NI+      +SD V + V+V +
Sbjct: 367 RDEVVRREMRQMESSWFDGEKLQLSQNRINRTGYFTDTNITTEDVPGMSDQVDVNVNVTE 426

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
              G + +   +     + +   I  +N FG G    L     +          +  + +
Sbjct: 427 KPTGQISLGVGFSSTDKLVLSAGIRQDNVFGSGTSLGLDVNTSKSNRTISVTQYDPYFTV 486

Query: 499 G-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                 + +         +  D    I  +   ++  VP +E+ +  F            
Sbjct: 487 DGISRSTELYYRTYRPLYYTGDQDYRIVQQGGNIKFGVPFSETDTVFFGIGYERTTIDVT 546

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           S    +   Y         ++  I+     +  D+ +VP +G    ++ ++   GGD QY
Sbjct: 547 SNTPLVYQNYVAKNGR-ISNNFPITIGWSKDQRDSALVPTRGRYQQANLEFGIPGGDLQY 605

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +R   +  YFY +S    +  +   GYG     NK+  +F  +       +RG+    +G
Sbjct: 606 YRAYYQHQYFYPVSKSFTLAFNNEIGYGHGYG-NKDFPVFKNYYAGGIGSVRGYETSTLG 664

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           PR     AIGG      +    FP+P       +R   F D   ++A             
Sbjct: 665 PRDANGVAIGGASKFVGNMEFIFPLPGSGVDRTVRLFTFFDYGNVFAEGQPFKV------ 718

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R S G  + W SP+G + +  G P++ +  D+ Q+F F+IG   
Sbjct: 719 -GDMRYSAGFGLSWLSPIGPLKISMGFPIKRKAEDQTQRFQFQIGTAF 765


>gi|253996529|ref|YP_003048593.1| outer membrane protein assembly complex protein YaeT [Methylotenera
           mobilis JLW8]
 gi|253983208|gb|ACT48066.1| outer membrane protein assembly complex, YaeT protein
           [Methylotenera mobilis JLW8]
          Length = 774

 Score =  395 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 178/756 (23%), Positives = 324/756 (42%), Gaps = 21/756 (2%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
           +V       V+ I + G        + S +PV VG+ + D     A+K++Y+ G+F +V+
Sbjct: 27  SVMALEPFQVKDIRVEGIQRTEAGTVFSHLPVKVGEIMDDDLASQAIKSLYSTGFFKDVR 86

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLK---MIVRSRSAAAYDEDTVNADVHN 155
           I+  ++VLI+ + ER  I  + FSGN +   D++K     +    +  +D+  ++     
Sbjct: 87  IEAENNVLIVTVQERAAIAQIEFSGNKSFPTDKMKEGLKQIGIAESQIFDKSQLDRAEQE 146

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           IK+ Y S G     VK     +    + + + IEEG  +KI  I  VGNK Y+   L   
Sbjct: 147 IKRQYLSQGKYGATVKTVVTPLERNRVAVRFDIEEGAVSKIRDINIVGNKAYTIEDLRAQ 206

Query: 216 ISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLI 274
             + T  +   + K D YSK++++ D EA+R+FY ++GY    + S  +        + I
Sbjct: 207 FLLTTPNWMSWWNKDDQYSKQKLNADLEALRSFYMNQGYLEFNIDSTQVSITPDKKDIYI 266

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
                       +    +    + +  L  LI++++G+ ++ +++ ++S+ IS    +  
Sbjct: 267 TINITEGEKYTISEVKLAGETLVPEDELRQLIQVQAGDTFSREKVTQTSKAISDRLSNDG 326

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F  V    + +  +      + +D G  +YV+RI + GN ++ D VIRRE+   E   
Sbjct: 327 YAFSNVNPVPDINKEQHTAAFTFFVDPGKRVYVRRINVVGNTRTRDEVIRREVRQLESAW 386

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDK 454
              + I R+K RI  T +FS+VN+        +D V L +SV + S GSV        ++
Sbjct: 387 YASNKINRSKERITRTDFFSDVNVETPAVAGTADQVDLNISVTEKSTGSVQFGAGLSSNE 446

Query: 455 GMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN---YTFSVEDPYFLGSPISAGFDLQKT 511
           G+     ++ NNF G G R       G+        YT     P  +   I        T
Sbjct: 447 GVVFGITVNQNNFLGTGNRVSAQVNTGKVNTTYSLSYTDPYFTPDGVSRGIDLYRRDVNT 506

Query: 512 HL-EDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHG 570
                G+   +     VR  +P+ E    +F     F      S+  +    +       
Sbjct: 507 SSLNIGTYSTSSYGGGVRFGIPLNERDGVNFGLAADFTSVDLTSQSPQQYKDFCDKASGC 566

Query: 571 KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDS 630
             +S   S    +++ D+ +   KG+L   S +      D +Y++I  + ++F  L    
Sbjct: 567 SSNSIVASAGWTHDSRDSIMFTTKGVLQRLSGEVTIPVLDLEYYKIDYKHAWFKELLTGY 626

Query: 631 DIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR-----VDKKYAIGGK 685
            ++ +   GY      NKN   F  F +     +RG+    +GPR         +A+GG 
Sbjct: 627 TLMLNGEIGYADSYG-NKNYPFFKNFYMGGVNSVRGYTNGSLGPRGIDSTTGNDFALGGT 685

Query: 686 IYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEI 745
                +A +  P+P + +    R + F D+  ++  + +        +    R STG+ +
Sbjct: 686 KRMLGNAELYVPIPGLKDSKQFRMSVFADAGNVFGANDSY-------DFGELRYSTGLGL 738

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            W SP G + + +  PL  + GD  Q   F++G + 
Sbjct: 739 SWVSPFGPLKLVFAKPLNSKPGDNTQTIQFQLGQQF 774


>gi|26988331|ref|NP_743756.1| surface antigen family outer membrane protein [Pseudomonas putida
           KT2440]
 gi|24983080|gb|AAN67220.1|AE016349_1 outer membrane protein, bacterial surface antigen family
           [Pseudomonas putida KT2440]
          Length = 786

 Score =  395 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 170/787 (21%), Positives = 325/787 (41%), Gaps = 31/787 (3%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG    D  L  
Sbjct: 1   MKRLLLTAVMSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           + ++++  G+F ++++    +VLII+++ER  ++ +   GN  +  + L   ++      
Sbjct: 61  STRSLFKTGFFQDIQLSRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +    L ++  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 IVGNNVFDDETLGQLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN ++ 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+         D V +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPQVPGTDDQVDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  +NF G G +  +           Y F   DPYF  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQSNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYFTA 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVRMIV-----PITESISTSFKYDLRFLQYGAIS 554
             +S G++      +   LD++  S AV             S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRSTDYDDLDVDVASYAVDSYGAGVSLGYPISETSRLTYGLSVQQDKIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  L E G  F +   S     +TL+  ++  +G   S + +    G D  +
Sbjct: 540 GKYTVDEIFDFLEEEGDNFLNFKASIGWSESTLNKGVLATRGHSQSLTLESTVPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  R   F  ++ D  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRGQLFKPITSDYTLRLHTELGYGDGYGSTSGLPFYENYFAGGFNSVRGFKDSSLG 659

Query: 674 PR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
           PR                          GG +     A + FP+P V ++  LR + F D
Sbjct: 660 PRSTPSIGEAAGGKPGTIADPDQDPLPFGGNVLVQGGAELLFPLPFVKDQRSLRTSVFWD 719

Query: 715 SATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
              ++  +     D  +   S    S G+ + W + LG +     +P++  +    Q F 
Sbjct: 720 VGNVFDTNCGNKPDCEKVGFSGMASSVGLGVTWITALGPLSFSLAMPVKKPDDADTQVFQ 779

Query: 775 FRIGNRM 781
           F +G   
Sbjct: 780 FSLGQTF 786


>gi|21307716|gb|AAK64508.1| putative outer membrane protein Vpr [Escherichia coli]
          Length = 810

 Score =  395 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 176/808 (21%), Positives = 316/808 (39%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG+   +V+ I   G   V     L  +PV  G +++D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLQASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              + D  T+      ++  Y S+G  +  VK     +    +++  V +EGV A+I  I
Sbjct: 121 VGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R +Y DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRIYYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    S         +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  + I K        + RV++    + A + V +   +D G+  YV++I  EGND S
Sbjct: 301 VTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++++ K R+   G+F  V+          D V +   VK+
Sbjct: 361 RDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS      Y  + G+  +  +  +N+ G GY   +      +               
Sbjct: 421 RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D Q    +            V +  PI E  S              + 
Sbjct: 481 DGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQ 540

Query: 555 EKEKIPSIYTTLIEH---------GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            +  +     ++ EH          K    + +    YN LD    P  G  ++ +    
Sbjct: 541 PQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVT 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
             G D++Y+++    + +  + DD   V  G  R+GYG  +   K +  ++ F    +  
Sbjct: 601 IPGSDNEYYKVTLDTATYVPIDDDHKWVVLGCTRWGYGDGLG-GKEMPFYENFYAGGSST 659

Query: 664 LRGFAYKGIGPRV----------------------------DKKYAIGGKIYSSASAAVS 695
           +RGF    IGP+                                 A+GG   + AS    
Sbjct: 660 VRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMTVASLEFI 719

Query: 696 FPMPLVPERA--GLRGAFFVDSATLYANHVA---LGADKLEGNDSFWRVSTGVEIMWNSP 750
            P P + ++    +R +FF D  T++  +             + S  R+S G+ + W SP
Sbjct: 720 TPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P +  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPFKKYDGDKAEQFQFNIG 807


>gi|167032167|ref|YP_001667398.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           putida GB-1]
 gi|166858655|gb|ABY97062.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           putida GB-1]
          Length = 787

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 170/788 (21%), Positives = 326/788 (41%), Gaps = 32/788 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG    D  L  
Sbjct: 1   MKRLLLTAVMSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           + ++++  G+F ++++    +VLII+++ER  ++ +   GN  +  + L   ++      
Sbjct: 61  STRSLFKTGFFQDIQLNRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +    L ++  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 IVGNNVFDDETLGQLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN ++ 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPPVPGTDDQVDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  +NF G G +  +           Y F   DPYF  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQSNFLGTGNKVSVGL-TRSEYQTRYNFGFVDPYFTA 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVRMIV-----PITESISTSFKYDLRFLQYGAIS 554
             +S G++      +   LD++  S AV             S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRSTDYDDLDVDVASYAVDSYGAGVSLGYPISETSRLTYGLSVQQDKIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  L + G  F +   S     +TL+  ++  +G   S + +    G D  +
Sbjct: 540 GKYTVDEIFDFLDQEGDNFLNFKASIGWSESTLNKGVLATRGHSQSLTLESTIPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  R   F  +S+D  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRGQLFQPISNDYTLRLHTELGYGDGYGSTSGLPFYENYFAGGFNSVRGFKDSSLG 659

Query: 674 PR--------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFV 713
           PR                           GG +       + FP+P V ++  LR + F 
Sbjct: 660 PRSTPSRGADDPNGKPGTIRDPDQDPLPFGGNVLVQGGVELLFPLPFVKDQRSLRTSVFW 719

Query: 714 DSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQF 773
           D   ++  +     D  +   S    S G+ + W + LG +     +P++  +    Q F
Sbjct: 720 DVGNVFDTNCGNKPDCEKVGFSGMASSVGLGVTWITALGPLSFSLAMPVKKPDDADTQVF 779

Query: 774 GFRIGNRM 781
            F +G   
Sbjct: 780 QFSLGQTF 787


>gi|325278084|ref|ZP_08143603.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           sp. TJI-51]
 gi|324096791|gb|EGB95118.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           sp. TJI-51]
          Length = 787

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 170/788 (21%), Positives = 327/788 (41%), Gaps = 32/788 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG    D  L  
Sbjct: 1   MKRLLLTAVMSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           + ++++  G+F ++++    +VLII+++ER  ++ +   GN  +  D L   ++      
Sbjct: 61  STRSLFKTGFFQDIQLNRDGNVLIINVVERPSVSSIEIEGNKAISTDDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +    L ++  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 IVGNNVFDDDTLGQLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN ++ 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPQPNEQDHTVDIMFVVDPGKRAYVNRINYRGNTKTE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPPVPGTDDQVDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  +NF G G +  +           Y F   DPYF  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQSNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYFTA 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G++          LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRSTNYDDLDVDVASYAVDSLGAGVSLGYPISETSRLTYGLSVQQDKIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  L + G  F +   S     +TL+  ++  +G   S + +    G D  +
Sbjct: 540 GKYTVDEIFDFLDQEGDNFLNFKASIGWSESTLNKGVLATRGHSQSLTLESTIPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  R   F  +++D  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRGQLFQPITNDYTLRLHTELGYGDGYGSTSGLPFYENYFAGGFNSVRGFKDSSLG 659

Query: 674 PR--------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFV 713
           PR                           GG +       + FP+P V ++  LR + F 
Sbjct: 660 PRSTPSRGEGNPGGKPGTIADPDQDPLPFGGNVLVQGGVELLFPLPFVKDQRSLRTSVFW 719

Query: 714 DSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQF 773
           D   ++  +     D  +   S    S G+ + W + LG +     +P++  +    Q F
Sbjct: 720 DVGNVFDTNCGSKPDCEKVGFSGMASSVGLGVTWITALGPLSFSLAMPVKKPDDADTQVF 779

Query: 774 GFRIGNRM 781
            F +G   
Sbjct: 780 QFSLGQTF 787


>gi|119898192|ref|YP_933405.1| outer membrane protein [Azoarcus sp. BH72]
 gi|119670605|emb|CAL94518.1| outer membrane protein [Azoarcus sp. BH72]
          Length = 759

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 161/752 (21%), Positives = 307/752 (40%), Gaps = 25/752 (3%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
           +V+ I + G        + S +PV VG + ++A    A++ ++A G+F +VKI++ + VL
Sbjct: 16  VVKDIRVEGIQRTEAGTVFSYLPVKVGDTFNEAQAAEAIRALFATGFFRDVKIEVENQVL 75

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKM---IVRSRSAAAYDEDTVNADVHNIKQAYASI 163
           ++ + ER  I  + F G      D LK     V    +  +D   ++     +K+ Y S 
Sbjct: 76  VVLVDERPAIAQIDFVGIKEFDKDALKKSLREVGLAESRIFDRALLDRAEQELKRQYLSR 135

Query: 164 GYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-IRTSG 222
           G  +  +      +    ++I + ++EG  A+I  I  VG K +    L           
Sbjct: 136 GKYSATITTTVTPLERNRVSINFNVDEGDVARIRQISIVGAKVFDEDDLLARFQLTTPGW 195

Query: 223 YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEI 282
              + K D YS++++S D E +R++Y DRGY    + S  +        + I        
Sbjct: 196 LTWYTKNDQYSRQKLSADLENLRSYYLDRGYLDFNIDSTQVSITPDKKDIYITVNITEGE 255

Query: 283 YTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKT 342
                    +    + +   L L  ++ G+ ++ + + E+++ I+    +    F  V  
Sbjct: 256 RYTVTGVRFTGDLILPESEYLGLTTVKPGDTFSRERLTETTKAITDRLGNEGYAFANVNA 315

Query: 343 RINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIER 402
               D  KR V     +D G  +YV+RI + GN ++ D V+RREL   EG   + + I R
Sbjct: 316 APEVDKDKREVSFTVFVDPGRRVYVRRINVGGNTKTRDEVVRRELRQMEGAWYDAAAINR 375

Query: 403 AKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHI 462
           ++ R+   G+F EVN+   P    +D V + ++VK+ + G++ +   +   + + +   I
Sbjct: 376 SRTRVDRLGFFDEVNVETPPVPGTTDQVDVNMTVKERATGNLMLGAGFSSSEKVVLSASI 435

Query: 463 DDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQKTHLEDGS 517
              N FG G    L       +           Y +        +               
Sbjct: 436 SQQNLFGSGNAMTLGLNTSSSSRTYALSFTNPYYTVDGVSLGWDLYHRTYDPSESYSVSP 495

Query: 518 LDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH------GK 571
                  A +R+  PI E  + +F   +   +     E  +    +            G 
Sbjct: 496 YKTVSTGAGLRLGYPIGEDDNINFGLTVDRTKITTYEESPEQYKGFCIDYGCSSDDGIGN 555

Query: 572 FSSHSIS--QSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD 629
            + +S++       ++ D+ + PR+G+      + A   G  +Y ++  +  +++ L  D
Sbjct: 556 VTVNSLTASAGWARDSRDSYLYPRQGVYQRIHGEVAVPPGKLRYTKLNYQYQHWFPLGRD 615

Query: 630 SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSS 689
             ++ +   G+       K +  +  F       +RGF    +GP+  +  A+GG     
Sbjct: 616 YALMLNGEAGWAKGYG-GKEVPFYKNFYAGGIGSVRGFEQSTLGPKDSEGDALGGTRKLI 674

Query: 690 ASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNS 749
            +A   FPMP        R + FVD+  ++     L            R STG+   W+S
Sbjct: 675 GNAEFFFPMPGAGTDRSFRISAFVDAGYVWGEDQKLKF-------GDLRYSTGLAFAWSS 727

Query: 750 PLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           P+G +    G+P++   GD IQ+F F++G+  
Sbjct: 728 PIGPLKFSLGMPIKKDSGDDIQRFQFQLGSIF 759


>gi|332160600|ref|YP_004297177.1| outer membrane protein assembly factor YaeT [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318606922|emb|CBY28420.1| outer membrane protein assembly factor YaeT precursor [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325664830|gb|ADZ41474.1| outer membrane protein assembly factor YaeT [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859607|emb|CBX69947.1| outer membrane protein assembly factor yaeT [Yersinia
           enterocolitica W22703]
          Length = 794

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 184/791 (23%), Positives = 318/791 (40%), Gaps = 35/791 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  QTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  + S      +     L +I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSEADKLTKIEPGELFNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    +      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGLGYVHNDLSDME 540

Query: 555 EKEKIPSIYTTLIEHGKFS--------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ E   ++          +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLESVGERPGYTGKTGFTTDDFTLNLGWTYNNLDRGFFPTSGVKSSVNTKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
            G D++++++    S +  L +D   V              +K +  ++ F       +R
Sbjct: 601 PGSDNEFYKVTFDTSAYQPLDEDRSWVLLGRGRLGYGGGIGSKEMPFYENFYAGGASSVR 660

Query: 666 GFAYKGIGPRV----------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAFFV 713
           GF    IGP+           D   A+GG   + AS  +  P P + E+    +R + FV
Sbjct: 661 GFRSNNIGPKAAYYNADGSIRDSTDAVGGNAMAVASLELITPTPFISEKYSNSVRTSVFV 720

Query: 714 DSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG 767
           D+ T++  +    A             S  RVS GV + W SPLG +   Y  P++  EG
Sbjct: 721 DAGTVWDTNWENTAQTRAAGIPDYSKASNIRVSAGVALQWMSPLGPLVFSYAKPVKDYEG 780

Query: 768 DKIQQFGFRIG 778
           DK +QF F IG
Sbjct: 781 DKSEQFQFNIG 791


>gi|187924425|ref|YP_001896067.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           phytofirmans PsJN]
 gi|187715619|gb|ACD16843.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           phytofirmans PsJN]
          Length = 770

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 159/774 (20%), Positives = 317/774 (40%), Gaps = 15/774 (1%)

Query: 18  YFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSIS 77
           + P  F    +I           + +   +V+ I I G   V    + + +P+  G + S
Sbjct: 2   FKPHRFVPKTVIAAAFAAHGLVAHATTPFVVQDIRIEGLQRVEPGTVFAYLPIKQGDTFS 61

Query: 78  DADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV- 136
           D     A++ +YA G+F++VKI    +V+I+ ++ER  I  + F+G +    + L   + 
Sbjct: 62  DDKASEAIRALYATGFFNDVKIATEGNVVIVQVLERPAIGTIDFAGIHEFDKENLTKALR 121

Query: 137 --RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
                    YD+  V+     +K+ Y + GY    V      I    +++ + + EG  A
Sbjct: 122 AVGLSQGRYYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVSVLFAVAEGPSA 181

Query: 195 KINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGY 253
           KI  I F+GNK +S   L   +     + +  + K D+Y+K++++ D E +R++Y +RGY
Sbjct: 182 KIRQINFIGNKAFSTGTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLENVRSYYLNRGY 241

Query: 254 AAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
               + S  +        + +            +    +     ++  L  LI+I+ G+ 
Sbjct: 242 LEFNIESTQVSITPDKKDMYLTVTLHEGEPYTISNIKLAGNLLDREPELAKLIKIKPGDR 301

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           ++ ++++ +++ I          F  V  +   D A   VD+   +D    +YV+RI + 
Sbjct: 302 FSAEKLQATTKAIVDKLGEYGYAFATVNAQPQIDQANHKVDLTLQVDPSRRVYVRRINVV 361

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE+   E    + + +  +K RI   GYF++V+++ +P     D V + 
Sbjct: 362 GNTRTRDEVVRREMRQLESSWFDSNRLALSKDRINRLGYFTDVDVTTVPVEGTPDQVDVD 421

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V +   G++ +   +     + +   +  +N FG G    +     +         V+
Sbjct: 422 VKVAEKPTGAITLGAGFSSTDKVVLSAGVSQDNVFGSGTSLSVNVNTAKTYRTLTVTQVD 481

Query: 494 DPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
             + +      + +         +  D S  I      ++  +P +E  +  F   L   
Sbjct: 482 PYFTVDGIKRITDVYYRTYQPLYYSTDSSFKIVTIGGDLKFGIPFSEVDTVYFGAGLEQN 541

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
           Q    +        Y         ++  I+     +  D+ +VP +G    ++ +Y    
Sbjct: 542 QLDVDANTPASYRQYVQDFGR-VSNNVPITVGWSRDARDSALVPSRGYFAQANAEYGTPI 600

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           G +QY++    A Y+Y  +    +  + +          K   +F  +       +RG+ 
Sbjct: 601 GSTQYYKADINAQYYYSFARGFVLGFNFQG-GYGKGMGGKPYPIFKNYYAGGIGSVRGYE 659

Query: 669 YKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
              +GPR       IGG      +  ++FP+P       LR   F+D+  ++A      +
Sbjct: 660 PSSLGPRDATTNDPIGGSKLLVGNIELTFPLPGTGYDRTLRVFTFLDAGNVWA---DASS 716

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                  +  R   G+ + W SP+G + +  G PL    GD+ Q+F F+IG   
Sbjct: 717 AATSTGANGLRYGYGIGLAWISPIGPLKLSLGFPLVKHTGDQYQKFQFQIGTAF 770


>gi|227114695|ref|ZP_03828351.1| outer membrane protein assembly factor YaeT [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 809

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 187/807 (23%), Positives = 328/807 (40%), Gaps = 52/807 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ 
Sbjct: 1   MAIKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGETLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   + +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +              +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINMTEGEQYKLSGVAVKGNLAGHSAEIEGLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+   + A + V +   +D G+  YV+ I  +GND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPEINDADKTVKLNINVDAGNRFYVRHIRFDGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E+ K R+   GYF  V++       V+D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDLVEQGKERLNRLGYFESVDVETQRVPGVADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      +  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISGTKNDYQTYVELSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA-- 552
                         + +  +              +  PI E+ S     D          
Sbjct: 481 DGVSLGGRIFYNKFEASDADLSDYTNVSYGVGSTLGFPINENNSLRVGLDYVHNDLSDMR 540

Query: 553 ----ISEKEKIPSIYTTLIEHGK-------FSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
               +        +  ++++ G         +   ++    YN LD    P KG   S++
Sbjct: 541 PQVAMWRYLDSVGVNPSVVQEGNKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASAN 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
              A  G D++Y+++   ++ +Y LSD  +  ++G  R G+   I   K +  +D F   
Sbjct: 601 AKIAVPGSDNEYYKLTFDSASYYPLSDSGNWVVMGRTRAGFADGIG-GKEVPFYDNFYAG 659

Query: 660 SNYYLRGFAYKGIGPRVDK--------------------KYAIGGKIYSSASAAVSFPMP 699
            +  +RGF    IGP+                         A+GG   +  SA +  P P
Sbjct: 660 GSSTVRGFQSNTIGPKAAYYKCAAGATSYSNCPIDSTNLDDAVGGNAMAVLSAELIVPTP 719

Query: 700 LVPERA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPL 751
            + ++    +R +FFVD  T++  +       +          S +RVS+G+ + W SPL
Sbjct: 720 FISDKYASSVRTSFFVDGGTVWDTNWKNTPATIAAGVPDYSKASNFRVSSGIALQWMSPL 779

Query: 752 GMMGVYYGIPLRHREGDKIQQFGFRIG 778
           G +   Y  P++  +GDK +QF F IG
Sbjct: 780 GPLVFSYAQPVKKYDGDKSEQFQFNIG 806


>gi|329912028|ref|ZP_08275639.1| Outer membrane protein assembly factor YaeT precursor
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327545751|gb|EGF30885.1| Outer membrane protein assembly factor YaeT precursor
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 779

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 181/773 (23%), Positives = 316/773 (40%), Gaps = 26/773 (3%)

Query: 26  GFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAV 85
             I L                 V+ I + G        + S +PV VG++ +D     A+
Sbjct: 16  RLIALAAFALCSGQALAVAPFTVKDIRVEGLQRTEAGTVFSYLPVRVGETFTDEKGSAAI 75

Query: 86  KNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAA 142
           K +YA G+F +V+I+    VL++ + ER  I  + F+G      DQL   ++      + 
Sbjct: 76  KALYATGFFKDVRIEADGDVLVVLVEERPAIAAVDFTGIKEFDKDQLNKALKDIGLGESR 135

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            YD+  V+     +K+ Y   G   V+VK     +    +NIT+ ++EG  A+I  I  V
Sbjct: 136 TYDKALVDRAEQELKRQYLGRGLYGVIVKTTVTPVERNRVNITFAVDEGETARIRQINVV 195

Query: 203 GNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           GNK +  + +   I+      +  + K+D YSK++++ D EA+++FY +RGY   +V S 
Sbjct: 196 GNKAFGDSEIRSRIALSTPGWFTWYTKSDQYSKQKLTGDIEALKSFYLNRGYLEFQVEST 255

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
            +        + I            +          ++  L  L+ +++G LY   ++  
Sbjct: 256 QVSITPDKKDIYITINISEGDKYTVSSVKIEGETFGREAELRGLMTLKAGELYAGDKLTA 315

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           S +KIS+   +    F  V      D  K+ V    LID G  +YV+RI + GN ++ D 
Sbjct: 316 SVKKISERMGNFGYAFANVNANPQIDRDKKEVAFTILIDPGKRVYVRRINVAGNTKTRDE 375

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           V+RRE    E    +   I  ++ R+   GYF EV I     +  +D V + ++V +   
Sbjct: 376 VVRREFRQFENSWYDGEKIRLSRDRVDRLGYFKEVTIDTPEVSGTTDQVDINMAVTEKPT 435

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNY----TFSVEDPYF 497
           G++ I   +   + + + G I   N FG G    L     +               D   
Sbjct: 436 GNILIGAGFSSSEKLTLTGSIQQANAFGSGTTVGLDVNTSKRNRTIALSQSNPYFTDDGV 495

Query: 498 LGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK- 556
             S  +     +   +  G   +    A ++  VP +E  +  F   +   +    +   
Sbjct: 496 SRSYETFLRTTRPPDINTGDYRVQQLGANMKFGVPFSELDTVFFGAGVERTRVETFTGDP 555

Query: 557 --EKIPSIYTTLI------EHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
                P +Y T +       +   +S  ++ +   ++ D+ + P  G    ++ + A  G
Sbjct: 556 LHNDSPELYKTYVRNFGDGTNATTNSFPLTVAWQRDSRDSALSPSAGRYQRANLEIAPVG 615

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
            D +Y+R   +  YF  L     +  +    YG      K   +F  F       +RGF 
Sbjct: 616 -DLKYYRAIYQHQYFLPLFRTITLATNAELDYGRGFG-GKAYPIFKNFYAGGIGSVRGFD 673

Query: 669 YKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGAD 728
              +GP+      +GG      +A + FP P       LR   FVD   ++       AD
Sbjct: 674 SSSLGPKAVNGDPLGGSSRVIMNAELQFPFPGSGADRSLRWYTFVDGGNVF-------AD 726

Query: 729 KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           + +   S  R S G+ I W SP+G + + YG PL  +  D+ Q F F++G   
Sbjct: 727 QQKIQFSEMRYSAGIGISWVSPVGPLRLSYGKPLNAKTTDRTQSFQFQLGQGF 779


>gi|284008512|emb|CBA75028.1| outer membrane protein assembly factor [Arsenophonus nasoniae]
          Length = 801

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 184/799 (23%), Positives = 319/799 (39%), Gaps = 44/799 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG    YGS+  +V+ I   G   V     L  +PV VG +I++ D+ 
Sbjct: 1   MAMKKLLIASLLFGSVTAYGSDGFVVQDIHFEGLQRVAVGAALLNMPVRVGDTINNDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ +++ G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  RTIRALFSTGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKSVKDDLLKQNLEASNIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   +      ++  Y S+G  N  VK     +     ++  +  EGV AKI  I
Sbjct: 121 VGEALDRTKLANIEKGLEDFYYSVGKYNATVKAIVTPLPRNRADLKLIFSEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK ++ A L     +R    +     D  Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFTTAELVNRFQLRDDVPWWNFIADQKYQKQKLAGDLETLRSFYLDRGYAKFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +         +  LI I+  +LYN  E
Sbjct: 241 DSTNVSLTPDKKGIYVTINVTEGDRYTISGVELNGETAGHYDEINQLITIKPASLYNGTE 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +     KI          + RV T+   +   + V +   +D GS  YV++I   GND S
Sbjct: 301 VTNMENKIKDLLGRYGYAYPRVITQPEINDEDKTVKLHVNVDAGSRFYVRQIRFVGNDVS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++   K R+  TG+F  V++         D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDLVNLGKERLNRTGFFETVDVETQRVPGTPDEVDVIYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     +  + G+  +  +   N+ G G    ++A    ++              
Sbjct: 421 RNTGSMNFGIGFGTESGISFQVGVQQENWLGTGNAVGISASKNDYSTYAELSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI- 553
                       D      +    +         +  P  E+ +              + 
Sbjct: 481 NGVSLGGRLFYNDFSAKDADLSRYNNKTYGVDSTLSFPFNENNAFRIGAGFVHNSLSDMK 540

Query: 554 -------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                    +    +           +  +++    YN LD    P  G   S +     
Sbjct: 541 AQVGMWRYLQSMGENPNFDDKARYNANDFTLNLGWTYNNLDRGFFPTAGNKTSLNSKITI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDD--SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G ++QY++I    S +Y + +D    ++G  + GYG      K L  ++ F       +
Sbjct: 601 PGSNNQYYKIRFDTSQYYPIDEDNKWVLLGRAQLGYGNGFG-GKELPFYENFYAGGAGTV 659

Query: 665 RGFAYKGIGPRV-----------------DKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           RGF    IGP+                      A+GG   ++AS  +  P P + E+   
Sbjct: 660 RGFRSNNIGPKAIYLEKDKKGDISPKSGSPSTDAVGGNAMATASLELITPTPFIDEKYAN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            +R +FF+D+ T++ ++ +             G  S  RVSTG+ + W SPLG +   Y 
Sbjct: 720 SIRTSFFIDAGTVWDSNWSNTPASWRAGMPDYGKASNIRVSTGIALQWMSPLGPLVFSYA 779

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P++  EGDK ++F F IG
Sbjct: 780 KPIKDYEGDKSEEFQFNIG 798


>gi|113868026|ref|YP_726515.1| outer membrane protein, surface antigen OMA87 [Ralstonia eutropha
           H16]
 gi|113526802|emb|CAJ93147.1| outer membrane protein, surface antigen OMA87 [Ralstonia eutropha
           H16]
          Length = 801

 Score =  394 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 166/782 (21%), Positives = 321/782 (41%), Gaps = 20/782 (2%)

Query: 12  KRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVV 71
           KR       +   +G +          A + ++  +VR I + G   V    +   +PV 
Sbjct: 28  KRGSTLIRHKRISLGLLASAVIAAWSPAGWAADPFVVRDIRVEGLQRVEPGTVFGYLPVR 87

Query: 72  VGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQ 131
           VG++ +D     A++ +Y  G+F +V+I+  + VL++ + ER  I+ L F G      D 
Sbjct: 88  VGETFTDDKGADAIRALYNTGFFKDVQIRAEEGVLVVQVEERPAISQLEFVGIKEFDKDT 147

Query: 132 LKMIV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVI 188
           L+  +       A  YD+  ++     +K+ Y + GY    V+     +    +++ + +
Sbjct: 148 LRRSLRAVGVAEARYYDKALIDKAEQELKRQYVARGYYAADVQTTITPVDRNRVSVVFNV 207

Query: 189 EEGVKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAF 247
           +EG  AKI  I  VGNK +    L   +     +    + K D+YSK++++ D EA+R+F
Sbjct: 208 DEGPVAKIRQINIVGNKAFKEGTLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSF 267

Query: 248 YHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIR 307
           Y +RGY    + S  +        + +    +       +    +     +++ +  L++
Sbjct: 268 YLNRGYLEFAIESTQVSITPDKKDIFLTLNIKEGDQYKVSDVRLAGELLGKQEEMEKLLQ 327

Query: 308 IRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYV 367
           ++ G++++ +++ +S++ I+    +    F  +  +   D  KR V +  ++D G  +YV
Sbjct: 328 LKKGDIFSSEKLTQSTKAITDLLGTYGYAFTTINPQPQIDKEKREVALTLMVDPGRRVYV 387

Query: 368 KRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVS 427
           +R+ + GN ++ D V+RRE+   E    +   + +++ RI  TGYF++ NI+        
Sbjct: 388 RRVNVVGNSKTRDEVVRREMRQMESSWFDSEKLTQSQARINRTGYFTDTNITTEDVPGAP 447

Query: 428 DYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN 487
           D V + V+V +   G + +   +     + ++  +  +N FG G    L     +     
Sbjct: 448 DQVDVNVNVTEKPTGQISLGVGFSSTDKLVLQAGLRQDNVFGSGTSLGLDVNTAKSFRTI 507

Query: 488 YTFSVEDPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFK 542
                +  + +      + I         +  D    I       +  VP +E  +  F 
Sbjct: 508 ALTQYDPYFTVDGISRSTDIYYRTSRPLYYTGDQDYKIVSAGGGFKFGVPFSEVDTVFFG 567

Query: 543 YDLRFLQYGAISEKEKIPSIYTTLI---EHGKFSSHSISQSIIYNTLDNPIVPRKGMLIS 599
                 Q           + +   I        ++   +     +  D+ +VP KG    
Sbjct: 568 IGYERTQVYTSVNTPSQYTDWLNKIGKSSGDGINNFPFTIGWARDRRDSALVPTKGPYTQ 627

Query: 600 SSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
           ++ +    GGD+QY+R   +  YFY +S    +  +    YG     N    +F  F   
Sbjct: 628 ANLEVGLPGGDTQYYRASVQQQYFYPISKSFTLALNGEVAYGHGYG-NTPFPVFKYFYAG 686

Query: 660 SNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
               +RG+    +GP+      +GG      +    FP+P       LR   F D   +Y
Sbjct: 687 GIGSVRGYQTSTLGPKDQNGNPVGGASKMIGNVEFIFPLPGSGVDRTLRLFTFFDFGNVY 746

Query: 720 ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
                L         S  + STG  + W SP+G + +  G PL     DK+Q+F F+IG 
Sbjct: 747 QEGQPLSF-------SELKYSTGFGMSWLSPIGPLKISMGFPLNRDTNDKVQRFQFQIGT 799

Query: 780 RM 781
             
Sbjct: 800 AF 801


>gi|194289784|ref|YP_002005691.1| outer membrane protein [Cupriavidus taiwanensis LMG 19424]
 gi|193223619|emb|CAQ69626.1| outer membrane protein [Cupriavidus taiwanensis LMG 19424]
          Length = 777

 Score =  394 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 165/782 (21%), Positives = 325/782 (41%), Gaps = 20/782 (2%)

Query: 12  KRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVV 71
           KR       +   +G +          A + ++  +VR I + G   V    +   +PV 
Sbjct: 4   KRGSTLIRHKRISLGLLASAVIAAWSPAGWAADPFVVRDIRVEGLQRVEPGTVFGYLPVR 63

Query: 72  VGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQ 131
           VG++ +D     A++ +Y  G+F +V+I+  + VL++ + ER  I+ L F G      D 
Sbjct: 64  VGETFTDDKGADAIRALYNTGFFKDVQIRAEEGVLVVQVEERPAISQLEFVGIKEFDKDT 123

Query: 132 LKMIV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVI 188
           L+  +       A  YD+  ++     +K+ Y + GY    V+     +    +++ + +
Sbjct: 124 LRRSLRAVGVAEARYYDKALIDKAEQELKRQYVARGYYAADVQTTITPVDRNRVSVVFNV 183

Query: 189 EEGVKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAF 247
           +EG  AKI  I  VGNK +  + L   +     +    + K D+YSK++++ D E++R++
Sbjct: 184 DEGPVAKIRQINIVGNKAFKESTLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLESLRSY 243

Query: 248 YHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIR 307
           Y +RGY    + S  +        + +    +       +    +     +++ +  L++
Sbjct: 244 YLNRGYLEFAIESTQVSITPDKKDIFLTLNIKEGEQYKVSDVRLAGELLGKQEEMEKLLQ 303

Query: 308 IRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYV 367
           ++ G++++ +++ +S++ I+    +    F  +  +   D  KR V +  ++D G  +YV
Sbjct: 304 LKKGDIFSSEKLTQSTKAITDLLGTYGYAFTTINPQPQIDKEKREVALTLMVDPGRRVYV 363

Query: 368 KRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVS 427
           +R+ + GN ++ D V+RRE+   E    +   +++++ RI  TGYF++ NI+        
Sbjct: 364 RRVNVVGNSKTRDEVVRREMRQMESSWFDSEKLQQSQARINRTGYFTDTNITTEDVPGAP 423

Query: 428 DYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN 487
           D V + V+V +   G + +   +     + ++  +  +N FG G    L     +     
Sbjct: 424 DQVDVNVNVTEKPTGQISLGVGFSSTDKLVLQAGLRQDNVFGSGTSLGLDVNTAKSFRTI 483

Query: 488 YTFSVEDPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFK 542
                +  + +      + I         +  D    I       +  VP +E  +  F 
Sbjct: 484 ALTQYDPYFTVDGISRSTDIYYRTSRPLYYTGDQDYKIVSAGGGFKFGVPFSEVDTVFFG 543

Query: 543 YDLRFLQYGAISEKEKIPSIYTTLIEHGK---FSSHSISQSIIYNTLDNPIVPRKGMLIS 599
                 Q             + T I        ++   +     +  D+ +VP KG    
Sbjct: 544 IGYERTQVYTSVNTPNQYKNWLTEIGKNSGDGINNFPFTIGWARDRRDSALVPTKGPYTQ 603

Query: 600 SSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
           ++ +    GGD+QY+R   +  YFY +S    +  +    YG     N    +F  F   
Sbjct: 604 ANLEVGLPGGDTQYYRASVQQQYFYPISKAFTLALNGEVAYGHGYG-NTPFPVFKYFYAG 662

Query: 660 SNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
               +RG+    +GP+      +GG      +    FP+P       LR   F D   +Y
Sbjct: 663 GIGSVRGYQTSTLGPKDQNGNPVGGASKMIGNVEFIFPLPGSGVDRTLRLFTFFDFGNVY 722

Query: 720 ANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGN 779
                L         S  + STG  + W SP+G + +  G PL+  + DK+Q+F F+IG 
Sbjct: 723 QEGEPLRF-------SELKYSTGFGMSWLSPIGPLKLSMGFPLKRDDNDKVQRFQFQIGT 775

Query: 780 RM 781
             
Sbjct: 776 AF 777


>gi|241662951|ref|YP_002981311.1| outer membrane protein assembly complex, YaeT protein [Ralstonia
           pickettii 12D]
 gi|240864978|gb|ACS62639.1| outer membrane protein assembly complex, YaeT protein [Ralstonia
           pickettii 12D]
          Length = 750

 Score =  394 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 161/752 (21%), Positives = 311/752 (41%), Gaps = 18/752 (2%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
             +     +V+ I + G   V    +   +PV VG++ +D     +++ +Y  G+F +V+
Sbjct: 8   QAHAVEPFVVKDIRVEGVQRVEPGTVFGYLPVKVGETFTDEKGAESIRALYNTGFFKDVQ 67

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHN 155
           I+   +VL++ + ER  I+ L F G      + L+  +       A  YD+  ++     
Sbjct: 68  IRSEGNVLVVRVEERPAISQLEFIGFKEFDKEALRRTLRGVGVAEARYYDKSLIDRAEQE 127

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERV 215
           IK+ Y S GY    V      +    ++IT+ ++EG  AKI  I  VGNK +    L   
Sbjct: 128 IKRQYVSRGYYAAEVTTTVTPVDANRVSITFTVDEGPTAKIRQINIVGNKAFKEGDLRDE 187

Query: 216 IS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLI 274
           +     +    + K D+YSK++++ D EA+R+FY DRGY    + S  +        + +
Sbjct: 188 MQLSTPNWLSWYTKNDLYSKQKLTADLEALRSFYLDRGYLEFAIESTQVSITPDKKDIYL 247

Query: 275 FQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGE 334
                       +    +     ++  +  LI+++ G++++  ++  +++ I+    +  
Sbjct: 248 TLNIHEGEQYKVSDIKLTGELLGKQAEMEKLIKLKQGDVFSSAKLSSTTKSITDLLGTYG 307

Query: 335 RPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDP 394
             F  +  +   +   R V +  ++D G  +YV+R+ + GN ++ D V+RRE+   E   
Sbjct: 308 YAFATINPQPQINQTDRTVALTLVVDPGRRVYVRRVNVVGNSKTRDEVVRREMRQMEASW 367

Query: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDK 454
            +   ++ ++ R+  TGYF++ NI+       +D V + V+V +   G + +   +    
Sbjct: 368 FDGEKLQLSQNRVNRTGYFTDANITTEDVPGTTDQVDVNVNVTEKPTGQINLGVGFSSTD 427

Query: 455 GMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG-----SPISAGFDLQ 509
            + +   I  +N FG G    L     +          +  + +      + +       
Sbjct: 428 KLVLSAGIRQDNVFGSGTSLGLDVNTSKSNRTIAVTQFDPYFTVDGISRSTELYYRTYRP 487

Query: 510 KTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEH 569
             +  D    +  +   V+  VP +E+ +  F            S        Y      
Sbjct: 488 LYYTGDQDYRVVQQGGNVKFGVPFSETDTVFFGIGYERTTIDVTSNTPLAYQNYVAKNGR 547

Query: 570 GKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD 629
              ++  I+     +  D+ +VP +G    ++ ++   GGD QY R   +  YFY LS  
Sbjct: 548 -ITNNFPITIGWSKDQRDSALVPTRGRYQQANLEFGIPGGDLQYFRAYYQHQYFYPLSKS 606

Query: 630 SDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSS 689
             +  +   GYG      K+  +F  +       +RG+    +GPR     AIGG     
Sbjct: 607 FTMAFNNEIGYGHGYG-GKDFPVFKNYYAGGIGSVRGYETSTLGPRDANGVAIGGASKFV 665

Query: 690 ASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNS 749
            +    FP+P       +R   F D   ++A                 R STG  + W S
Sbjct: 666 GNVEFIFPLPGSGVDRTVRLFTFFDYGNVFAEGQPYKL-------GDMRYSTGFGLSWLS 718

Query: 750 PLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           P+G + +  G P++ +  D+ Q+F F+IG   
Sbjct: 719 PIGPLKISMGFPIKRKTEDQTQRFQFQIGTAF 750


>gi|227326544|ref|ZP_03830568.1| outer membrane protein assembly factor YaeT [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 810

 Score =  394 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 188/808 (23%), Positives = 325/808 (40%), Gaps = 53/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ 
Sbjct: 1   MAIKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGETLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   + +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +              +  L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINMTEGEQYKLSGVAVKGNLAGHSAEIEGLTKIEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+   + A + V +   +D G+  YV+ I  +GND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPEINDADKTVKLNINVDAGNRFYVRHIRFDGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E+ K R+   GYF  V++       V+D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDLVEQGKERLNRLGYFESVDVETQRVPGVADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      +  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISGTKNDYQTYVELSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                         + +  +              +  PI E+ S     D        + 
Sbjct: 481 DGVSLGGRIFYNKFEASDADLSDYTNVSYGVGSTLGFPINENNSLRVGLDYVHNDLSDMR 540

Query: 555 --------------EKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
                           E +           K +   ++    YN LD    P KG   S+
Sbjct: 541 PQVAMWRYLDSVGVNPEVVAGTNNKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASA 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSV 658
           +   A  G D++Y+++   ++ +Y L+D     ++G  R G+   I S K +  +D F  
Sbjct: 601 NAKIAVPGSDNEYYKLTFDSASYYPLTDSGKWVVMGRTRAGFADGIGS-KEVPFYDNFYA 659

Query: 659 SSNYYLRGFAYKGIGPRVDK--------------------KYAIGGKIYSSASAAVSFPM 698
             +  +RGF    IGP+                         A+GG   +  SA +  P 
Sbjct: 660 GGSSTVRGFQSNTIGPKAAYYNCAVGATSYSGCPIDKTNLDDAVGGNAMAVLSAELIVPT 719

Query: 699 PLVPERA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSP 750
           P + ++    +R +FFVD  T++  +       +          S +RVS+G+ + W SP
Sbjct: 720 PFISDKYASSVRTSFFVDGGTVWDTNWKNTPATIAAGVPDYSKASNFRVSSGIALQWMSP 779

Query: 751 LGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           LG +   Y  P++  +GDK +QF F IG
Sbjct: 780 LGPLVFSYAQPVKKYDGDKSEQFQFNIG 807


>gi|91784111|ref|YP_559317.1| putative outer membrane antigen [Burkholderia xenovorans LB400]
 gi|91688065|gb|ABE31265.1| Putative outer membrane antigen [Burkholderia xenovorans LB400]
          Length = 767

 Score =  394 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 160/774 (20%), Positives = 316/774 (40%), Gaps = 18/774 (2%)

Query: 18  YFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSIS 77
           + P  F    +I           + +   +V+ I I G   V    + + +P+  G + S
Sbjct: 2   FKPHRFVPKTVIAAAFAAHGLVAHATTPFVVQDIRIEGLQRVEPGTVFAYLPIKQGDTFS 61

Query: 78  DADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV- 136
           D     A++ +YA G+F++VKI    +V+I+ ++ER  I  + F+G +    D L   + 
Sbjct: 62  DDKASEAIRALYATGFFNDVKIATEGNVVIVQVLERPAIGTIDFAGIHEFDKDNLTKALR 121

Query: 137 --RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
                    YD+  V+     +K+ Y + GY    V      I    +++ + + EG  A
Sbjct: 122 AVGLSQGRYYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVSVLFSVAEGPSA 181

Query: 195 KINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGY 253
           KI  I F+GNK +S   L   +     + +  + K D+Y+K++++ D E +R++Y +RGY
Sbjct: 182 KIRQINFIGNKAFSTGTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLENVRSYYLNRGY 241

Query: 254 AAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
               + S  +        + +            +    +     ++  L  LI+I+ G+ 
Sbjct: 242 LEFNIDSTQVSISPDKKDMYLTVTLHEGEPYTISSIKLAGNLLDREPELAKLIKIKPGDR 301

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           ++ ++++ +++ I          F  V  +   D +   VD+   +D    +YV+RI + 
Sbjct: 302 FSAEKLQATTKAIVDKLGEYGYAFATVNAQPQIDQSNHKVDLTLQVDPSRRVYVRRINVV 361

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE+   E    + + +  +K RI   GYF++V+++ +P     D V + 
Sbjct: 362 GNTRTRDEVVRREMRQLESSWFDSNRLALSKDRINRLGYFTDVDVTTVPVEGTPDQVDVD 421

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V +   G++ +   +     + +   +  +N FG G    +     +         V+
Sbjct: 422 VKVAEKPTGAITLGAGFSSTDKVVLSAGVSQDNVFGSGTSLSVNVNTAKTYRTLTVTQVD 481

Query: 494 DPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
             + +      + +         +  D S  I      ++  +P +E  +  F   L   
Sbjct: 482 PYFTVDGIKRITDVYYRTYQPLYYSTDSSFKIVTIGGDLKFGIPFSEVDTVYFGAGLEQN 541

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
           Q    S   +    Y         ++  I+     +  D+ +VP +G    ++ +Y    
Sbjct: 542 QLDIDSNTPQSYIDYVHEFGR-VSNNVPITVGWSRDARDSALVPSRGYFTQANAEYGTPI 600

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           G +QY++    A Y+Y  +    +  + +          K   +F  +       +RG+ 
Sbjct: 601 GGTQYYKADINAQYYYSFARGFVLGFNFQG-GYGNGLGGKPYPIFKNYYAGGIGSVRGYE 659

Query: 669 YKGIGPRVD-KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
              +GPR       IGG      +  ++FP+P       LR   F+D+  ++        
Sbjct: 660 PSSLGPRDAKTNDPIGGSKLLVGNIELTFPLPGTGYDRTLRVFTFLDAGNVWGTEGNSIG 719

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                  +  R   GV + W SP+G + +  G PL    GD+ Q+F F+IG   
Sbjct: 720 A------NGLRYGYGVGLAWISPIGPLKLSLGFPLTKHTGDQYQKFQFQIGTAF 767


>gi|73541562|ref|YP_296082.1| surface antigen (D15):surface antigen variable number [Ralstonia
           eutropha JMP134]
 gi|72118975|gb|AAZ61238.1| surface antigen (D15):Surface antigen variable number [Ralstonia
           eutropha JMP134]
          Length = 784

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 164/791 (20%), Positives = 323/791 (40%), Gaps = 31/791 (3%)

Query: 12  KRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVV 71
           KR       +   +G +          A + ++  +V+ I + G   V    +   +PV 
Sbjct: 4   KRGSRLIRHKRVSLGLLASAVIAAWSPAGWAADPFVVKDIRVEGLQRVEPGTVFGYLPVR 63

Query: 72  VGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQ 131
           VG++ +D     A++ +Y  G+F +V+I+  + VL++ + ER  I+ L F G      D 
Sbjct: 64  VGETFTDDKGADAIRALYNTGFFKDVQIRAEEGVLVVQVEERPAISQLEFVGIKEFDKDT 123

Query: 132 LKMIV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVI 188
           L+  +       A  YD+  ++     +K+ Y + GY    V+     +    +++ + +
Sbjct: 124 LRRSLRAVGVAEARYYDKALIDKAEQELKRQYVARGYYAADVQTTVTPVDRNRVSVVFNV 183

Query: 189 EEGVKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAF 247
           EEG  AKI  I  VGNK +  + L   +     +    + K D+YSK++++ D EA+R++
Sbjct: 184 EEGPVAKIKQINIVGNKAFKESTLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSY 243

Query: 248 YHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIR 307
           Y +RGY    + S  +        + +    +       +    +     +++ +  L++
Sbjct: 244 YLNRGYLEFAIESTQVSITPDKKDIYLTLNIKEGEQYKVSDIRLAGELLGKQEEMEKLLQ 303

Query: 308 IRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYV 367
           ++ G++++ +++  S++ I+    +    F  +  +   D  KR V +  ++D G  +YV
Sbjct: 304 LKKGDIFSSEKLTASTKSITDLLGTYGYAFTTINPQPQIDQEKREVALTLMVDPGRRVYV 363

Query: 368 KRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVS 427
           +R+ + GN ++ D V+RRE+   E    +   + +++ RI  TGYF++ NI+        
Sbjct: 364 RRVNVVGNSKTRDEVVRREMRQMESSWFDSEKLTQSQARINRTGYFTDTNITTEDVPGAP 423

Query: 428 DYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN 487
           D V + V+V +   G + +   +     + ++  +  +N FG G    L     +     
Sbjct: 424 DQVDVNVNVTEKPTGQISLGVGFSSTDKLVLQAGLRQDNVFGSGTSLGLDVNTAKSFRTI 483

Query: 488 YTFSVEDPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFK 542
                +  + +      + +         +  D    I       +  VP +E  +  F 
Sbjct: 484 ALTQYDPYFTVDGISRSTDVYYRTSRPLYYTGDQDYKIETAGGGFKFGVPFSEVDTVFFG 543

Query: 543 YDLRFLQYGAISEKEKIPSIYTTLIEHGK------------FSSHSISQSIIYNTLDNPI 590
               + +                L + GK             ++   +     +  D+ +
Sbjct: 544 IGYEWTRISV--SPNTPSQYVKFLHDIGKMPAGQTTGTASPINNFPFTIGWARDRRDSAL 601

Query: 591 VPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNL 650
           VP KG    ++ +    GGD QY+R   +  YFY +S    +  +    YG     N   
Sbjct: 602 VPTKGPYTQANLEVGIPGGDVQYYRASVQQQYFYPISKAFTLALNGEVAYGHGYG-NTPF 660

Query: 651 QLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGA 710
            ++  F       +RG+    +GP+      +GG      +    FP+P       LR  
Sbjct: 661 PVYKYFYAGGIGSVRGYQTSTLGPKDQNGNPVGGASKMIGNVEFIFPLPGSGVDRTLRLF 720

Query: 711 FFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKI 770
            F D   +Y     L         S  + STG  + W SP+G + +  G PL+    DK+
Sbjct: 721 TFFDFGNVYQEGAPLSF-------SELKYSTGFGMSWLSPIGPLKISMGFPLKKDNTDKV 773

Query: 771 QQFGFRIGNRM 781
           Q+F F+IG   
Sbjct: 774 QRFQFQIGTAF 784


>gi|326316581|ref|YP_004234253.1| outer membrane protein assembly complex, YaeT protein [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323373417|gb|ADX45686.1| outer membrane protein assembly complex, YaeT protein [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 765

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 164/775 (21%), Positives = 310/775 (40%), Gaps = 18/775 (2%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           ++K+  R        +   +F   A +      V+ I + G   V    + + +P+ VG 
Sbjct: 1   MKKHINRLGVRTACAVAAMVFVAQAAWALEPFKVQDIRVEGLQRVEPGTVFASMPLRVGD 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
             +D     A+++++A+G F +V+++   +VL++ + ER  I  + F+G      D LK 
Sbjct: 61  DYNDEKGAAAIRSLFALGLFKDVRLEASGNVLVVVVEERPTIADVDFAGTKEFDKDTLKK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +          YD+   +     +K+ Y +       V      I    +N+T+ + EG
Sbjct: 121 AMRDVGLTEGRPYDKALTDRAEQELKRQYINKSLYGAEVVTTVTPIERNRVNLTFTVTEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVISIRT-SGYFSFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKI  I   G + +S + L+ +    T      + K+D YS+ +++ D E +R++Y  
Sbjct: 181 EPAKIKDIHINGAQAFSESTLKGLFDQDTGGWLSWYTKSDRYSRTKLNADLETLRSYYLA 240

Query: 251 RGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRS 310
           RGY   ++ S  +        + I          V +          +     SLI I+ 
Sbjct: 241 RGYLEFRIDSTQVAVSPDKQDISITINITEGQRYVVSGVKLEGNYLDRDDEFKSLITIQP 300

Query: 311 GNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           G  YN  ++ E+++  + +F +    F RV+     D     V +    +     YV+RI
Sbjct: 301 GEPYNADKVTETTKAFTDHFGNFGFAFARVEAVPEIDRENNRVALVLRAEPSRRAYVRRI 360

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            + GN+++ D VIRRE    E    +   I+ ++ R+   GYF+EVN+     +   D V
Sbjct: 361 VVSGNNRTRDEVIRREFRQYEASWYDGDKIKLSRDRVDRLGYFTEVNVETQEVSGSPDQV 420

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNY-- 488
            L V+V +   GS+ +   +   + + +   I   N FG G    +     ++       
Sbjct: 421 DLVVNVAEKPTGSLQLGAGFSSAEKVSLSFSIKQENVFGSGNYLGVDVNTSKYRRTLVLS 480

Query: 489 --TFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLR 546
                        +        +    + G+  +     +VR  +P +E+ +  F   L 
Sbjct: 481 TTNPYFTPDGISRTLDLYYRTDKPYQDQGGNYQLITAGTSVRFGIPFSETDTVFFGGGLE 540

Query: 547 FLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
             +    +        Y         ++  ++     +  D+ + P  G     + D++ 
Sbjct: 541 NTRIKLGTNIPAAYLSYANTYGT-SSTALPLTVGWSRDDRDSALAPNSGRYQRLNSDWSV 599

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRG 666
            G D++Y R   +   +  L+    +  +   G+G  + + +   +F  F       +RG
Sbjct: 600 AG-DARYVRANYQFQQYVPLNKKFTLAFNSELGWGKGL-NGRPYPVFKNFYSGGLGSVRG 657

Query: 667 FAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALG 726
           F    +GPR     ++GG    + +A    P P       LR   FVD+  +Y     + 
Sbjct: 658 FDQGTLGPRDVTGASLGGPKKVTLNAEFIAPFPGAGNDRTLRVFTFVDAGNVYGEDEKVT 717

Query: 727 ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                   S  RVS G+ + W SPLG + + +  P+R   GDKIQ+  F+IG   
Sbjct: 718 F-------SDMRVSAGLGLSWISPLGPLRLAFAQPVRKFAGDKIQKLQFQIGTSF 765


>gi|188533045|ref|YP_001906842.1| outer membrane protein assembly factor YaeT [Erwinia tasmaniensis
           Et1/99]
 gi|226708909|sp|B2VE18|YAET_ERWT9 RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|188028087|emb|CAO95944.1| Outer membrane protein assembly factor YaeT [Erwinia tasmaniensis
           Et1/99]
          Length = 803

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 182/800 (22%), Positives = 316/800 (39%), Gaps = 44/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +   + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLIASLLLSSATVYGADGFVVKDIHFDGLQRVAVGAALLSMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+ + ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  NTIRALFATGNFEDVQVLRDGNTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  TV+     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTVSTIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NVVGNKAFSSDELISRFQLRDDVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +++ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGEQYKLSGVAVSGNLAGHSAEIEGLSKVKPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  + + I K        + RV+T+   D A + V +   +D G+  YV+++  EGND S
Sbjct: 301 VTRTEDDIKKLLGRYGYAYPRVQTQTEIDDANKTVKLHINVDAGNRYYVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E+ K R+   GYF  V+   +     +D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVEQGKDRLNRIGYFETVDTDTVRVPGSADQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G++     Y  + G+  +  I   N+ G G    ++     +               
Sbjct: 421 RNTGTLNFGVGYGTESGVSFQAGITQENWLGTGNTVGISGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       + +    +              +  P+ E+ +              + 
Sbjct: 481 DGVSLGGRLFYNNFKADDADLSDYTNKSYGLDGTLGFPVNENNTLRVGLGYVHNSLSNMQ 540

Query: 555 EKEKIP--------SIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +         +   +  E       + +    YNTLD    P  G   + +     
Sbjct: 541 PQVAMWRYLRSVGMNPSLSSNEDFSTDDFTFNYGWTYNTLDRGFFPTAGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLR 665
            G D+ +++       +  L  D   V   R   G     S K L  ++ F    +  +R
Sbjct: 601 PGSDNAFYKATLDTQQYVPLDQDHSWVLLGRGRVGYADGLSGKELPFYENFYAGGSSTVR 660

Query: 666 GFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVSFPMPLVPERA- 705
           GF    IGP+                        A+GG   + ASA +  P P + E+  
Sbjct: 661 GFRSNTIGPKAAYYNNGSSNCSGSDVAKICSSDDAVGGNAMAVASAELITPTPFLSEKYA 720

Query: 706 -GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
             +R + FVD+ T++  H    A  L             R+S G+ + W SPLG +   Y
Sbjct: 721 NSVRTSLFVDAGTVWDTHWDDTAATLGAGVPDYSKPGNIRMSAGLALQWMSPLGPLVFSY 780

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             P +  +GDK +QF F IG
Sbjct: 781 AQPFKKYDGDKAEQFQFNIG 800


>gi|296158896|ref|ZP_06841724.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. Ch1-1]
 gi|295890771|gb|EFG70561.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           sp. Ch1-1]
          Length = 767

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 159/774 (20%), Positives = 316/774 (40%), Gaps = 18/774 (2%)

Query: 18  YFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSIS 77
           + P  F    +I           + +   +V+ I I G   V    + + +P+  G + S
Sbjct: 2   FKPHRFVPKTVIAAAFAAHGLVAHATTPFVVQDIRIEGLQRVEPGTVFAYLPIKQGDTFS 61

Query: 78  DADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV- 136
           D     A++ +YA G+F++VKI    +V+I+ ++ER  I  + F+G +    + L   + 
Sbjct: 62  DDKASEAIRALYATGFFNDVKIATEGNVVIVQVLERPAIGTIDFAGIHEFDKENLTKALR 121

Query: 137 --RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
                    YD+  V+     +K+ Y + GY    V      I    +++ + + EG  A
Sbjct: 122 AVGLSQGRYYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVSVLFSVAEGPSA 181

Query: 195 KINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGY 253
           KI  I F+GNK +S   L   +     + +  + K D+Y+K++++ D E +R++Y +RGY
Sbjct: 182 KIRQINFIGNKAFSTGTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLENVRSYYLNRGY 241

Query: 254 AAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
               + S  +        + +            +    +     ++  L  LI+I+ G+ 
Sbjct: 242 LEFNIDSTQVSISPDKKDMYLTVTLHEGEPYTISNIKLAGNLLDREPELAKLIKIKPGDR 301

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           ++ ++++ +++ I          F  V  +   D +   VD+   +D    +YV+RI + 
Sbjct: 302 FSAEKLQATTKAIVDKLGEYGYAFATVNAQPQIDQSNHKVDLTLQVDPSRRVYVRRINVV 361

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE+   E    + + +  +K RI   GYF++V+++ +P     D V + 
Sbjct: 362 GNTRTRDEVVRREMRQLESSWFDSNRLALSKDRINRLGYFTDVDVTTVPVEGTPDQVDVD 421

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V +   G++ +   +     + +   +  +N FG G    +     +         V+
Sbjct: 422 VKVAEKPTGAITLGAGFSSTDKVVLSAGVSQDNVFGSGTSLSVNVNTAKTYRTLTVTQVD 481

Query: 494 DPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
             + +      + +         +  D S  I      ++  +P +E  +  F   L   
Sbjct: 482 PYFTVDGIKRITDVYYRTYQPLYYSTDSSFKIVTIGGDLKFGIPFSEVDTVYFGAGLEQN 541

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
           Q    S   +    Y         ++  I+     +  D+ +VP +G    ++ +Y    
Sbjct: 542 QLDIDSNTPQSYIDYVHEFGR-VSNNVPITVGWSRDARDSALVPSRGYFTQANAEYGTPI 600

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           G +QY++    A Y+Y  +    +  + +          K   +F  +       +RG+ 
Sbjct: 601 GGTQYYKADINAQYYYSFARGFVLGFNFQG-GYGNGLGGKPYPIFKNYYAGGIGSVRGYE 659

Query: 669 YKGIGPRVD-KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
              +GPR       IGG      +  ++FP+P       LR   F+D+  ++        
Sbjct: 660 PSSLGPRDAKTNDPIGGSKLLVGNIELTFPLPGTGYDRTLRVFTFLDAGNVWGTEGNSIG 719

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                  +  R   GV + W SP+G + +  G PL    GD+ Q+F F+IG   
Sbjct: 720 A------NGLRYGYGVGLAWISPIGPLKLSLGFPLTKHTGDQYQKFQFQIGTAF 767


>gi|327480162|gb|AEA83472.1| surface antigen family outer membrane protein [Pseudomonas stutzeri
           DSM 4166]
          Length = 783

 Score =  393 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 166/784 (21%), Positives = 322/784 (41%), Gaps = 28/784 (3%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   I  L      + +  +  I + G   V    +   +P+ VG++  DA L  
Sbjct: 1   MKRLLLPAVISALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEAADDARLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRS 140
           A + ++  G+F ++++     VL+I ++ER  I+ +   GN  +K + L   +       
Sbjct: 61  ATRALFRTGFFQDIQLGREGDVLVISVVERPSISAIEIEGNKAIKTEDLLSGLQQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  ++ +  +     + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAAIETEVVAQPRNRVALKIKINEGSVAAIKHIN 180

Query: 201 FVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +    L  +     T+    F   D Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNSVFPDEDLVDLFELKTTNWLSFFRNDDKYAREKLSGDLERLRSYYLDRGYINMDIT 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V +    +            S   ++ ++ + +L+  + G +++ + +
Sbjct: 241 STQVSITPDKKHVYVTVNIDEGERYTVRDVKLSGDLKVPQEEIEALLLAKEGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V            V I +++D G   YV RI   GN ++ 
Sbjct: 301 TSTSELITRRLGNEGYTFANVNGVPEAHDEDNTVSITFVVDPGKRAYVNRINFRGNTKTE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+         D + +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPQVPGTDDQIDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
            +GS+  +  +  + G+ + G I  NNF G G R  L           Y F   DPY+  
Sbjct: 421 PSGSIMASIGFAQNAGLILGGSISQNNFLGTGNRVSLGL-TRSEYQSRYNFGFVDPYWTE 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G++      +   LD    S +V      + +    S ++   + L   Q    +
Sbjct: 480 DGVSLGYNAFYRTTDYDELDYAVSSYSVDSLGAGINIGYPISETSRLSFGLTVQQDDLDT 539

Query: 555 EKEKIPSIYTTLIEHGK-FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            +  +  I+  + E G  F +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GRYTVDEIFDFMEEEGDSFLNFKASVGWSESTLNRGVLATRGHSQSLVFETTVPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +++      F  ++ D  +    R GYG    S  +L  ++ +       +RGF    +G
Sbjct: 600 YKLDYNGQLFVPMTKDYTLRMHTRLGYGDAYGSTSSLPFYEHYYAGGFNSVRGFEDSSLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG +       V FPMP V ++  LR + F D   +
Sbjct: 660 PRSTPSDGSRPGTIADPDQDPLPFGGNVLIQGGLEVLFPMPFVKDQRSLRTSVFWDVGNV 719

Query: 719 YANHVALG-ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRI 777
           +  +   G A+  + +      S GV + W + +G +     +P+   +    Q F F +
Sbjct: 720 FNTNCPSGAANCSDIDFGDMASSVGVGLTWITAMGPLSFSLAMPVVKPDDADTQVFQFSL 779

Query: 778 GNRM 781
           G   
Sbjct: 780 GQTF 783


>gi|309782130|ref|ZP_07676860.1| outer membrane protein assembly complex, YaeT protein [Ralstonia
           sp. 5_7_47FAA]
 gi|308919196|gb|EFP64863.1| outer membrane protein assembly complex, YaeT protein [Ralstonia
           sp. 5_7_47FAA]
          Length = 765

 Score =  393 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 162/768 (21%), Positives = 314/768 (40%), Gaps = 18/768 (2%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           F +  +            +     +V+ I + G   V    +   +PV VG++ +D    
Sbjct: 7   FPLSVLAASVLTVTAGQAHAVEPFVVKDIRVEGVQRVEPGTVFGYLPVKVGETFTDEKGA 66

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            +++ +Y  G+F +V+I+   +VL++ + ER  I+ L F G      + L+  +      
Sbjct: 67  ESIRALYNTGFFKDVQIRSEGNVLVVRVEERPAISQLEFIGFKEFDKEALRRTLRGVGVA 126

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            A  YD+  ++     IK+ Y   GY    V      +    ++IT+ ++EG  AKI  I
Sbjct: 127 EARYYDKSLIDRAEQEIKRQYVFRGYYAAEVTTTVTPVDANRVSITFTVDEGPTAKIRQI 186

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +    L   +     +    + K D+YSK++++ D EA+R+FY DRGY    +
Sbjct: 187 NIVGNKAFKEGDLRDEMQLSTPNWLSWYTKNDLYSKQKLTADLEALRSFYLDRGYLEFAI 246

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + +            +    +     ++  +  LI+++ G++++  +
Sbjct: 247 ESTQVSITPDKKDIYLTLNIHEGEQYKVSDIKLTGELLGKQAEMEKLIKLKQGDVFSSAK 306

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  +++ I+    +    F  +  +   + + R V +  +ID G  +YV+R+ + GN ++
Sbjct: 307 LSSTTKSITDLLGTYGYAFATINPQPQINQSDRTVALTLVIDPGRRVYVRRVNVVGNSKT 366

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   E    +   ++ ++ R+  TGYF++ NI+       +D V + V+V +
Sbjct: 367 RDEVVRREMRQMEASWFDGEKLQLSQNRVNRTGYFTDANITTEDVPGTTDQVDVNVNVTE 426

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
              G + +   +     + +   I  +N FG G    L     +          +  + +
Sbjct: 427 KPTGQINLGVGFSSTDKLVLSAGIRQDNVFGSGTSLGLDVNTSKSNRTIAVTQFDPYFTV 486

Query: 499 G-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                 + +         +  D    +  +   V+  VP +E+ +  F            
Sbjct: 487 DGISRSTELYYRTYRPLYYTGDQDYRVVQQGGNVKFGVPFSETDTVFFGIGYERTTIDVT 546

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
           S        Y         ++  I+     +  D+ +VP +G    ++ ++   GGD QY
Sbjct: 547 SNTPLAYQNYVAKNGR-ITNNFPITIGWSKDQRDSALVPTRGRYQQANLEFGIPGGDLQY 605

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            R   +  YFY LS    +  +   GYG      K+  +F  +       +RG+    +G
Sbjct: 606 FRAYYQHQYFYPLSKSFTMAFNNEIGYGHGYG-GKDFPVFKNYYAGGIGSVRGYETSTLG 664

Query: 674 PRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
           PR     AIGG      +    FP+P       +R   F D   ++A             
Sbjct: 665 PRDANGVAIGGASKFVGNVEFIFPLPGSGVDRTVRLFTFFDYGNVFAEGQPYKL------ 718

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R STG  + W SP+G + +  G P++ +  D+ Q+F F+IG   
Sbjct: 719 -GDMRYSTGFGLSWLSPIGPLKISMGFPIKRKTEDQTQRFQFQIGTAF 765


>gi|116051645|ref|YP_789516.1| putative outer membrane antigen [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115586866|gb|ABJ12881.1| putative outer membrane antigen [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 794

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 168/793 (21%), Positives = 330/793 (41%), Gaps = 38/793 (4%)

Query: 26  GFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAV 85
            F++       + A   + +  V  I + G   V    + + +P+ VG++I D  L  A 
Sbjct: 3   RFLLPALLSALMIAEVHAESFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQAT 62

Query: 86  KNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAA 142
           ++++  G+F ++++    +VL++ ++ER  I+ +   GN  +  + L   ++        
Sbjct: 63  RSLFKTGFFQDIQLGRDGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGE 122

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            +   T+    + +++ Y + G  +  +  +        + +   I EG  A I+ I  V
Sbjct: 123 IFQRATLEGVRNELQRQYVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVV 182

Query: 203 GNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           GN  +S   L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S 
Sbjct: 183 GNTVFSEEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIAST 242

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
            +       +V I                 +   ++ ++ +  L+ ++ G +++ + +  
Sbjct: 243 QVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTT 302

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           +S+ I++   +    F  V          + V + +++D G   YV RI   GN ++ D 
Sbjct: 303 TSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDE 362

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           V+RRE+   EG   +  +I+++K R+   GYF EVN+         D V +  SV++  +
Sbjct: 363 VLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPS 422

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSP 501
           GS+  +  +    G+ + G I  NNF G G +  +           Y F   DPY+    
Sbjct: 423 GSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYWTVDG 481

Query: 502 ISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G++      +   LD++  S +V      M +    S ++   Y L   +    + +
Sbjct: 482 VSLGYNAFYRKTDYDELDVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGR 541

Query: 557 EKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
             +  IY  L + G  F++   S     +TL+  ++  +G   S + +    G D  +++
Sbjct: 542 YTVDEIYDFLDKEGDNFTNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYK 601

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           I  R   F  L+D+  +      GYG    S + L  ++ +       +RGF    +GPR
Sbjct: 602 IDYRGQVFAPLTDNYTMRFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPR 661

Query: 676 -------------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGA 710
                                         A GG I  +  A + FP+P V ++  LR  
Sbjct: 662 STPSRAYKDGKIIPGPDERGRYTDPDQDPEAFGGNILITGGAELLFPLPFVKDQRQLRTV 721

Query: 711 FFVDSATLYANHVALG--ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD 768
            F D  + +          +           S GV + W + LG +      P++  +  
Sbjct: 722 LFWDVGSTFDTDCPTNTTTNCDGIKTDNLASSVGVGLTWITALGPLSFSLATPIKKPDNA 781

Query: 769 KIQQFGFRIGNRM 781
           + Q F F +G   
Sbjct: 782 ETQVFQFSLGQTF 794


>gi|330504236|ref|YP_004381105.1| surface antigen [Pseudomonas mendocina NK-01]
 gi|328918522|gb|AEB59353.1| surface antigen [Pseudomonas mendocina NK-01]
          Length = 786

 Score =  392 bits (1007), Expect = e-106,   Method: Composition-based stats.
 Identities = 168/787 (21%), Positives = 330/787 (41%), Gaps = 31/787 (3%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+ + D  L  
Sbjct: 1   MKRLLLPAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQVDDRQLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRS 140
           A ++++  G+F ++++     VL++ ++ER  I+ +   GN  +  + L   +       
Sbjct: 61  ATRSLFRTGFFQDIQLGRDGDVLVVTVVERPSISGIEIEGNKAITTEDLLKGLNQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  ++ +        + +   I EG  A I+ I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEIEAEVIPQPRNRVALKITINEGTVAAISHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + +S
Sbjct: 181 VVGNTVFSDEDLVDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIS 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I    E            S   ++ ++ + +L+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNVEEGEKYSVRDVKLSGDLKVPEEDVRALLLVKEGQVFSRKIM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V            V I + +D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPEAHDEDNTVSITFFVDPGKRAYVNRINFRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+         D + +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKVRLERLGFFKEVNVETPQVPGTDDQIDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
            +GS+  +  +  + G+ + G I  NNF G G R  +           Y+F   DPY+  
Sbjct: 421 PSGSITASVGFAQNAGLILGGSISQNNFLGTGNRVSIGL-TRSEYQTRYSFGFVDPYWTV 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G++      +   LD++  S +V      + +    S +    Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRTTDYDELDVDVSSYSVDSLGAGINIGYPISETARLTYGLTVQQDSIDT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            +  +  I+  +   G  + +   S     +TL+  ++  +G   S   +    G D  +
Sbjct: 540 GRYTVDEIFDFIDAEGDNYLNFKGSIGWSESTLNRGVLANRGHSQSLVLETTIPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +++  R   F  +SD+  +    + GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 YKLDYRGQVFTPISDNYTLRFHTQLGYGDSYGSTAELPFYEHYYAGGFNSVRGFKDSSLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG +       + FP+P V ++  LR A F D   +
Sbjct: 660 PRSTPSSGNKPGTLRDPDQDPLPFGGNVLVQGGVEMLFPLPFVKDQRSLRTALFWDVGNV 719

Query: 719 YANHVALG----ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
           +  + +      +D  + + S    S GV + W + LG +     +P++  +    Q F 
Sbjct: 720 FDTNCSSSQKKLSDSCDIDFSNLASSVGVGLTWITALGPLSFSLAMPIKKPDDADTQVFQ 779

Query: 775 FRIGNRM 781
           F +G   
Sbjct: 780 FSLGQTF 786


>gi|218890127|ref|YP_002438991.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
 gi|218770350|emb|CAW26115.1| probable outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
          Length = 795

 Score =  392 bits (1007), Expect = e-106,   Method: Composition-based stats.
 Identities = 168/794 (21%), Positives = 330/794 (41%), Gaps = 39/794 (4%)

Query: 26  GFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAV 85
            F++       + A   + +  V  I + G   V    + + +P+ VG++I D  L  A 
Sbjct: 3   RFLLPALLSALMIAEVHAESFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQAT 62

Query: 86  KNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAA 142
           ++++  G+F ++++    +VL++ ++ER  I+ +   GN  +  + L   ++        
Sbjct: 63  RSLFKTGFFQDIQLGRDGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGE 122

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            +   T+    + +++ Y + G  +  +  +        + +   I EG  A I+ I  V
Sbjct: 123 IFQRATLEGVRNELQRQYVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVV 182

Query: 203 GNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           GN  +S   L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S 
Sbjct: 183 GNTVFSEEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIAST 242

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
            +       +V I                 +   ++ ++ +  L+ ++ G +++ + +  
Sbjct: 243 QVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTT 302

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           +S+ I++   +    F  V          + V + +++D G   YV RI   GN ++ D 
Sbjct: 303 TSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDE 362

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           V+RRE+   EG   +  +I+++K R+   GYF EVN+         D V +  SV++  +
Sbjct: 363 VLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPS 422

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSP 501
           GS+  +  +    G+ + G I  NNF G G +  +           Y F   DPY+    
Sbjct: 423 GSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYWTVDG 481

Query: 502 ISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G++      +   LD++  S +V      M +    S ++   Y L   +    + +
Sbjct: 482 VSLGYNAFYRKTDYDELDVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGR 541

Query: 557 EKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
             +  IY  L + G  F++   S     +TL+  ++  +G   S + +    G D  +++
Sbjct: 542 YTVDEIYDFLDKEGDNFTNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYK 601

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           I  R   F  L+D+  +      GYG    S + L  ++ +       +RGF    +GPR
Sbjct: 602 IDYRGQVFAPLTDNYTMRFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPR 661

Query: 676 --------------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRG 709
                                          A GG I  +  A + FP+P V ++  LR 
Sbjct: 662 STPSVARDGKGNQIVGPDSKGRYTDPDQDPEAFGGNILITGGAELLFPLPFVKDQRQLRT 721

Query: 710 AFFVDSATLYANHVA--LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG 767
             F D  + +          +           S GV + W + LG +      P++  + 
Sbjct: 722 VLFWDVGSTFDTDCPTKTTTNCDGIKTDNLASSVGVGLTWITALGPLSFSLATPIKKPDN 781

Query: 768 DKIQQFGFRIGNRM 781
            + Q F F +G   
Sbjct: 782 AETQVFQFSLGQTF 795


>gi|120610511|ref|YP_970189.1| surface antigen (D15) [Acidovorax citrulli AAC00-1]
 gi|120588975|gb|ABM32415.1| surface antigen (D15) [Acidovorax citrulli AAC00-1]
          Length = 765

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 162/775 (20%), Positives = 309/775 (39%), Gaps = 18/775 (2%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           ++K+  R        +   +F   A +      V+ I + G   V    + + +P+ VG 
Sbjct: 1   MKKHINRLGVRTACAVAAMVFVAQAAWALEPFKVQDIRVEGLQRVEPGTVFASMPLRVGD 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
             +D     A+++++A+G F +V+++   +VL++ + ER  I  + F+G      D LK 
Sbjct: 61  DYNDEKGAAAIRSLFALGLFKDVRLEASGNVLVVVVEERPTIADVDFAGTKEFDKDTLKK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +          YD+   +     +K+ Y +       V      I    +N+T+ + EG
Sbjct: 121 AMRDVGLTEGRPYDKALTDRAEQELKRQYINKSLYGAEVVTTVTPIERNRVNLTFTVTEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVISIRT-SGYFSFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKI  I   G + +S + L+ +    T      + K+D YS+ +++ D E +R++Y  
Sbjct: 181 EPAKIKDIHINGAQAFSESTLKGLFDQDTGGWLSWYTKSDRYSRTKLNADLETLRSYYLA 240

Query: 251 RGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRS 310
           RGY   ++ S  +        + I          V +          +     SLI I+ 
Sbjct: 241 RGYLEFRIDSTQVAVSPDKQDISITINITEGQRYVVSGVKLEGNYLDRDDEFKSLITIQP 300

Query: 311 GNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           G  YN   + E+++  + +F +    F RV+     D     V +    +     YV+RI
Sbjct: 301 GEPYNADRVTETTKAFTDHFGNFGFAFARVEAVPEIDRENNRVALVLRAEPSRRAYVRRI 360

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            + GN+++ D VIRRE    E    +   I+ ++ R+   GYF+EVN+     +   D V
Sbjct: 361 IVSGNNRTRDEVIRREFRQYEASWYDGDKIKLSRDRVDRLGYFTEVNVETQDVSGSPDQV 420

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNY-- 488
            L V+V +   GS+ +   +   + + +   I   N FG G    +     ++       
Sbjct: 421 DLVVNVAEKPTGSLQLGAGFSSAEKVSLSFSIKQENVFGSGNYLGVDVNTSKYRRTLVLS 480

Query: 489 --TFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLR 546
                        +        +    + G+  +     +VR  +P +E+ +  F   L 
Sbjct: 481 TTNPYFTPDGISRTLDLYYRTDKPYEDQGGNYQLVTAGTSVRFGIPFSETDTVFFGGGLE 540

Query: 547 FLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
             +    +        Y         ++  ++     +  D+ + P  G     + D++ 
Sbjct: 541 NTRIKLGTNIPAAYLAYAN-TYGSSSTAIPLTVGWSRDDRDSALAPNSGRYQRLNSDWSV 599

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRG 666
            G D++Y R   +   +  L+    +  +   G+G  + + +   +F  F       +RG
Sbjct: 600 AG-DARYVRANYQFQQYVPLNKKFTLAFNSELGWGKGL-NGRPYPVFKNFYSGGLGSVRG 657

Query: 667 FAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALG 726
           F    +GPR     ++GG    + +A    P P       LR   FVD+  ++     + 
Sbjct: 658 FDQGTLGPRDVTGASLGGPKKVTLNAEFIAPFPGAGNDRTLRVFTFVDAGNVFGEDEKVS 717

Query: 727 ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                   S  RVS G+ + W SPLG + + +  P+R   GD+IQ+  F+IG   
Sbjct: 718 F-------SDMRVSAGLGLSWISPLGPLRLAFAQPVRKFAGDRIQKLQFQIGTSF 765


>gi|254242346|ref|ZP_04935668.1| hypothetical protein PA2G_03087 [Pseudomonas aeruginosa 2192]
 gi|126195724|gb|EAZ59787.1| hypothetical protein PA2G_03087 [Pseudomonas aeruginosa 2192]
          Length = 794

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 168/793 (21%), Positives = 330/793 (41%), Gaps = 38/793 (4%)

Query: 26  GFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAV 85
            F++       + A   + +  V  I + G   V    + + +P+ VG++I D  L  A 
Sbjct: 3   RFLLPALLSALMIAEVHAESFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQAT 62

Query: 86  KNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAA 142
           ++++  G+F ++++    +VL++ ++ER  I+ +   GN  +  + L   ++        
Sbjct: 63  RSLFKTGFFQDIQLGRDGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGE 122

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            +   T+    + +++ Y + G  +  +  +        + +   I EG  A I+ I  V
Sbjct: 123 IFQRATLEGVRNELQRQYVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVV 182

Query: 203 GNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           GN  +S   L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S 
Sbjct: 183 GNTVFSEEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIAST 242

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
            +       +V I                 +   ++ ++ +  L+ ++ G +++ + +  
Sbjct: 243 QVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTT 302

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           +S+ I++   +    F  V          + V + +++D G   YV RI   GN ++ D 
Sbjct: 303 TSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDE 362

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           V+RRE+   EG   +  +I+++K R+   GYF EVN+         D V +  SV++  +
Sbjct: 363 VLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPS 422

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSP 501
           GS+  +  +    G+ + G I  NNF G G +  +           Y F   DPY+    
Sbjct: 423 GSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYWTVDG 481

Query: 502 ISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G++      +   LD++  S +V      M +    S ++   Y L   +    + +
Sbjct: 482 VSLGYNAFYRKTDYDELDVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGR 541

Query: 557 EKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
             +  IY  L + G  F++   S     +TL+  ++  +G   S + +    G D  +++
Sbjct: 542 YTVDEIYDFLDKEGDNFTNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYK 601

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           I  R   F  L+D+  +      GYG    S + L  ++ +       +RGF    +GPR
Sbjct: 602 IDYRGQVFAPLTDNYTMRFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPR 661

Query: 676 -------------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGA 710
                                         A GG I  +  A + FP+P V ++  LR  
Sbjct: 662 STPSRAYKDGKIIPGPDERGRYTDPDQDPEAFGGNILITGGAELLFPLPFVKDQRQLRTV 721

Query: 711 FFVDSATLYANHVA--LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD 768
            F D  + +          +           S GV + W + LG +      P++  +  
Sbjct: 722 LFWDVGSTFDTDCPTKTTTNCDGIKTDNLASSVGVGLTWITALGPLSFSLATPIKKPDNA 781

Query: 769 KIQQFGFRIGNRM 781
           + Q F F +G   
Sbjct: 782 ETQVFQFSLGQTF 794


>gi|123443477|ref|YP_001007450.1| outer membrane protein assembly factor YaeT [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122090438|emb|CAL13306.1| putative surface antigen [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 794

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 184/791 (23%), Positives = 318/791 (40%), Gaps = 35/791 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  QTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  + S      +     L +I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSEADKLTKIEPGELFNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    +      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGLGYVHNDLSDME 540

Query: 555 EKEKIPSIYTTLIEHGKF--------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ E   +           +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLESVGERPGYTGTTGFTTDDFTLNLGWTYNNLDRGFFPTSGVKSSVNTKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
            G D++++++    S +  L +D   V              +K +  ++ F       +R
Sbjct: 601 PGSDNEFYKVTFDTSAYQPLDEDRSWVLLGRGRLGYGGGIGSKEMPFYENFYAGGASSVR 660

Query: 666 GFAYKGIGPRV----------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAFFV 713
           GF    IGP+           D   A+GG   + AS  +  P P + E+    +R + FV
Sbjct: 661 GFRSNNIGPKAAYYNADGSIRDSTDAVGGNAMAVASLELITPTPFISEKYSNSVRTSVFV 720

Query: 714 DSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG 767
           D+ T++  +    A+            S  RVS GV + W SPLG +   Y  P++  EG
Sbjct: 721 DAGTVWDTNWENTAETRAAGIPDYSKASNIRVSAGVALQWMSPLGPLVFSYAKPVKDYEG 780

Query: 768 DKIQQFGFRIG 778
           DK +QF F IG
Sbjct: 781 DKSEQFQFNIG 791


>gi|227821904|ref|YP_002825874.1| group 1 outer membrane protein precursor [Sinorhizobium fredii
           NGR234]
 gi|227340903|gb|ACP25121.1| group 1 outer membrane protein precursor [Sinorhizobium fredii
           NGR234]
          Length = 777

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 270/778 (34%), Positives = 435/778 (55%), Gaps = 5/778 (0%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   R L      +     +        +++   +  +++ R+E+RGAT V  E + + 
Sbjct: 1   MKAGSRFLNAVSAFALSASMVATGTGAALVASTSVAQAAVISRVEVRGATRVSPETVRAN 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           I +V G+S S+AD+D +VK +YA GYFS+V I I    L++++ E +++N + F+GN  +
Sbjct: 61  ITIVPGKSFSNADIDASVKRLYATGYFSDVSISISGGTLVVNVSENQLVNQVVFNGNRKI 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KDD+L+ +VR++    Y E TV  D+  IK AYA+IG  +V V  Q   I+   +N+ +V
Sbjct: 121 KDDKLQGVVRTQPLGPYSEATVETDIQAIKDAYAAIGRSDVTVTTQVVPIAEGRVNLAFV 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRA 246
           I EG + KI  I FVGN+ YS  RL+ VI+ + SG FSF  + DVY+ +++  DEE +R 
Sbjct: 181 INEGERTKITQINFVGNEAYSDGRLQSVIATKESGIFSFLTRKDVYNPDKLRADEELLRQ 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++RGYA   + S      +  + Y +   ++EG  Y  G I+++ST++ +  + L  L
Sbjct: 241 FYYNRGYADFNIISSEATLNEATNEYTVTITVEEGPRYDFGAINVESTVEGVNAEELKGL 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           ++ R G++Y  ++I+++  +ISK   S   PF RV  R NRD A   + ++YL+DQG   
Sbjct: 301 VQSREGSVYKAKDIQDTMSEISKRVASAGYPFARVTPRGNRDLANHTIAVDYLVDQGERA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RIEI GN ++ D VIRRE ++ EGD  N  MI RAKRR+ A GYFS VNI+  P + 
Sbjct: 361 YVERIEIRGNTRTRDYVIRREFDVGEGDAFNQEMIARAKRRLEALGYFSSVNITTAPGSA 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
               +++     Q +      A       G  +     +   F    +    A       
Sbjct: 421 ADRVIVVVDVQDQSTGSFGIGAGYAAGSGGGFLVEASIEEKNFLGRGQYIRLAAGKGEDS 480

Query: 486 QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
           Q Y  S  +PYFLG  ++AGFDL K   +    + +       + V    + + S     
Sbjct: 481 QTYNVSFTEPYFLGYRLAAGFDLFKNEHDFDDDNYSYNDQGFSLRVTAPITENLSTTLRY 540

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            + +     +++++ S Y  ++E   ++  S+SQS+ YNTLD+  +P +G+L S + ++A
Sbjct: 541 NYTELEYFGDQDELSSPYDRVVEDSPWTRSSVSQSVTYNTLDDAQLPHEGILASVTQEFA 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G GG S ++++  +A ++Y ++D++DI+ SL    G +  ++ ++++FDQF +  +  +R
Sbjct: 601 GLGGTSDFYKLTGKAKWYYTVNDEADIIASLAGSAGHLFKTSGSMEVFDQFQLG-SNDIR 659

Query: 666 GFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAL 725
           GF   GIGPRV+   A+GG  Y +ASA  SFP+P +P  +G RGA FVD+ TLY N VAL
Sbjct: 660 GFERNGIGPRVNNGDALGGTTYFTASAEASFPLPGIPRDSGFRGALFVDAGTLYGNDVAL 719

Query: 726 GADK--LEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                  EG D+  RVS GV ++W SP G + V Y +P+   + D+IQ F F I +  
Sbjct: 720 TGAGEFAEGTDASLRVSVGVSLIWASPFGPLRVDYAVPVAKEDFDEIQNFKFGINSSF 777


>gi|254236562|ref|ZP_04929885.1| hypothetical protein PACG_02561 [Pseudomonas aeruginosa C3719]
 gi|126168493|gb|EAZ54004.1| hypothetical protein PACG_02561 [Pseudomonas aeruginosa C3719]
          Length = 795

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 168/794 (21%), Positives = 330/794 (41%), Gaps = 39/794 (4%)

Query: 26  GFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAV 85
            F++       + A   + +  V  I + G   V    + + +P+ VG++I D  L  A 
Sbjct: 3   RFLLPALLSALMIAEVHAESFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQAT 62

Query: 86  KNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAA 142
           ++++  G+F ++++    +VL++ ++ER  I+ +   GN  +  + L   ++        
Sbjct: 63  RSLFKTGFFQDIQLGRDGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGE 122

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            +   T+    + +++ Y + G  +  +  +        + +   I EG  A I+ I  V
Sbjct: 123 IFQRATLEGVRNELQRQYVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVV 182

Query: 203 GNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           GN  +S   L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S 
Sbjct: 183 GNTVFSEEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIAST 242

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
            +       +V I                 +   ++ ++ +  L+ ++ G +++ + +  
Sbjct: 243 QVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTT 302

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           +S+ I++   +    F  V          + V + +++D G   YV RI   GN ++ D 
Sbjct: 303 TSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDE 362

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           V+RRE+   EG   +  +I+++K R+   GYF EVN+         D V +  SV++  +
Sbjct: 363 VLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPS 422

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSP 501
           GS+  +  +    G+ + G I  NNF G G +  +           Y F   DPY+    
Sbjct: 423 GSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYWTVDG 481

Query: 502 ISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G++      +   LD++  S +V      M +    S ++   Y L   +    + +
Sbjct: 482 VSLGYNAFYRKTDYDELDVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGR 541

Query: 557 EKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
             +  IY  L + G  F++   S     +TL+  ++  +G   S + +    G D  +++
Sbjct: 542 YTVDEIYDFLDKEGDNFTNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYK 601

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           I  R   F  L+D+  +      GYG    S + L  ++ +       +RGF    +GPR
Sbjct: 602 IDYRGQVFAPLTDNYTMRFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPR 661

Query: 676 --------------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRG 709
                                          A GG I  +  A + FP+P V ++  LR 
Sbjct: 662 STPSVARDGNGNQIVGPDSKGRYTDPDQDPEAFGGNILITGGAELLFPLPFVKDQRQLRT 721

Query: 710 AFFVDSATLYANHVA--LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG 767
             F D  + +          +           S GV + W + LG +      P++  + 
Sbjct: 722 VLFWDVGSTFDTDCPTKTTTNCDGIKTDNLASSVGVGLTWITALGPLSFSLATPIKKPDN 781

Query: 768 DKIQQFGFRIGNRM 781
            + Q F F +G   
Sbjct: 782 AETQVFQFSLGQTF 795


>gi|300724786|ref|YP_003714111.1| putative outer membrane antigen [Xenorhabdus nematophila ATCC
           19061]
 gi|297631328|emb|CBJ92023.1| putative outer membrane antigen [Xenorhabdus nematophila ATCC
           19061]
          Length = 796

 Score =  392 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 181/793 (22%), Positives = 319/793 (40%), Gaps = 37/793 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG +  YGS+  +VR I   G   V     L  +P+ VG  +SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATAYGSDGFVVRDIHFEGLQRVTVGAALLNMPIRVGDPVSDEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
             +  ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  RTIHALFATGNFEDVRVLRDGNSLVVQVKERPTIASITFSGNKSVKDDMLKQNLEASRIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   ++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTMLSNIEKGLEDFYYSVGKYSAAVKAVVTPLPRNRVDLKLVFSEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L     +R    +     D  Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSTNELLNYFQLRDDIPWWNMTADQKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I                 +      +  +  L +I  G+LYN  E
Sbjct: 241 DSTQVNLTPDKKGIYITVNITEGDQYKIAGVDLNGNLVGYQSQIAELTKIEPGSLYNGTE 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +    I          + RV T+   D A + V +   +D G+  YV++I   GND S
Sbjct: 301 VTKMETAIKNLLGRHGYAYPRVMTQPEIDDADKTVKLHVNVDAGNRFYVRKIRFSGNDVS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +   ++E+ K R+   GYF  V++         D V +   VK+
Sbjct: 361 KDMVLRREMRQMEGAWLGSDLVEQGKERLNRLGYFESVDVDTERVPGSQDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRH----AVQNYTFSVED 494
            + GS+  +  +  + GM  +  +  +N+ G G    ++A    +     +         
Sbjct: 421 RNTGSMNFSVGFGTESGMSFQVGVQQDNWLGTGNSVAVSATKNDYSKSADLSVTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +  +           +  P+ E+ S +F+          + 
Sbjct: 481 NGVSLGGRLFYSDFGAAAADLSNYTNKGYGTEGLLGFPLNENNSLNFRLGYVHNSLSNMR 540

Query: 555 EKEKIP--------SIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +         +           +  +++    YN+L+    P  G+  S       
Sbjct: 541 PQAAMWRYLNKMGKNPGMDDKAKFDTNDFTMTVGWSYNSLNRGFFPTSGLRSSLDTKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGY-GCVIPSNKNLQLFDQFSVSSNYYLR 665
            G  +Q++++   +S +Y L DD   V + R           K +  ++ F    +  +R
Sbjct: 601 PGLSNQFYKVTWNSSGYYPLDDDHSWVLAGRSRLGYGGGFGGKEMPFYENFYAGGSNSVR 660

Query: 666 GFAYKGIGPRV----------------DKKYAIGGKIYSSASAAVSFPMPLV--PERAGL 707
           GF    IGP+                   + A+GG   + AS  +  P P +       +
Sbjct: 661 GFRSNNIGPKAIYLENGKEGIKPVKNSPSRDAVGGNAVAVASFELITPTPFLDAKYSNSV 720

Query: 708 RGAFFVDSATLYANHV--ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHR 765
           R + FVD+ T++  +              +  RVS G+ + W SPLG + + Y  P++  
Sbjct: 721 RTSVFVDAGTVWDTNWTKTYAGMPDYSKPNNIRVSAGIALQWLSPLGPLSLSYAKPIKDY 780

Query: 766 EGDKIQQFGFRIG 778
           EGD+ +QF F IG
Sbjct: 781 EGDRSEQFQFNIG 793


>gi|167033575|ref|YP_001668806.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           putida GB-1]
 gi|166860063|gb|ABY98470.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           putida GB-1]
          Length = 799

 Score =  392 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 166/775 (21%), Positives = 325/775 (41%), Gaps = 33/775 (4%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           + +  ++   +  I + G   V    +   +P+ VG    D  L  + ++++  G+F ++
Sbjct: 27  ATLAQASPFRIADIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVDSTRSLFKTGFFQDI 86

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVH 154
           ++    +VLII+++ER  ++ +   GN  +  + L   ++         +   T+    +
Sbjct: 87  QLNRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAEGEIFQRATLEGVRN 146

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
            +++ Y + G  +  V  +        + +   I EG  A I  I  VGN  +    L +
Sbjct: 147 ELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHINIVGNNVFDDETLGQ 206

Query: 215 VISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVL 273
           +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S  +       +V 
Sbjct: 207 LFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIASTQVSITPDKKHVY 266

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
           I                 S   ++ +  + SL+ ++ G +++ + +  +SE I++   + 
Sbjct: 267 ITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVMTTTSELITRRLGNE 326

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
              F  V      +     VDI +++D G   YV RI   GN ++ D V+RRE+   EG 
Sbjct: 327 GYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTEDEVLRREMRQMEGG 386

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             +  +I+++K R+   G+F EVN+   P     D V +  SV++ ++GS+  +  +   
Sbjct: 387 WASTYLIDQSKTRLERLGFFKEVNVETPPVPGTDDQVDVNYSVEEQASGSITASVGFAQS 446

Query: 454 KGMGVEGHIDDNNFFGQGY-------RARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGF 506
            G+ + G I  +NF G G        R+     +       Y  +           ++  
Sbjct: 447 AGLILGGSISQSNFLGTGNKVAIGLTRSEYQTKYNFGFTDPYFTADGVSLGYNLFYNSTD 506

Query: 507 DLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTL 566
                        IN   A V    PI+E+   S+   L+       +       IY  +
Sbjct: 507 YSDYYDDGVSYYAINSYGAGVSFGYPISETSRLSYGLTLQHDDLSPGTY--SADEIYDFI 564

Query: 567 IEHGK-FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              GK F++   S     +TL+  ++  +G   S +      G D  ++++      +  
Sbjct: 565 SREGKSFNNLKASIGWSESTLNKGVLATRGHSQSLTLMATTPGSDLSFYKLDYNGQAYLP 624

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---------- 675
           +++++ +      GYG    S   L  ++ ++      +RGF    +GPR          
Sbjct: 625 VTNNTALRLHTSLGYGNGYGSTDGLPFYESYTAGGQGSVRGFKDGTLGPRNTPATGAYAR 684

Query: 676 -------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGAD 728
                        +GG I  +  A   FP+P V +++ LR + FVD+  +YA+   L   
Sbjct: 685 SGQAYYSDRDTDVLGGNILITGGAEYIFPLPFVKDQSQLRSSLFVDAGNVYADTCYLSTT 744

Query: 729 KLEG--NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +  G  + +   VS GV + W SP+G +      PL+  +  + Q F F +G   
Sbjct: 745 QGCGSVDLAQMAVSLGVGVTWYSPMGPLSFSLAAPLKKPDNAETQIFQFSLGQTF 799


>gi|15598844|ref|NP_252338.1| outer membrane protein Opr86 [Pseudomonas aeruginosa PAO1]
 gi|313109053|ref|ZP_07795025.1| putative outer membrane antigen [Pseudomonas aeruginosa 39016]
 gi|9949808|gb|AAG07036.1|AE004784_9 outer membrane protein Opr86 [Pseudomonas aeruginosa PAO1]
 gi|310881527|gb|EFQ40121.1| putative outer membrane antigen [Pseudomonas aeruginosa 39016]
          Length = 797

 Score =  392 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 168/796 (21%), Positives = 330/796 (41%), Gaps = 41/796 (5%)

Query: 26  GFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAV 85
            F++       + A   + +  V  I + G   V    + + +P+ VG++I D  L  A 
Sbjct: 3   RFLLPALLSALMIAEVHAESFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQAT 62

Query: 86  KNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAA 142
           ++++  G+F ++++    +VL++ ++ER  I+ +   GN  +  + L   ++        
Sbjct: 63  RSLFKTGFFQDIQLGRDGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGE 122

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            +   T+    + +++ Y + G  +  +  +        + +   I EG  A I+ I  V
Sbjct: 123 IFQRATLEGVRNELQRQYVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVV 182

Query: 203 GNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           GN  +S   L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S 
Sbjct: 183 GNTVFSEEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIAST 242

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
            +       +V I                 +   ++ ++ +  L+ ++ G +++ + +  
Sbjct: 243 QVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTT 302

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           +S+ I++   +    F  V          + V + +++D G   YV RI   GN ++ D 
Sbjct: 303 TSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDE 362

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           V+RRE+   EG   +  +I+++K R+   GYF EVN+         D V +  SV++  +
Sbjct: 363 VLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPS 422

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSP 501
           GS+  +  +    G+ + G I  NNF G G +  +           Y F   DPY+    
Sbjct: 423 GSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYWTVDG 481

Query: 502 ISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G++      +   LD++  S +V      M +    S ++   Y L   +    + +
Sbjct: 482 VSLGYNAFYRKTDYDELDVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGR 541

Query: 557 EKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
             +  IY  L + G  F++   S     +TL+  ++  +G   S + +    G D  +++
Sbjct: 542 YTVDEIYDFLDKEGDNFTNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYK 601

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           I  R   F  L+D+  +      GYG    S + L  ++ +       +RGF    +GPR
Sbjct: 602 IDYRGQVFAPLTDNYTMRFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPR 661

Query: 676 ----------------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGL 707
                                            A GG I  +  A + FP+P V ++  L
Sbjct: 662 STPSVARNPDGTPMKNQGPDSKGRYTDPDQDPEAFGGNILITGGAELLFPLPFVKDQRQL 721

Query: 708 RGAFFVDSATLYANHVA--LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHR 765
           R   F D  + +          +           S GV + W + LG +      P++  
Sbjct: 722 RTVLFWDVGSTFDTDCPTKTTTNCDGIKTDNLASSVGVGLTWITALGPLSFSLATPIKKP 781

Query: 766 EGDKIQQFGFRIGNRM 781
           +  + Q F F +G   
Sbjct: 782 DNAETQVFQFSLGQTF 797


>gi|320540039|ref|ZP_08039695.1| outer membrane protein assembly factor [Serratia symbiotica str.
           Tucson]
 gi|320029888|gb|EFW11911.1| outer membrane protein assembly factor [Serratia symbiotica str.
           Tucson]
          Length = 801

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 186/799 (23%), Positives = 330/799 (41%), Gaps = 44/799 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I+D D+ 
Sbjct: 1   MAMKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTITDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDCNTLIVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +++  L     +R    +        Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHAFTNDELISRFQLRDEVPWWNLVGDRKYQKQKLSGDLENLRSFYLDRGYACFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  + +       +    L +I  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINMTEGEQYKLSEVVVNGNLAGHSQEAAQLTKIEPGELYNGGK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + I          + RV T+   +   + V +   +D G+  YV+RI+ EGN+ S
Sbjct: 301 VTNMEDNIKTMLGRYGYAYPRVATQPEINDQDKTVKLNVNVDAGNRFYVRRIKFEGNNTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E+ K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNVQVEQGKERLNRLGYFETVDVETQRVPSSADQVDVIYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFL 498
            + GS      Y  + G+  +  +  +N+ G GY   +      +         +  + +
Sbjct: 421 RNTGSFNFGIGYGTESGVSFKMGMQQDNWLGTGYSVGINGSKNNYQTYTELSVTDPYFTM 480

Query: 499 GSPI--SAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
                    F            D  ++S  V   +    + + S +  L ++  G  + +
Sbjct: 481 DGVSLGGRVFYNNFKADNADLSDYTNKSYGVDGTLGFPINENNSLRSCLGYVHNGLSNMQ 540

Query: 557 EKIP----------SIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +I              T           +++    +N LD    P  G   + +     
Sbjct: 541 PQIAMWRYLKSVGMEPNTVDRASYSADDFTLNLGWTHNDLDRGYFPTSGNRTTLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G D++Y+++   +  +  +++D   V     R  Y   +   K    ++ F    +  L
Sbjct: 601 PGSDNKYYKVTLDSVQYVPINNDHTWVLLGRGRLSYADGLG-GKETPFYENFYAGGSSTL 659

Query: 665 RGFAYKGIGPRV-----------------DKKYAIGGKIYSSASAAVSFPMPLVPERAG- 706
           RGF    IGP+                  +   A+GG   + AS  +  P P + E+   
Sbjct: 660 RGFQSNTIGPKAVYYNSHSHSCADKTKICNSDNAVGGNAMAVASLELITPTPFISEKYAN 719

Query: 707 -LRGAFFVDSATLYANHVALGADKLEGN------DSFWRVSTGVEIMWNSPLGMMGVYYG 759
            +R + F+D+ T++       AD L+ +       S  R S GV + W SPLG +   Y 
Sbjct: 720 LVRTSLFLDTGTVWDTKWQNTADTLKYDVPDYNKVSNIRASFGVALQWMSPLGPLVFSYA 779

Query: 760 IPLRHREGDKIQQFGFRIG 778
            PL+  +GDK +QF F IG
Sbjct: 780 KPLKKHDGDKSEQFQFNIG 798


>gi|270261868|ref|ZP_06190140.1| outer membrane protein assembly factor YaeT [Serratia odorifera
           4Rx13]
 gi|270043744|gb|EFA16836.1| outer membrane protein assembly factor YaeT [Serratia odorifera
           4Rx13]
          Length = 814

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 191/806 (23%), Positives = 314/806 (38%), Gaps = 50/806 (6%)

Query: 22  SFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
             +M   I+        + Y ++  +V+ I   G   V     L  +PV VG ++SD D+
Sbjct: 7   PIKMKKSIVAMLFLNSLSAYAADGFLVKDIHFEGLQRVAPGAALLSMPVRVGDTLSDEDI 66

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS--- 138
            + ++ ++  G F +V+I   D VLII + ER  I  + FSGN  +KDD LK  + S   
Sbjct: 67  SNTIRALFTTGNFDDVQILRDDHVLIIKVKERPTIAGISFSGNKTVKDDMLKHNLESSGV 126

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R   A D  T+++    ++  Y S+G  N  VK     +    +++  V  EGV AKI  
Sbjct: 127 RVGEALDRTTLSSIEQGMEDFYYSVGKYNARVKAVITPLPRNRIDLKLVFTEGVSAKIQQ 186

Query: 199 IRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  +GN+ +    L   + +R    +        Y K++++ D E +R+FY DRGYA  K
Sbjct: 187 INVIGNQAFRTDELLANLQLRDDVPWWNLASDRKYQKQKLAGDLETLRSFYLDRGYANFK 246

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           + S  +        + I          + +  + +         + +L  I+ G LYN  
Sbjct: 247 IDSTQVSLTPDKKGIYITINLNEGSQYLLSGVVLNGNMAGHLPQIAALTNIQPGELYNGA 306

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           +I      I +        F  V      +   + V +   +D G    V+RI  EGN  
Sbjct: 307 KITRMENDIKQLLGRYGYAFPLVGIEPEINQKAKTVKLHVNVDAGKRYSVRRIRFEGNGT 366

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S DSV+RRE+   EG  +    +E+ K+R+  TG+F  V           D V +   VK
Sbjct: 367 SKDSVLRREMRQMEGAWLGNDQVEQGKQRLNRTGFFETVETETQRVPGSPDQVDVVYKVK 426

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVE 493
           + + G+      Y  D G   +  +  +N+ G G                          
Sbjct: 427 ERNTGTFNFGLGYGTDSGASFQVGVSQDNWLGSGNTVGFNGTKSDSQTYIELSMTDPYFT 486

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL-------- 545
                     +  D      +     +        +  PI E+ S     D         
Sbjct: 487 VDGVSLGGKISYNDYDAEDDDLSEYTMKSLGIGGNLGFPIGENSSLGLGLDYANTRLSGM 546

Query: 546 -----RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
                 +    +++    I +           +    S    YNTLD    P  G   S 
Sbjct: 547 APQVAMWRYLNSVNVNPGITTQDNDNDARFTANDFFTSVGWNYNTLDRGFFPTDGTSASL 606

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLS--DDSDIVGSLRFGYGCVIPSNKNLQLFDQFSV 658
           +      G  + Y+++   A+ +  LS  +   ++G  + GY         +  +D F+ 
Sbjct: 607 NAKITVPGSTNSYYKVTFSANQYLPLSSDNKWIVMGRTKAGYADGFG-GHEVPFYDNFNA 665

Query: 659 SSNYYLRGFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPL 700
             +  +RGF+   IGP+                       A+GG   + AS  + FP P 
Sbjct: 666 GGSSSVRGFSSNSIGPKAAYYHCSGSESAYSDCPVDKSDDAVGGNAMAIASTELIFPTPF 725

Query: 701 VPERA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLG 752
           + +R    LR + FVD+ T++  H    +  L       G+ S  RVS G+ + W SPLG
Sbjct: 726 INDRYANSLRTSLFVDAGTVWDTHWQNTSQTLAAGIPDYGDPSNVRVSAGIALQWQSPLG 785

Query: 753 MMGVYYGIPLRHREGDKIQQFGFRIG 778
            +   Y  P++  EGDK +QF F IG
Sbjct: 786 PLSFSYAFPIKKYEGDKAEQFQFNIG 811


>gi|260767817|ref|ZP_05876752.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           furnissii CIP 102972]
 gi|260617326|gb|EEX42510.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           furnissii CIP 102972]
 gi|315179353|gb|ADT86267.1| outer membrane protein assembly factor/surface antigen [Vibrio
           furnissii NCTC 11218]
          Length = 802

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 172/802 (21%), Positives = 312/802 (38%), Gaps = 43/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+    +    +   +   +V+ I+I+G   V     L ++PV +G ++   D+ 
Sbjct: 1   MAMKKILFATLLATSVSANSAENFVVQDIQIQGLQRVALGAALLKMPVRIGDTVDSQDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K +YA G F NVK+    + L++++ ER  I  + FSGN  +K++QL+  +     R
Sbjct: 61  AIIKALYASGNFENVKVLRDGNALVVEVKERPTIASVSFSGNKAIKEEQLQQNLDASGIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   ++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTKLSNIEKGLEDFYYSVGKYNATVKAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ +S   L    +++    +++F   D Y K+ ++ D EA+R FY DRGY   +V
Sbjct: 181 NFIGNEVFSDKELLSRFNLKVDVAWWNFLSDDKYQKQVLAGDIEALRTFYLDRGYLKFQV 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        V I    +                  ++    SLI    G  Y    
Sbjct: 241 DSTQVSISPDKKGVYITMNLDEGKPYTVKDVQFRGELIGKEDEFKSLIPFEMGETYRGSS 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +  E + +        + +V+T    D   + V +   ++ G  +YV+ I   GN+ +
Sbjct: 301 VTQLEESVKRVLGEAGYAYPQVRTIPEFDDETQQVSLVVHVETGKRMYVRDIRFVGNNAT 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +N   I+  K R+   G+F  V++  +      D V L  +VK+
Sbjct: 361 RDEVLRREMRQMEGAWLNSKSIDTGKARLNRLGFFETVDVQTVRVPGTEDQVDLVYTVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVEDP 495
            ++GSV     Y  + G+     +  +NF G G R  + A    + ++    Y     + 
Sbjct: 421 ANSGSVNFGVGYGTESGVSFTVGLTQDNFLGTGNRVGINATTNDYQKNVTLEYRDPYWNL 480

Query: 496 YFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITES-ISTSFKYDLRFLQYGAIS 554
             +       ++  +          N+            +      F       + G ++
Sbjct: 481 DGVSLGGKVFYNQFEASEAGIVDYTNESYGTSLTWGFPFDELNRFEFGVGYTHNKIGNLT 540

Query: 555 EKEKIPSIYTTLIEHGK----FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
              ++      L +            ++ +   N L+    P  G    +S      G D
Sbjct: 541 PYLQVEQFLCNLGDCSPDNLITDDFDVNVAWTRNNLNKGYFPTAGNYQRASGKITVPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDS--DIVGSLRFGYGCVIP---SNKNL-QLFDQFSVSSNYYL 664
           ++Y ++      +  L+      ++   R GYG        N NL   ++ F       L
Sbjct: 601 AKYFKLQYDVRQYVPLTKKHEFTLLLRGRLGYGNGYGQTDGNDNLYPFYENFYAGGFTTL 660

Query: 665 RGFAYKGIGPR--------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA--GLR 708
           RGF     GP+                   ++GG   + AS  +  P P   + A   +R
Sbjct: 661 RGFGSNTAGPKAVYRDYSGSNNGSDTATDNSVGGNAIALASIELIVPTPFASDEARSQVR 720

Query: 709 GAFFVDSATLYANHVALGADK---------LEGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            + F D A+++       +              + + +R S GV + W SP+G +     
Sbjct: 721 TSIFYDMASVWDTEFDYRSSGADYGNNYYYDYSDPTNYRSSYGVALQWMSPMGPLVFSLA 780

Query: 760 IPLRHREGDKIQQFGFRIGNRM 781
            P++  EGD  + F F IG   
Sbjct: 781 KPIKKYEGDDEEFFTFTIGRTF 802


>gi|238763970|ref|ZP_04624926.1| Outer membrane protein assembly factor yaeT [Yersinia kristensenii
           ATCC 33638]
 gi|238697787|gb|EEP90548.1| Outer membrane protein assembly factor yaeT [Yersinia kristensenii
           ATCC 33638]
          Length = 795

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 182/792 (22%), Positives = 319/792 (40%), Gaps = 36/792 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  QTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  + S      +     L +I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGDQYKLNSVVVSGNLAGHQSEADKLTKIEPGELFNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    +      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGLGYVHNDLSDME 540

Query: 555 EKEKIPSIYTTLIEHGKFS--------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +   ++          +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLESVGQRPDYTGRTGFTTDDFTLNLGWTYNNLDRGFFPTSGVKSSVNTKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
            G D++++++    S +  L +D   V              +K +  ++ F       +R
Sbjct: 601 PGSDNEFYKVTFDTSAYQPLDEDRSWVLLGRGRLGYGGGIGSKEMPFYENFYAGGASSVR 660

Query: 666 GFAYKGIGPRV-----------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAFF 712
           GF    IGP+            +   A+GG   + AS  +  P P + E+    +R + F
Sbjct: 661 GFRSNNIGPKAAYYGNNGTTVSNSTDAVGGNAMAVASLELITPTPFISEKYSNSVRTSVF 720

Query: 713 VDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
           +DS T++  +    A+            S  RVS GV + W SPLG +   Y  P++  E
Sbjct: 721 IDSGTVWDTNWENTAETRAAGIPDYSKASNIRVSAGVALQWMSPLGPLVFSYAKPVKDYE 780

Query: 767 GDKIQQFGFRIG 778
           GDK +QF F IG
Sbjct: 781 GDKSEQFQFNIG 792


>gi|261822591|ref|YP_003260697.1| outer membrane protein assembly factor YaeT [Pectobacterium
           wasabiae WPP163]
 gi|261606604|gb|ACX89090.1| outer membrane protein assembly complex, YaeT protein
           [Pectobacterium wasabiae WPP163]
          Length = 815

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 187/813 (23%), Positives = 328/813 (40%), Gaps = 58/813 (7%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ 
Sbjct: 1   MAIKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGETLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   + +    ++  Y S+G  +  VK     +    +++  V  EGV A+I  I
Sbjct: 121 VGEALDRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAQIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +              +  L +I SG LYN  +
Sbjct: 241 DSTQVSLTPDRKGIYITINMTEGEQYKLSGVAVKGNLAGHSAEIEGLTKIESGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+ + + A + V +   +D G+  YV+ +  +GND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPDINDADKTVRLNINVDAGNRFYVRHVRFDGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +   ++E+ K R+   GYF  V +       V+D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDLVEQGKERLNRLGYFESVEVETQRVPGVADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      +  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISGTKNDYQTYVELSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                         + +  +              +  PI E+ S     D        + 
Sbjct: 481 DGVSLGGRIFYNKFEASDADLSDYTNVSYGVGSTLGFPINENNSLRVGLDYVHNDLSDMR 540

Query: 555 EKEKIPSI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
            +  +                        K +   ++    YN LD    P KG   S++
Sbjct: 541 PQVAMWRYLDSVGVNPSVVGENVKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASAN 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
              A  G D++Y+++   ++ +Y LSD  +  ++G  R G+   I S K +  +D F   
Sbjct: 601 AKIAVPGSDNEYYKLTFDSASYYPLSDSGNWVVMGRTRAGFADGIGS-KEVPFYDNFYAG 659

Query: 660 SNYYLRGFAYKGIGPRVDK--------------------------KYAIGGKIYSSASAA 693
            +  +RGF    IGP+                               A+GG   +  SA 
Sbjct: 660 GSSTVRGFQSNTIGPKAAYYQCRPATQGGALPPSYSGCGIDKTNLDDAVGGNAMAVLSAE 719

Query: 694 VSFPMPLVPERA--GLRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEI 745
           +  P P + ++    +R +FFVD  T++  +       ++         S +RVS+G+ +
Sbjct: 720 LIVPTPFISDKYASSVRTSFFVDGGTVWDTNWKNTQATIDAGVPDYSKASNFRVSSGIAL 779

Query: 746 MWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
            W SPLG +   Y  P++  +GDK +QF F IG
Sbjct: 780 QWMSPLGPLVFSYAQPVKKYDGDKSEQFQFNIG 812


>gi|152986344|ref|YP_001346875.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           aeruginosa PA7]
 gi|150961502|gb|ABR83527.1| outer membrane protein assembly complex, YaeT protein [Pseudomonas
           aeruginosa PA7]
          Length = 797

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 168/796 (21%), Positives = 330/796 (41%), Gaps = 41/796 (5%)

Query: 26  GFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAV 85
            F++       + A   + +  V  I + G   V    + + +P+ VG+++ D  L  A 
Sbjct: 3   RFLLPALLSALMIAEVHAESFTVSDIRVNGLQRVSAGSVFAALPLNVGETVDDQSLVQAT 62

Query: 86  KNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAA 142
           ++++  G+F ++++    +VL++ ++ER  I+ +   GN  +  + L   ++        
Sbjct: 63  RSLFKTGFFQDIQLGRDGNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGE 122

Query: 143 AYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFV 202
            +   T+    + +++ Y + G  +  +  +        + +   I EG  A I+ I  V
Sbjct: 123 IFQRATLEGVRNELQRQYVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVV 182

Query: 203 GNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           GN  +S   L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S 
Sbjct: 183 GNTVFSEEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIAST 242

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
            +       +V I                 +   ++ ++ +  L+ ++ G +++ + +  
Sbjct: 243 QVSITPDKKHVYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTT 302

Query: 322 SSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDS 381
           +S+ I++   +    F  V          + V + +++D G   YV RI   GN ++ D 
Sbjct: 303 TSDLITRRLGNEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDE 362

Query: 382 VIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSA 441
           V+RRE+   EG   +  +I+++K R+   GYF EVN+         D V +  SV++  +
Sbjct: 363 VLRREMRQMEGGWASTYLIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPS 422

Query: 442 GSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSP 501
           GS+  +  +    G+ + G I  NNF G G +  +           Y F   DPY+    
Sbjct: 423 GSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYWTVDG 481

Query: 502 ISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEK 556
           +S G++      +   LD++  S +V      M +    S ++   Y L   +    + +
Sbjct: 482 VSLGYNAFYRKTDYDELDVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGR 541

Query: 557 EKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
             +  IY  L + G  F++   S     +TL+  ++  +G   S + +    G D  +++
Sbjct: 542 YTVDEIYDFLDKEGDNFTNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYK 601

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           I  R   F  L+D+  +      GYG    S + L  ++ +       +RGF    +GPR
Sbjct: 602 IDYRGQVFAPLTDNYTMRFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPR 661

Query: 676 ----------------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGL 707
                                            A GG I  +  A + FPMP V ++  L
Sbjct: 662 STPSVARDANGNRLPDGVPDSKGRYTDPDQDPEAFGGNILITGGAELLFPMPFVKDQRQL 721

Query: 708 RGAFFVDSATLYANHVA--LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHR 765
           R   F D  + +          +           S GV + W + LG +      P++  
Sbjct: 722 RTVLFWDVGSTFDTDCPTKTTTNCDGIKTDNIASSVGVGLTWITALGPLSFSLATPIKKP 781

Query: 766 EGDKIQQFGFRIGNRM 781
           +  + Q F F +G   
Sbjct: 782 DNAETQVFQFSLGQTF 797


>gi|222110434|ref|YP_002552698.1| outer membrane protein assembly complex, yaet protein [Acidovorax
           ebreus TPSY]
 gi|221729878|gb|ACM32698.1| outer membrane protein assembly complex, YaeT protein [Acidovorax
           ebreus TPSY]
          Length = 765

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 177/778 (22%), Positives = 322/778 (41%), Gaps = 24/778 (3%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           + K+  R        L   +F   A +      V+ I + G   V    I + +P+ VG 
Sbjct: 1   MRKHINRLGVRTASALAAMVFASQAAWALAPFKVQDIRVEGLQRVEPGTIFASLPLRVGD 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
             +D     A++ ++A+G F +V+++   +VL++ + ER  I  + F+G      D LK 
Sbjct: 61  EYNDDKGAAAIRALFALGLFKDVRLEASGNVLVVVVEERPTIADVDFAGTKEFDKDTLKK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +          +D+   +     +K+ Y +       V      I    +N+T+ + EG
Sbjct: 121 AMRDVGLTEGRPFDKALADRAEQELKRQYINRSLYGAEVVTTVTPIERNRVNLTFTVTEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKI  IR VGNK +S + L+ +    T G+   + K++ YS+ +++ D E +R++Y  
Sbjct: 181 EPAKIKEIRIVGNKAFSESTLKGLFDQDTGGWMSWYTKSNRYSRAKLNADLETLRSYYLA 240

Query: 251 RGYAAVKVSSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIR 309
           RG+   ++ S        K    +   ++EG+ Y V  + ++    +       SLI IR
Sbjct: 241 RGFLEFRIESTQVAISPDKQDISITVNVNEGQSYVVSGVKLEGNYLDRD-DEFKSLITIR 299

Query: 310 SGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKR 369
            G  YN  ++ E+++  + +F +    F RV+     D     V +    +     YV+R
Sbjct: 300 PGEPYNADKVAETTKAFTDHFGNFGFAFARVEAVPEIDRENNRVALVLRAEPSRRAYVRR 359

Query: 370 IEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDY 429
           I + GN+++ D VIRRE    E    +   I+ ++ R+   GYF+EVN+         D 
Sbjct: 360 INVSGNNRTRDEVIRREFRQFEASWYDGDKIKLSRDRVDRLGYFTEVNVETQEVPGAPDQ 419

Query: 430 VILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT 489
           V L V+V +   GS+ +   +   + + V   I   N FG G    +     ++      
Sbjct: 420 VDLVVNVAEKPTGSLQLGAGFSSAEKVSVSFAIKQENVFGSGNYLGVDVNTSKYRRTLVF 479

Query: 490 ----FSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
                         +        +    + G+ ++     +VR+ VP +E+ +  F   +
Sbjct: 480 STTDPYFTQDGISRTFDVYYRTAKPYEDQGGNYELVTAGTSVRLGVPFSETDTVFFGGGV 539

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHS--ISQSIIYNTLDNPIVPRKGMLISSSYD 603
              +  A +    IP+ Y    +    +S S  ++     +  D+ + P  G     +  
Sbjct: 540 EQTRIKAGT---NIPAAYLAYAQQFGETSLSVPLTIGWSRDDRDSALAPNSGRYQRLN-S 595

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
                GD++Y R   +   +  L+    I  +   G G  + + +   +F  F       
Sbjct: 596 EWSVAGDARYVRANYQYQQYIPLNKQFTIAFNGELGLGKGM-NGRPFPVFKNFYSGGLGS 654

Query: 664 LRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHV 723
           +RGF    +GPR     ++GG    + +A +  P P       LR   FVD+  +Y    
Sbjct: 655 VRGFDQGTLGPRDVTGASLGGPKKITLNAELIAPFPGAGNDRTLRWFTFVDAGNVYGEDE 714

Query: 724 ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +             RVS G+ + W SPLG + +    P+R   GDKIQ+  F+IG   
Sbjct: 715 S-------WELGDMRVSAGLGLSWISPLGPLRIAIAQPVRKFAGDKIQKLQFQIGTSF 765


>gi|146308066|ref|YP_001188531.1| surface antigen (D15) [Pseudomonas mendocina ymp]
 gi|145576267|gb|ABP85799.1| surface antigen (D15) [Pseudomonas mendocina ymp]
          Length = 786

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 171/787 (21%), Positives = 329/787 (41%), Gaps = 31/787 (3%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+ + D  L  
Sbjct: 1   MKRLLLPAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQVDDRQLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRS 140
           A ++++  G+F ++++     VL+I ++ER  I+ +   GN  +  + L   +       
Sbjct: 61  ATRSLFRTGFFQDIQLGRDGDVLVITVVERPSISGIEIEGNKAITTEDLLKGLNQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  ++ +        + +   I EG  A I+ I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEIQAEVIPQPRNRVALKITINEGTVAAISHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + +S
Sbjct: 181 VVGNTVFSDEDLTDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIS 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +       +V I    E            S   ++ ++ + +L+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKHVYITVNVEEGEKYSVRDVKLSGDLKVPEEDVRALLLVKEGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V            V I + +D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPEAHDEDNTVSITFFVDPGKRAYVNRINFRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+         D + +  SV++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKVRLERLGFFKEVNVETPQVPGTDDQIDVNYSVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
            +GS+  +  +  + G+ + G I  NNF G G R  L           Y+F   DPY+  
Sbjct: 421 PSGSITASVGFAQNAGLILGGSISQNNFLGTGNRVSLGL-TRSEYQTRYSFGFVDPYWTV 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G++      +   LD++  S +V      + +    S +    Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRTTDYDELDVDVSSYSVDSLGAGINIGYPISETARLTYGLTVQQDTIDT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            +  +  I+  +   G  + +   S     +TL+  ++  +G   S   +    G D  +
Sbjct: 540 GRYTVDEIFDFIEAEGDNYLNFKGSIGWSESTLNRGVLANRGHSQSLVLETTIPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
           +++  R   F  +SD   +    + GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 YKLDYRGQVFKPISDTYTLRFHTQLGYGDSYGSTAELPFYEHYYAGGFNSVRGFKDSSLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG +       + FPMP V ++  LR A F D   +
Sbjct: 660 PRSTPSSGNKPGTLRDPDQDPLPFGGNVLVQGGVEMLFPMPFVKDQRSLRTALFWDVGNV 719

Query: 719 YANHVALG----ADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFG 774
           +  + +      +D  + + S    S GV + W + LG +     +P++  +    Q F 
Sbjct: 720 FDTNCSSSQKKLSDSCDIDFSNLASSVGVGLTWITALGPLSFSLAMPIKKPDDADTQVFQ 779

Query: 775 FRIGNRM 781
           F +G   
Sbjct: 780 FSLGQTF 786


>gi|238787227|ref|ZP_04631026.1| Outer membrane protein assembly factor yaeT [Yersinia frederiksenii
           ATCC 33641]
 gi|238724489|gb|EEQ16130.1| Outer membrane protein assembly factor yaeT [Yersinia frederiksenii
           ATCC 33641]
          Length = 795

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 184/792 (23%), Positives = 323/792 (40%), Gaps = 36/792 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISNIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  + S      +     L++I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGNQYKLNSVVVSGNLAGHQSAADKLVQIEPGELFNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEEDIKKMLGRYGYAYPRVVSQPEINDADKTVKLHINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    L      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGLNGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGVDGTLGFPINENNSLRVGLGYVHNDLSDME 540

Query: 555 EKEKIPSIYTTLIEHGKFS--------SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
            +  +     ++ +   ++          +++    YN LD    P  G+  S +     
Sbjct: 541 PQVAMWRYLDSVGQRPGYTGREGFTTDDFTLNLGWTYNNLDRGFFPTSGVKSSVNTKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
            G D++++++    S +  L +D   V              +K +  ++ F    +  +R
Sbjct: 601 PGSDNEFYKVTFDTSAYRPLDEDRSWVLLGRGRLGYGGGIGSKEMPFYENFYAGGSSSVR 660

Query: 666 GFAYKGIGPR-----------VDKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAFF 712
           GF    IGP+            +   A+GG   + AS  +  P P + E+    +R +FF
Sbjct: 661 GFRSNNIGPKAAYYANNGATVNNSTDAVGGNAMAVASLELITPTPFISEKYSNSVRTSFF 720

Query: 713 VDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
           +DS T++  +    A+            S  RVS GV + W SPLG +   Y  P++  E
Sbjct: 721 IDSGTVWDTNWENTAETRAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYAKPVKDYE 780

Query: 767 GDKIQQFGFRIG 778
           GDK +QF F IG
Sbjct: 781 GDKSEQFQFNIG 792


>gi|121594915|ref|YP_986811.1| surface antigen (D15) [Acidovorax sp. JS42]
 gi|120606995|gb|ABM42735.1| surface antigen (D15) [Acidovorax sp. JS42]
          Length = 765

 Score =  390 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 176/778 (22%), Positives = 322/778 (41%), Gaps = 24/778 (3%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           + K+  R        L   +F   A +      V+ I + G   V    I + +P+ VG 
Sbjct: 1   MRKHINRLGVRTASALAAMVFASQAAWALAPFKVQDIRVEGLQRVEPGTIFASLPLRVGD 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
             +D     A++ ++A+G F +V+++   +VL++ + ER  I  + F+G      D LK 
Sbjct: 61  EYNDDKGAAAIRALFALGLFKDVRLEASGNVLVVVVEERPTIADVDFAGTKEFDKDTLKK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +          +D+   +     +K+ Y +       V      I    +N+T+ + EG
Sbjct: 121 AMRDVGLTEGRPFDKALADRAEQELKRQYINRSLYGAEVVTTVTPIERNRVNLTFTVTEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKI  IR VGNK +S + L+ +    T G+   + K++ YS+ +++ D E +R++Y  
Sbjct: 181 EPAKIKEIRIVGNKAFSESTLKGLFDQDTGGWMSWYTKSNRYSRAKLNADLETLRSYYLA 240

Query: 251 RGYAAVKVSSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIR 309
           RG+   ++ S        K    +   ++EG+ Y V  + ++    +       SLI IR
Sbjct: 241 RGFLEFRIESTQVAISPDKQDISITVNVNEGQSYVVSGVKLEGNYLDRD-DEFKSLITIR 299

Query: 310 SGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKR 369
            G  YN  ++ E+++  + +F +    F RV+     D     V +    +     YV+R
Sbjct: 300 PGEPYNADKVAETTKAFTDHFGNFGFAFARVEAVPEIDRENNRVALVLRAEPSRRAYVRR 359

Query: 370 IEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDY 429
           I + GN+++ D VIRRE    E    +   I+ ++ R+   GYF+EVN+         D 
Sbjct: 360 INVSGNNRTRDEVIRREFRQFEASWYDGDKIKLSRDRVDRLGYFTEVNVETQEVPGAPDQ 419

Query: 430 VILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT 489
           V L V+V +   GS+ +   +   + + V   I   N FG G    +     ++      
Sbjct: 420 VDLVVNVAEKPTGSLQLGAGFSSAEKVSVSFAIKQENVFGSGNYLGVDVNTSKYRRTLVF 479

Query: 490 ----FSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
                         +        +    + G+ ++     +VR+ +P +E+ +  F   +
Sbjct: 480 STTDPYFTQDGISRTFDVYYRTAKPYEDQGGNYELVTAGTSVRLGIPFSETDTVFFGGGV 539

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHS--ISQSIIYNTLDNPIVPRKGMLISSSYD 603
              +  A +    IP+ Y    +    +S S  ++     +  D+ + P  G     +  
Sbjct: 540 EQTRIKAGT---NIPAAYLAYAQQFGETSLSVPLTIGWSRDDRDSALAPNSGRYQRLN-S 595

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
                GD++Y R   +   +  L+    I  +   G G  + + +   +F  F       
Sbjct: 596 EWSVAGDARYVRANYQYQQYIPLNKQFTIAFNGELGLGKGM-NGRPFPVFKNFYSGGLGS 654

Query: 664 LRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHV 723
           +RGF    +GPR     ++GG    + +A +  P P       LR   FVD+  +Y    
Sbjct: 655 VRGFDQGTLGPRDVTGASLGGPKKITLNAELIAPFPGAGNDRTLRWFTFVDAGNVYGEDE 714

Query: 724 ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +             RVS G+ + W SPLG + +    P+R   GDKIQ+  F+IG   
Sbjct: 715 S-------WELGDMRVSAGLGLSWISPLGPLRIAIAQPVRKFAGDKIQKLQFQIGTSF 765


>gi|50119979|ref|YP_049146.1| outer membrane protein assembly factor YaeT [Pectobacterium
           atrosepticum SCRI1043]
 gi|81645944|sp|Q6D8D5|YAET_ERWCT RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|49610505|emb|CAG73950.1| putative surface antigen [Pectobacterium atrosepticum SCRI1043]
          Length = 814

 Score =  390 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 188/812 (23%), Positives = 330/812 (40%), Gaps = 57/812 (7%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +++   +F  + VYG++  +V+ I   G   V     L  +PV VG +I D D+ 
Sbjct: 1   MAIKKLLIASLLFSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTIGDDDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN ++KDD LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGETLIVQVKERPTIASVTFSGNKSVKDDMLKENLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D   + +    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTALTSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +              +  L ++  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITINMTEGEQYKLSGVAVKGNLAGHSAEIEGLTKVEPGELYNGTK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E I K        + RV T+   + A + V +   +D G+  YV+ +  +GND S
Sbjct: 301 VTRMEEDIKKLLGRYGYAYPRVVTQPEINDADKTVRLNINVDAGNRFYVRHVRFDGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E+ K R+   GYF  V +       V+D V +   VK+
Sbjct: 361 KDTVLRREMRQMEGAWLGNDLVEQGKERLNRLGYFESVEVETQRVPGVADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+      +  + G+  +  +  +N+ G G    ++     +               
Sbjct: 421 RNTGTFNFGVGFGTESGVSFQAGVQQDNWLGTGNSVGISGTKNDYQTYVELSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA-- 552
                         + +  +              +  PI E+ S     D          
Sbjct: 481 DGVSLGGRVFYNKFEASDADLSDYTNVSYGVGSTLGFPINENNSLRVGLDYVHNDLSDMR 540

Query: 553 --ISEKEKIPSIYTTLIEHGKFSSHS---------ISQSIIYNTLDNPIVPRKGMLISSS 601
             +S    + S+       G+    S         ++    YN LD    P KG   S++
Sbjct: 541 PQVSMWRYLDSVGVNPSVVGENVKSSADFKANDFFLNTGWSYNNLDRGYFPTKGTRASAN 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
              A  G D++Y+++   ++ +Y L++     ++G  R G+   I S K +  +D F   
Sbjct: 601 AKIAVPGSDNEYYKLTFDSASYYPLTESGKWVVMGRTRAGFADGIGS-KEVPFYDNFYAG 659

Query: 660 SNYYLRGFAYKGIGPRVDK-------------------------KYAIGGKIYSSASAAV 694
            +  +RGF    IGP+                              A+GG   +  SA +
Sbjct: 660 GSSTVRGFQSNTIGPKAAYYKCPANLVGSGFNSYSGCPIDSTNMDDAVGGNAMAVLSAEL 719

Query: 695 SFPMPLVPERA--GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIM 746
             P P + ++    +R +FFVD  T++  +    A+ L       G  + +RVS+G+ + 
Sbjct: 720 IVPTPFISDKYANSVRTSFFVDGGTVWDTNWENTAETLKAGVPDYGKATNFRVSSGIALQ 779

Query: 747 WNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG 778
           W SPLG +   Y  P++  +GDK +QF F IG
Sbjct: 780 WMSPLGPLVFSYAQPVKKYDGDKSEQFQFNIG 811


>gi|209549189|ref|YP_002281106.1| outer membrane protein assembly complex, YaeT protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534945|gb|ACI54880.1| outer membrane protein assembly complex, YaeT protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 779

 Score =  390 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 286/780 (36%), Positives = 451/780 (57%), Gaps = 7/780 (0%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   + L      +     +          +   +  ++++RI++RGA+ VG E + S 
Sbjct: 1   MKAGSKFLNAVSAVALSASVVASGAGALTFVSATAAEAAVIQRIDVRGASRVGAEAVRSN 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           + +  G+S S+ D+D +VK +Y  GYFS+VKI +  S L++++ E +++N + F+GN  +
Sbjct: 61  LTIAPGKSFSNTDIDESVKQLYGTGYFSDVKISVSGSTLVVNVQEAQLVNQVVFNGNRKI 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KDD+L  IV++ +A  Y +  + +D+ +IK AYA+ G   V V  Q   +    +N+ +V
Sbjct: 121 KDDKLATIVQTHAAGPYSDTQIQSDIQSIKDAYAATGRSEVEVTTQVVPLGEGRVNLAFV 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY-FSFGKTDVYSKERMSFDEEAIRA 246
           I EG + KI+SI FVGN  YS  RL  VI+ + S +     + DVY+++++  DEEA+R 
Sbjct: 181 INEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSNFLSFLTRKDVYNEDKLHADEEALRQ 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++RGYA +++ S         + Y L F I+EG+ Y  G +++QST++ +  + L  L
Sbjct: 241 FYYNRGYADMRIVSSDATFDDATNKYTLTFNIEEGQRYDFGPVTVQSTVEGVGSEQLQPL 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           +R   G++YN +E+++S E IS    S   PF RV  R NRD     + +EYL+DQG   
Sbjct: 301 VRTHEGHVYNAKEVQKSIEAISDQVASAGYPFARVTPRGNRDLNNNTIGVEYLVDQGERA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RIEI GN ++ D VIRRE ++SEGD  N  MI +AKRR+ A GYFS VNIS  P + 
Sbjct: 361 YVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMITKAKRRLEALGYFSSVNISTQPGSS 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
               V++     Q +      A       G+ +E  I++ NF G+G   R++AG G+   
Sbjct: 421 PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLEASIEEKNFLGRGQYIRISAGGGQEGS 480

Query: 486 QNYTFSVEDPYFLGSP-ISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYD 544
           + Y  S  +PYFLG    +           + + D  + S  +R+  PITE ++T+F+Y+
Sbjct: 481 RAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNYDYEETSVVLRVTAPITEDLATTFRYN 540

Query: 545 LRFLQYGAISEK-EKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYD 603
            + ++Y A S     + + Y  L+E   ++  SISQ++ YNTLD+ ++PR+G+  +++ +
Sbjct: 541 YKQMKYDADSSDLSDLSAPYQHLVEDSPWTRSSISQTLTYNTLDDTVLPREGIYATATQE 600

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
            AG GGDSQ+++I  +A Y+ LL+DD+DI+GS+    G VI    +L +FDQF+++ N  
Sbjct: 601 LAGLGGDSQFYKIYGKARYYRLLADDADIIGSVSASAGYVIGLGDHLNVFDQFTLT-NGD 659

Query: 664 LRGFAYKGIGPRVD--KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN 721
           +RGF  KGIGPRV       +GG  Y +ASA  +FPMP  P    LRGA F D+ TL+ N
Sbjct: 660 IRGFENKGIGPRVSGTNDDPLGGTTYFTASAEATFPMPGFPRDFNLRGAVFADAGTLFGN 719

Query: 722 HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            V L  D ++G D+  R S GV ++W SP G + + Y IP+   + DK Q F F I N+ 
Sbjct: 720 DVDLRGDGIDGEDASLRASVGVGVVWQSPFGSLRLDYAIPVLKEDFDKTQNFKFGINNQF 779


>gi|54310076|ref|YP_131096.1| outer membrane protein assembly factor YaeT [Photobacterium
           profundum SS9]
 gi|46914515|emb|CAG21294.1| putative surface antigen [Photobacterium profundum SS9]
          Length = 805

 Score =  390 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 170/805 (21%), Positives = 302/805 (37%), Gaps = 46/805 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +++   + G S    +   +V  I   G   V     L ++PV VG ++ D D+ 
Sbjct: 1   MAIKKLLIASLLLGSSVAQSAEQFVVDDIRFEGLQRVTMGAALLKMPVRVGDNVDDRDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F ++K+      L++ ++ER  I ++ FSGN  +K++QL   +     R
Sbjct: 61  EIIQALFASGNFEDIKVFRDGDALVVKVLERPTIANITFSGNKAIKEEQLTDNLDSSNLR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  V+     +     ++ +V  EGV AKI  I
Sbjct: 121 IGEALDRTTLSKIEKGLEDFYYSVGKYNASVQAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTD-VYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN  ++ A L    +++    +     D  Y K+ ++ D E +R+ Y + GY   K+
Sbjct: 181 NFIGNDVFTDAELSSKFNLKADIPWWNFLADEKYQKQVLAGDLEILRSQYLNNGYLKYKL 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        V I                         K L  L+ I+ G++YN  +
Sbjct: 241 DSTQVSISPDKKGVYITLKISEGEQYQVKDVTFRGDLSKDNKDLNELVTIKEGDIYNGAQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + + +        + +V T  + D  K  V +   ++ G  +YV+ I+  GN  +
Sbjct: 301 VTALEDAVKRTLGESGYAYPQVTTIPDFDDDKNEVSLLVNVESGKRIYVRNIQFSGNTST 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +N   +E  K R+  TG+F  V++  +      D V ++  VK+
Sbjct: 361 KDEVLRREMRQMEGSWLNSKSVESGKSRLNRTGFFETVDVQTVRVPGSDDEVDIKYVVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            +AGS+     Y  + G+  +  I  +NF G G R  + A    +               
Sbjct: 421 ANAGSINFGVGYGTESGISFQAGIQQDNFLGTGNRFGINAMMNDYQKNVSLEYRDPYFTI 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       + + +              ++    P  E     F       +     
Sbjct: 481 DGISLGGKIYYNEFEASDANISDYTNQSYGTSLTWGFPFDELNFFEFGLGYDHNKISNTQ 540

Query: 555 EKEKIPSI-----YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
           E  +I        +       +      S S   N L+    P  G    +S+     G 
Sbjct: 541 EYYQIEKFKKIHGFDRGQNVIELDDFDWSVSWTRNNLNRGYFPTAGNHQRASFRMTIPGS 600

Query: 610 DSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKN-----LQLFDQFSVSSNY 662
           D+QY +       ++ L+D  D       R GYG    +  N     L  ++ F      
Sbjct: 601 DAQYFKTQYDVRQYFPLNDGHDFSLLLRGRLGYGNGYGTTDNGSDQLLPFYENFYAGGFT 660

Query: 663 YLRGFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVSFPMPLVPE 703
            LRGF    +GP+                        A GG   + AS  +  P P   +
Sbjct: 661 TLRGFRSNTVGPKAVYVQGCPTGGPSGNNNCAIGTDDAAGGNAVALASIELIVPTPFASD 720

Query: 704 R--AGLRGAFFVDSATLYANHVALGADK-----LEGNDSFWRVSTGVEIMWNSPLGMMGV 756
                +R + F+D+ T++     L            +    R S G  + W SP+G +  
Sbjct: 721 EVRNQIRTSLFIDAGTVWDTEYDLKDTDGKYLEDYSDMGLIRASYGAALQWMSPMGPLVF 780

Query: 757 YYGIPLRHREGDKIQQFGFRIGNRM 781
               P++  +GD  + F F IG   
Sbjct: 781 SIARPIKKYDGDDEEFFTFTIGRTF 805


>gi|170692150|ref|ZP_02883313.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           graminis C4D1M]
 gi|170142580|gb|EDT10745.1| outer membrane protein assembly complex, YaeT protein [Burkholderia
           graminis C4D1M]
          Length = 770

 Score =  390 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 157/774 (20%), Positives = 316/774 (40%), Gaps = 15/774 (1%)

Query: 18  YFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSIS 77
           + P  F    +I           + +   +V+ I I G   V    + + +P+  G + +
Sbjct: 2   FKPHRFVPKTVIAAAFAAHGLVAHATTPFVVQDIRIEGLQRVEPGTVFAYLPIKQGDTFN 61

Query: 78  DADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV- 136
           D     A++ +YA G+F++VKI    +V+I+ ++ER  I  + F+G +    + L   + 
Sbjct: 62  DDKASEAIRALYATGFFNDVKIATEGNVVIVQVLERPAIGTIDFAGIHEFDKENLTKALR 121

Query: 137 --RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKA 194
                    YD+  V+     +K+ Y + GY    V      I    +++ + + EG  A
Sbjct: 122 AVGLSQGRYYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVSVLFSVAEGPSA 181

Query: 195 KINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGY 253
           KI  I F+GNK +S   L   +     + +  + K D+Y+K++++ D E IR++Y +RGY
Sbjct: 182 KIRQINFIGNKAFSTGTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLENIRSYYLNRGY 241

Query: 254 AAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNL 313
               + S  +        + +            +    +     ++  L  LI+I+ G+ 
Sbjct: 242 LEFNIESTQVSITPDKKDMYLTVTLHEGEPYTISSIKLAGNLLDREPELAKLIKIKPGDR 301

Query: 314 YNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIE 373
           ++ ++++ +++ I          F  V  +   D +   VD+   +D    +YV+RI + 
Sbjct: 302 FSAEKLQSTTKAIVDKLGEYGYAFATVNAQPQIDQSNHKVDLTLQVDPSRRVYVRRINVV 361

Query: 374 GNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILR 433
           GN ++ D V+RRE+   E    + + +  +K RI   GYF++V+++ +P     D V + 
Sbjct: 362 GNTRTRDEVVRREMRQLESSWFDSNRLALSKDRINRLGYFTDVDVTTIPVEGTPDQVDVD 421

Query: 434 VSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVE 493
           V V +   G++ +   +     + +   +  +N FG G    +     +         V+
Sbjct: 422 VKVAEKPTGAITLGAGFSSTDKVVLSAGVSQDNVFGSGTSLAVNVNTAKTYRTLTVTQVD 481

Query: 494 DPYFLG-----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFL 548
             + +      + +         +  D S  I      ++  +P +E  +  F   L   
Sbjct: 482 PYFTVDGIKRITDVYYRTYQPLYYSTDSSFKIVTMGGDLKFGIPFSEVDTVYFGAGLEQN 541

Query: 549 QYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFG 608
           +    +        Y         ++  ++     +  D+ +VP +G    ++ +Y    
Sbjct: 542 KLDVDANTPASYKQYVDDFGR-VSNNVPVTVGWSRDARDSALVPSRGYFAQANAEYGTPI 600

Query: 609 GDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFA 668
           G +QY++    A Y+Y  +    +  + +          K   +F  +       +RG+ 
Sbjct: 601 GSTQYYKADINAQYYYSFARGFVLGFNFQG-GYGKGTGGKPYPIFKNYYAGGIGSVRGYE 659

Query: 669 YKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGA 727
              +GPR       IGG      +  ++FP+P       LR   F+D+  ++       A
Sbjct: 660 PSSLGPRDKTTGDPIGGSKLLVGNIELTFPLPGTGYDRTLRVFTFLDAGNVW---ADASA 716

Query: 728 DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                  +  R   GV + W SP+G + +  G PL    GD+ Q+F F+IG   
Sbjct: 717 AANSNGANGLRYGYGVGLAWISPIGPLKLSLGFPLTKHTGDQYQKFQFQIGTAF 770


>gi|238759940|ref|ZP_04621094.1| Outer membrane protein assembly factor yaeT [Yersinia aldovae ATCC
           35236]
 gi|238701847|gb|EEP94410.1| Outer membrane protein assembly factor yaeT [Yersinia aldovae ATCC
           35236]
          Length = 794

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 183/791 (23%), Positives = 315/791 (39%), Gaps = 35/791 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +FG + VYG++  +V+ I   G   V     L  +PV VG ++SD D+ 
Sbjct: 1   MAMKKLLIASLLFGSATVYGADGFVVKDIHFEGLQRVAVGAALLNMPVRVGDTVSDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +V++    + LI+ + ER  I  + FSGN  +KDD LK  +     R
Sbjct: 61  KTIRALFATGNFEDVRVLRDGNTLIVQVKERPTIASITFSGNKAVKDDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EG+ AKI  I
Sbjct: 121 VGEALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGMSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN +++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHSFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            N  I S      +     L +I  G L+N  +
Sbjct: 241 DSTQVSLTPDKKGIYITINITEGNQYKLNSVIVSGNLAGHQSEAEKLTKIEPGELFNGSK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    + I K        + RV ++   + A + V +   +D G+  YV+ +  EGND S
Sbjct: 301 VTRMEDDIKKLLGRYGYAYPRVVSQPEINDADKTVSLHINVDAGNRFYVRNVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +    +E  K R+   GYF  V++        +D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGNDQVEAGKERLNRLGYFETVDVETQRVPGTADQVDVTYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + GS+     Y  + G+  +  +  +N+ G G    +      +               
Sbjct: 421 RNTGSLNFGIGYGTESGVSFQVGVQQDNWLGTGNTVGINGTKNDYQTYAEFTLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI- 553
                       D +  + +      +       +  PI E+ S              + 
Sbjct: 481 DGVSLGGRIFYNDFKADNADLSGYTNSSYGLDGTLGFPINENNSLRVGLGYVHNDLSDMQ 540

Query: 554 -------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                         +   T          +++    YN LD    P  G   S +     
Sbjct: 541 PQVAMWRYLNSVGENPNLTDRASFTADDFTLNLGWTYNNLDRGFFPTSGTKSSVNGKVTV 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
            G D++++++    S +  L  D   V              +K +  ++ F    +  +R
Sbjct: 601 PGSDNEFYKVTFDTSSYQPLDQDKTWVLLGRGRLGYGGGIGSKEMPFYENFYAGGSSSVR 660

Query: 666 GFAYKGIGPR----------VDKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRGAFFV 713
           GF    IGP+           +   A+GG   + AS  +  P P + E+    +R +FF+
Sbjct: 661 GFRSNNIGPKAAYYNANGSVYNSTDAVGGNAMAVASLELITPTPFISEKYANSVRTSFFI 720

Query: 714 DSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG 767
           DS T++  +    A             S  RVS GV + W SPLG +   Y  P++  EG
Sbjct: 721 DSGTVWDTNWENTAATQAAGIPDYSKASNIRVSAGVSLQWMSPLGPLVFSYAKPVKDYEG 780

Query: 768 DKIQQFGFRIG 778
           DK +QF F IG
Sbjct: 781 DKSEQFQFNIG 791


>gi|259907550|ref|YP_002647906.1| outer membrane protein assembly factor YaeT [Erwinia pyrifoliae
           Ep1/96]
 gi|224963172|emb|CAX54656.1| Outer membrane protein assembly factor YaeT [Erwinia pyrifoliae
           Ep1/96]
 gi|283477390|emb|CAY73306.1| Outer membrane protein assembly factor yaeT precursor [Erwinia
           pyrifoliae DSM 12163]
          Length = 803

 Score =  389 bits (998), Expect = e-105,   Method: Composition-based stats.
 Identities = 184/800 (23%), Positives = 316/800 (39%), Gaps = 44/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +   + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLIASLLLSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+++ ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  NTIRALFATGNFEDVQVLRDGNTLIVEVKERPTIASITFSGNKAVKEDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISTIEKGLEDFYFSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L     +R    +        Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NVVGNKAFSSDELISRFQLRDEVPWWNLVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +++ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGEQYKLSGVAVSGNLAGHSAEIEGLSKVKPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           I  + + I K        + RV+T+   D A + V +    D G+  YV+++  EGND S
Sbjct: 301 ITRTEDDIKKLLGRYGYAYPRVQTQTEIDDANKTVKLHVNADAGNRYYVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E+ K R+   GYF  V+          D V +   +K+
Sbjct: 361 KDAVLRREMRQMEGAWLGNDLVEQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKIKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G++     Y  + G+  +  I  +N+ G G    ++     +               
Sbjct: 421 RNTGTLNFGVGYGTESGVSFQAGITQDNWLGTGNTVGISGTKNDYQTYAELSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI- 553
                       D +    +              +  P+ E+ +  F           + 
Sbjct: 481 DGVSLGGRLFYNDFKADDADLSDYTNKSYGLDGTLGFPVNENNTLRFGAGYIHNSLSNMQ 540

Query: 554 -------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                    +    +   +  E       + +    YNTLD    P  G   + +     
Sbjct: 541 PQVAMWRYLRSVGKNPSLSDDEDFSTDDFTFNYGWTYNTLDRGFFPTAGNRTNLNGKVTL 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLR 665
            G D+ +++       +  L  D   V S R   G     S K L  ++ F    +  +R
Sbjct: 601 PGSDNAFYKATLDTQQYLPLDQDHTWVLSGRGRVGYGGGLSGKELPFYENFYAGGSSTVR 660

Query: 666 GFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVSFPMPLVPERA- 705
           GF    IGP+                        A+GG   + ASA +  P P + E+  
Sbjct: 661 GFRSNTIGPKAAYYNNGSSNCSGSDVTRICSSDDAVGGNAMAVASAELITPTPFISEKYV 720

Query: 706 -GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
             +R + FVD+ T++  +    A                R+S G+ + W SPLG +   Y
Sbjct: 721 NSVRISLFVDAGTVWDTNWDNTAATSAAGIPDYSKPGNIRMSAGMALQWMSPLGPLVFSY 780

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             PL+  +GDK +QF F IG
Sbjct: 781 AQPLKKYDGDKAEQFQFNIG 800


>gi|327189229|gb|EGE56408.1| outer membrane lipoprotein [Rhizobium etli CNPAF512]
          Length = 779

 Score =  389 bits (998), Expect = e-105,   Method: Composition-based stats.
 Identities = 284/780 (36%), Positives = 455/780 (58%), Gaps = 7/780 (0%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   + L      +     +          +   +  ++++RI++RGA+ VG E + S 
Sbjct: 1   MKAGSKFLNAVSAVALSASVVASGAGALTFVSATAAEAAVIQRIDVRGASRVGAEAVRSN 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           + +  G+S S+ D+D++VK +Y  GYFS+VKI +    L++++ E +++N + F+GN  +
Sbjct: 61  LTITPGKSFSNTDIDNSVKQLYGTGYFSDVKISVSGGTLVVNVQEAQLVNQIVFNGNRKI 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KDD+L  IV++ +A  Y +  + +D+  IK+AYA+ G   V V  Q   +    +N+ +V
Sbjct: 121 KDDKLATIVQTHAAGPYSDTQIQSDIQAIKEAYAATGRSEVEVTTQVVPLGEGRVNLAFV 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY-FSFGKTDVYSKERMSFDEEAIRA 246
           I EG + KI+SI FVGN  YS  RL  VI+ + S +     + DVY+++++  DEEA+R 
Sbjct: 181 INEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSNFLSFLTRKDVYNEDKLHADEEALRQ 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++RGYA +++ S      +  + Y L F I+EG+ Y  G +++QST++ +    LL L
Sbjct: 241 FYYNRGYADMRIVSSDASFDEATNKYTLTFNIEEGQRYDFGPVTVQSTVEGVGSDQLLPL 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           +R + G++Y+ +E+++S E IS    S   PF RV  R NRD     + +EYL+DQG   
Sbjct: 301 VRTKEGHVYSAKEVQKSIEAISDQVASAGYPFARVTPRGNRDLNNNTIGVEYLVDQGERA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RIEI GN ++ D VIRRE ++SEGD  N  MI +AKRR+ A GYFS VNIS  P + 
Sbjct: 361 YVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMITKAKRRLEALGYFSSVNISTQPGSS 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
               V++     Q +      A       G+ +E  I++ NF G+G   R++AG G+   
Sbjct: 421 PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLEASIEEKNFLGRGQYIRISAGGGQEGS 480

Query: 486 QNYTFSVEDPYFLGSP-ISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYD 544
           + Y  S  +PYFLG    +           + + D  + S  +R+  PITE ++T+F+Y+
Sbjct: 481 RAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNYDYEETSVVLRVTAPITEDLATTFRYN 540

Query: 545 LRFLQYGAISEK-EKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYD 603
            + ++Y A +     + + Y  L+E   ++  SISQ++ YNTLD+ ++PR+G+  +++ +
Sbjct: 541 YKQMKYDADNNDLSDLSAPYQHLVEDSPWTRSSISQTLTYNTLDDTVLPREGIYATATQE 600

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
            AG GGDSQ+++I  +A Y++LL+DD+DI+GS+    G V+   ++L +FDQF+++ N  
Sbjct: 601 IAGLGGDSQFYKIYGKARYYHLLADDADIIGSVSASAGYVVGFGEHLNVFDQFTLT-NGD 659

Query: 664 LRGFAYKGIGPRV--DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN 721
           +RGF  KGIGPRV       +GG  Y +ASA  +FPMP  P    LRGA F D+ TL+ N
Sbjct: 660 IRGFENKGIGPRVAGTNDDPLGGTTYFTASAEATFPMPGFPRDFNLRGAVFADAGTLFGN 719

Query: 722 HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            V L  D +EG D+  R S GV ++W SP G + + Y IP+   + DK Q F F I N+ 
Sbjct: 720 DVDLRGDGIEGEDASLRASVGVGVVWQSPFGSLRLDYAIPVLKEDFDKTQNFKFGINNQF 779


>gi|146281919|ref|YP_001172072.1| surface antigen family outer membrane protein [Pseudomonas stutzeri
           A1501]
 gi|145570124|gb|ABP79230.1| outer membrane protein, bacterial surface antigen family
           [Pseudomonas stutzeri A1501]
          Length = 771

 Score =  389 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 162/765 (21%), Positives = 317/765 (41%), Gaps = 27/765 (3%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           + +  +  I + G   V    +   +P+ VG++  DA L  A + ++  G+F ++++   
Sbjct: 8   AESFTISDIRVNGLQRVSAGSVFGALPLNVGEAADDARLIDATRALFRTGFFQDIQLGRE 67

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQA 159
             VL+I ++ER  I+ +   GN  +K + L   +          +   T+    + +++ 
Sbjct: 68  GDVLVISVVERPSISAIEIEGNKAIKTEDLLSGLQQSGLAEGEIFQRATLEGVRNELQRQ 127

Query: 160 YASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-I 218
           Y + G  +  ++ +  +     + +   I EG  A I  I  VGN  +    L  +    
Sbjct: 128 YVAQGRYSATIETEVVAQPRNRVALKIKINEGSVAAIKHINVVGNSVFPDEDLVDLFELK 187

Query: 219 RTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQID 278
            T+    F   D Y++E++S D E +R++Y DRGY  + ++S  +       +V +    
Sbjct: 188 TTNWLSFFRNDDKYAREKLSGDLERLRSYYLDRGYINMDITSTQVSITPDKKHVYVTVNI 247

Query: 279 EGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFV 338
           +            S   ++ ++ + +L+  + G +++ + +  +SE I++   +    F 
Sbjct: 248 DEGERYTVRDVKLSGDLKVPQEEIEALLLAKEGQVFSRKVMTSTSELITRRLGNEGYTFA 307

Query: 339 RVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYS 398
            V            V I +++D G   YV RI   GN ++ D V+RRE+   EG   +  
Sbjct: 308 NVNGVPEAHDEDNTVSITFVVDPGKRAYVNRINFRGNTKTEDEVLRREMRQMEGGWASTY 367

Query: 399 MIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGV 458
           +I+++K R+   G+F EVN+         D + +  SV++  +GS+  +  +  + G+ +
Sbjct: 368 LIDQSKTRLERLGFFKEVNVETPQVPGTDDQIDVNYSVEEQPSGSIMASIGFAQNAGLIL 427

Query: 459 EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSL 518
            G I  NNF G G R  L           Y F   DPY+    +S G++      +   L
Sbjct: 428 GGSISQNNFLGTGNRVSLGL-TRSEYQSRYNFGFVDPYWTEDGVSLGYNAFYRTTDYDEL 486

Query: 519 DINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGK-F 572
           D +  S +V      + +    S ++   + L   Q    + +  +  I+  + E G  F
Sbjct: 487 DYDVSSYSVDSLGAGINIGYPISETSRLSFGLTVQQDDLDTGRYTVDEIFDFMEEEGDSF 546

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDI 632
            +   S     +TL+  ++  +G   S  ++    G D  ++++      F  ++ D  +
Sbjct: 547 LNFKASVGWSESTLNRGVLATRGHSQSLVFETTVPGSDLSFYKLDYNGQLFVPMTKDYTL 606

Query: 633 VGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---------------VD 677
               R GYG    S  +L  ++ +       +RGF    +GPR                 
Sbjct: 607 RMHTRLGYGDAYGSTSSLPFYEHYYAGGFNSVRGFEDSSLGPRSTPSDGSRPGTIADPDQ 666

Query: 678 KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALG-ADKLEGNDSF 736
                GG +       V FPMP V ++  LR + F D   ++  +   G A+  + +   
Sbjct: 667 DPLPFGGNVLIQGGLEVLFPMPFVKDQRSLRTSVFWDVGNVFNTNCPSGAANCSDIDFGD 726

Query: 737 WRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
              S GV + W + +G +     +P+   +    Q F F +G   
Sbjct: 727 MASSVGVGLTWITAMGPLSFSLAMPVVKPDDADTQVFQFSLGQTF 771


>gi|86357541|ref|YP_469433.1| outer membrane lipoprotein [Rhizobium etli CFN 42]
 gi|86281643|gb|ABC90706.1| outer membrane lipoprotein [Rhizobium etli CFN 42]
          Length = 779

 Score =  389 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 285/780 (36%), Positives = 456/780 (58%), Gaps = 7/780 (0%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   + L      +   G +          +   +  ++++RI++RGA+ VG E + S 
Sbjct: 1   MKAGSKFLNAVSAVALSAGVVASGAGAVTFVSATAAEAAVIQRIDVRGASRVGAEAVRSN 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           + +  G+S S+ D+D++VK +Y  GYFS+VKI +    L++++ E +++N + F+GN  +
Sbjct: 61  LTITPGKSFSNTDIDNSVKQLYGTGYFSDVKISVSGGTLVVNVQEAQLVNQVVFNGNRKI 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KDD+L  IV++ +A  Y +  + +D+  IK AYA+ G   V V  Q   +    +N+ +V
Sbjct: 121 KDDKLATIVQTHAAGPYSDTQIQSDIQAIKDAYAATGRSEVEVTTQVVPLGEGRVNLAFV 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY-FSFGKTDVYSKERMSFDEEAIRA 246
           I EG + KI+SI FVGN  YS  RL  VI+ + S +     + DVY+++++  DEEA+R 
Sbjct: 181 INEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSNFLSFLTRKDVYNEDKLHADEEALRQ 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++RGYA +++ S      +  + Y L F I+EG+ Y  G +++QST++ +    LL L
Sbjct: 241 FYYNRGYADMRIVSSDASFDEATNKYTLTFNIEEGQRYDFGPVTVQSTVEGVGSDQLLPL 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           +R + G++Y+ +E+++S E IS    S   PF RV  R NRD     + +EYL+DQG   
Sbjct: 301 VRTKEGHVYSAKEVQKSIEAISDQVASAGYPFARVTPRGNRDLNNNTIGVEYLVDQGERA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RIEI GN ++ D VIRRE ++SEGD  N  MI +AKRR+ A GYFS VNIS  P + 
Sbjct: 361 YVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMITKAKRRLEALGYFSSVNISTQPGSS 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
               V++     Q +      A       G+ +E  I++ NF G+G   R++AG G+   
Sbjct: 421 PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLEASIEEKNFLGRGQYIRISAGGGQEGS 480

Query: 486 QNYTFSVEDPYFLGSP-ISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYD 544
           + Y  S  +PYFLG    +           + + D  + S  +R+  PITE ++T+F+Y+
Sbjct: 481 RAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNYDYEETSVVLRVTAPITEDLATTFRYN 540

Query: 545 LRFLQYGAISEK-EKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYD 603
            + ++Y A +     + + Y  L+E   ++  S+SQ++ YNTLD+ ++PR+G+  +++ +
Sbjct: 541 YKQMKYDADNSDLSDLSAPYQHLVEDSPWTRSSVSQTLTYNTLDDTVLPREGIYATATQE 600

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
            AG GGDSQ+++I  +A Y++LL+DD+DI+GS+    G V+   ++L +FDQF+++ N  
Sbjct: 601 IAGLGGDSQFYKIYGKARYYHLLADDADIIGSVSASAGYVVGFGEHLNVFDQFTLT-NGD 659

Query: 664 LRGFAYKGIGPRV--DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN 721
           +RGF  KGIGPRV  D    +GG  Y +ASA  +FPMP  P    LRGA F D+ TL+ N
Sbjct: 660 IRGFENKGIGPRVRGDNDDPLGGTTYFTASAEATFPMPGFPRDFNLRGAVFADAGTLFGN 719

Query: 722 HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            V L  D +EG D+  R S GV ++W SP G + + Y IP+   + DK Q F F I N+ 
Sbjct: 720 DVDLRGDGIEGEDASLRASVGVGVVWQSPFGSLRLDYAIPVLKEDFDKTQNFKFGINNQF 779


>gi|331016375|gb|EGH96431.1| surface antigen (D15):surface antigen variable number [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 791

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 173/792 (21%), Positives = 330/792 (41%), Gaps = 36/792 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNVNEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            +  +  I+  +   G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GRYTVDEIFDFVNREGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFETTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG         V FP+P + ++  LR + F D   +
Sbjct: 660 PRSTPSRGTNPGTIADPDQDPLPFGGNALVQGGVEVMFPLPFIKDQRSLRTSVFWDVGNV 719

Query: 719 YANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD-K 769
           +      G     G        + S    S G+ + W + LG +     +P++  + + +
Sbjct: 720 FDTKCDSGNTTASGKKVECNNIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPDDEAE 779

Query: 770 IQQFGFRIGNRM 781
            Q F F +G   
Sbjct: 780 TQVFQFSLGQTF 791


>gi|257487074|ref|ZP_05641115.1| outer membrane protein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289626026|ref|ZP_06458980.1| outer membrane protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289651457|ref|ZP_06482800.1| outer membrane protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488340|ref|ZP_07006372.1| Outer membrane protein assembly factor YaeT precursor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298157162|gb|EFH98250.1| Outer membrane protein assembly factor YaeT precursor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320329616|gb|EFW85605.1| outer membrane protein [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330878170|gb|EGH12319.1| outer membrane protein [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 791

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 174/792 (21%), Positives = 331/792 (41%), Gaps = 36/792 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNINEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GKYTVDEIFDFVEKEGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG         V FP+P V ++  LR + F D   +
Sbjct: 660 PRSTPSNGSKPGTLADPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRSLRTSVFWDVGNV 719

Query: 719 YANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD-K 769
           +  +         G        + S    S G+ + W + LG +     +P++  + + +
Sbjct: 720 FDTNCDSSRKTASGKNVECNNIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPDDEAE 779

Query: 770 IQQFGFRIGNRM 781
            Q F F +G   
Sbjct: 780 TQVFQFSLGQTF 791


>gi|66044599|ref|YP_234440.1| surface antigen (D15):surface antigen variable number [Pseudomonas
           syringae pv. syringae B728a]
 gi|63255306|gb|AAY36402.1| surface antigen (D15):Surface antigen variable number [Pseudomonas
           syringae pv. syringae B728a]
          Length = 791

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 175/792 (22%), Positives = 331/792 (41%), Gaps = 36/792 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGNK +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNKVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNINEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GKYTVDEIFDFVEKEGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG         V FP+P V ++  LR + F D   +
Sbjct: 660 PRSTPSNGSKPGTLADPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRSLRTSVFWDVGNV 719

Query: 719 YANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD-K 769
           +            G        + S    S G+ + W + LG +     +P++  + + +
Sbjct: 720 FDTKCDSTRTSASGKKVECNDIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPDDEAE 779

Query: 770 IQQFGFRIGNRM 781
            Q F F +G   
Sbjct: 780 TQVFQFSLGQTF 791


>gi|71733283|ref|YP_275970.1| outer membrane protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71553836|gb|AAZ33047.1| outer membrane protein [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 791

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 173/792 (21%), Positives = 330/792 (41%), Gaps = 36/792 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++TS + SF K D  Y++E++  D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLLGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNINEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GKYTVDEIFDFVEKEGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG         V FP+P V ++  LR + F D   +
Sbjct: 660 PRSTPSNGSKPGTLADPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRSLRTSVFWDVGNV 719

Query: 719 YANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD-K 769
           +  +         G        + S    S G+ + W + LG +     +P++  + + +
Sbjct: 720 FDTNCDSSRKTASGKNVECNNIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPDDEAE 779

Query: 770 IQQFGFRIGNRM 781
            Q F F +G   
Sbjct: 780 TQVFQFSLGQTF 791


>gi|254428938|ref|ZP_05042645.1| outer membrane protein assembly complex, YaeT protein [Alcanivorax
           sp. DG881]
 gi|196195107|gb|EDX90066.1| outer membrane protein assembly complex, YaeT protein [Alcanivorax
           sp. DG881]
          Length = 787

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 159/779 (20%), Positives = 311/779 (39%), Gaps = 24/779 (3%)

Query: 25  MGFIILFYAIFGLSAVYG--SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           +  ++  + +     +         V  I + G   +  E + + +P+  G +++   + 
Sbjct: 11  LKGLLAVFCLLAAPLLNADTQLPFKVHDIRVEGLQRLPVERVYASLPIQAGDTVNRDQVV 70

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
            AV+ ++A G F +V++      L++ + ER  I  +  SGN ++ ++ L+  +      
Sbjct: 71  DAVQRLFATGNFEDVQLGRDGDDLVVIVAERPSIARIDLSGNKSIDEENLRKGLTEAGLA 130

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
               +   T+ A    +++ Y S G     +K +  ++    + +   I EG  A+I +I
Sbjct: 131 EGEVFQRSTLQAIAGELERQYVSQGRYGADIKTESVALPRNRVALKIEIYEGKAARIRNI 190

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN+ +    L     + +SG++SF K  D YS+E++  D E +R++Y DRGY    +
Sbjct: 191 NIVGNQLFDDEALLEDFELHSSGFWSFIKGDDKYSREKLGGDLERLRSYYLDRGYINFSI 250

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        V I            N    +    +++  L  L+ ++ G +++ Q 
Sbjct: 251 ESTQVSVTPDRRSVFITVNVAEGEQYTVNEVNLAGDLVVKEDQLRPLLIVKKGQVFSQQL 310

Query: 319 IKESSEKISKYFFSGERPF-VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           +  +++ I +   +    F        N +     VD+ + +D G  +YV+RI   GN +
Sbjct: 311 VTYTNDLIKRRLGNEGYTFAEVNGREHNANDEDNTVDVTFYVDPGRKVYVRRINFSGNAK 370

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P N S+++ +++R+   GYFS V        +  D V +   V+
Sbjct: 371 TDDEVLRRELRQFEQAPANTSLVDLSRQRLQRLGYFSVVEADTPRVPNADDLVDVNYKVE 430

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
           +  +GS+G    +    G     ++  NN+ G G R   A                  Y 
Sbjct: 431 EQPSGSIGANVGFSDASGFIFGANVTQNNWRGSGNRVSFALSRSDIRDSYSFSHYNPYYT 490

Query: 498 LG--SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISE 555
           L   S   + F  +    E        +     +      S  +   +   + +    + 
Sbjct: 491 LDGVSRGFSLFYSEIDFDETTVASYAADRLGGSVTFGYPISEYSRLSFGATYEKTDITTG 550

Query: 556 KEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYH 614
                 I   LI+ G KF+ +  + S+  +TL+  I+P +G   +  ++ A  G D  ++
Sbjct: 551 DFVAVDIANFLIQEGTKFNEYKANASLQTSTLNRGILPDRGWSSTLGFEVAVPGSDYGFY 610

Query: 615 RIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGP 674
           ++      ++ ++    +       YG     +  L  F+ +       +RG+  + +GP
Sbjct: 611 KLNWTGQKYFPITQRWTLRTRADVAYGDGYGDDTVLPFFENYYSGGIGSVRGYESRSLGP 670

Query: 675 R------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH 722
           R                  IGG   + AS  + FP P  PE   +R   FVD+  ++   
Sbjct: 671 RSEGLSYFLNGTTDPSPDPIGGNFLTEASMELIFPTPFAPESRSVRTFLFVDAGNVFETE 730

Query: 723 VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                   E      R S G+ + W + +G +       L  + GD  + F F +G   
Sbjct: 731 RDDIFADFE--PQDIRTSAGIGLTWLTAIGPLSFNLAKALNDQPGDDTEVFQFSLGQTF 787


>gi|320323112|gb|EFW79201.1| outer membrane protein [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 791

 Score =  388 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 174/792 (21%), Positives = 331/792 (41%), Gaps = 36/792 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNINEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GKYTVDEIFDFVEKEGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG         V FP+P V ++  LR + F D   +
Sbjct: 660 PRSTPSNGSKPGTLADPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRTLRTSVFWDVGNV 719

Query: 719 YANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD-K 769
           +  +         G        + S    S G+ + W + LG +     +P++  + + +
Sbjct: 720 FDTNCDSSRKTASGKNVECNNIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPDDEAE 779

Query: 770 IQQFGFRIGNRM 781
            Q F F +G   
Sbjct: 780 TQVFQFSLGQTF 791


>gi|313498671|gb|ADR60037.1| Surface antigen (D15) [Pseudomonas putida BIRD-1]
          Length = 787

 Score =  388 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 165/775 (21%), Positives = 323/775 (41%), Gaps = 33/775 (4%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           + +  ++   +  I + G   V    +   +P+ VG    D  L  + ++++  G+F ++
Sbjct: 15  ATLAQASPFRIADIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVDSTRSLFKTGFFQDI 74

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVH 154
           ++    +VLII+++ER  ++ +   GN  +  + L   ++         +   T+    +
Sbjct: 75  QLSRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAEGEIFQRATLEGVRN 134

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
            +++ Y + G  +  V  +        + +   I EG  A I  I  VGN  +    L +
Sbjct: 135 ELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHINIVGNNVFDDETLGQ 194

Query: 215 VISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVL 273
           +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S  +       +V 
Sbjct: 195 LFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIASTQVSITPDKKHVY 254

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
           I                 S   ++ +  + SL+ ++ G +++ + +  +SE I++   + 
Sbjct: 255 ITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVMTSTSELITRRLGNE 314

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
              F  V      +     VDI +++D G   YV RI   GN ++ D V+RRE+   EG 
Sbjct: 315 GYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTEDEVLRREMRQMEGG 374

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             +  +I+++K R+   G+F EVN+         D V +  SV++ ++GS+  +  +   
Sbjct: 375 WASTYLIDQSKTRLERLGFFKEVNVETPQVPGTDDQVDVNYSVEEQASGSITASVGFAQS 434

Query: 454 KGMGVEGHIDDNNFFGQGYRAR-------LAAGFGRHAVQNYTFSVEDPYFLGSPISAGF 506
            G+ + G I  +NF G G +             +    V  Y  +           ++  
Sbjct: 435 AGLILGGSISQSNFLGTGNKVSIGLTRSEYQTRYNFGFVDPYFTADGVSLGYNLFYNSTD 494

Query: 507 DLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTL 566
                        IN   A V    PI E+   ++   L+       +       IY  +
Sbjct: 495 YSDYYDDGVSYYAINSYGAGVSFGYPINETSRLTYGLTLQHDDISPGTY--SADEIYDFI 552

Query: 567 IEHGK-FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              GK F++   S     +TL+  ++  +G   S +      G D  ++++      F  
Sbjct: 553 SREGKSFNNLKASIGWSESTLNKGVLATRGHSQSLTLMATTPGSDLSFYKLDYNGQAFLP 612

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---------- 675
           ++ ++ +      GYG    S   L  ++ ++      +RGF    +GPR          
Sbjct: 613 VTSNTTLRLHTNLGYGNGYGSTDGLPFYESYNAGGQGSVRGFKDGTLGPRSTPATGAYSS 672

Query: 676 -------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGAD 728
                        +GG I  +  A   FP+P V +++ LR + FVD+  +YA+   L   
Sbjct: 673 AGQAYYSDRDTDVLGGNILITGGAEYLFPLPFVQDQSQLRSSVFVDAGNVYADTCYLSTT 732

Query: 729 KLEG--NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +  G  + +   VS GV + W SP+G +     +PL+  +  + Q F F +G   
Sbjct: 733 QGCGSVDLAQMAVSLGVGVTWYSPMGPLSFSLAVPLKKPDNAETQVFQFSLGQTF 787


>gi|237800151|ref|ZP_04588612.1| surface antigen (D15):surface antigen variable number [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331023008|gb|EGI03065.1| surface antigen (D15):surface antigen variable number [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 795

 Score =  388 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 174/796 (21%), Positives = 330/796 (41%), Gaps = 40/796 (5%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVE 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I ++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVISVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNINEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G++          LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GKYTVDEIFDFVQKEGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
           PR                          GG         V FP+P V ++  LR + F D
Sbjct: 660 PRSTPSRGASVTGNQGTLADPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRSLRTSVFWD 719

Query: 715 SATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
              ++            G        + S    S G+ + W + LG +     +P++  +
Sbjct: 720 VGNVFNTKCDSSKTSASGKKVECNDIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPD 779

Query: 767 GD-KIQQFGFRIGNRM 781
            + + Q F F +G   
Sbjct: 780 DEAETQVFQFSLGQTF 795


>gi|310764942|gb|ADP09892.1| outer membrane protein assembly factor YaeT [Erwinia sp. Ejp617]
          Length = 803

 Score =  388 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 183/800 (22%), Positives = 314/800 (39%), Gaps = 44/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +   + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLIASLLLSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++    + LI+++ ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  NTIRALFATGNFEDVQVLRDGNTLIVEVKERPTIASITFSGNKAVKEDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISTIEKGLEDFYFSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L     +R    +        Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NVVGNKAFSSDELISRFQLRDEVPWWNLVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +++ G LYN  +
Sbjct: 241 DSTQVNLTPDKKGIYITVNITEGEQYKLSGVAVSGNLAGHSAEIEGLSKVKPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           I  + + I K        + RV+T+   D A + V +    D G+  YV+++  EGND S
Sbjct: 301 ITRTEDDIKKLLGRYGYAYPRVQTQTEIDDANKTVKLHVNADAGNRYYVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E+ K R+   GYF  V+          D V +   +K+
Sbjct: 361 KDAVLRREMRQMEGAWLGNDLVEQGKERLNRLGYFETVDTDTQRVPGSPDQVDVVYKIKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G++     Y  + G+  +  I  +N+ G G    ++     +               
Sbjct: 421 RNTGTLNFGVGYGTESGVSFQAGITQDNWLGTGNTVGISGTKNDYQTYAELSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI- 553
                       D +    +              +  P+ E+ +              + 
Sbjct: 481 DGVSLGGRLFYNDFKADDADLSDYTNKSYGLDGTLGFPVNENNTLRVGAGYIHNSLSNMQ 540

Query: 554 -------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                    +    +   +  E       + +    YNTLD    P  G   S +     
Sbjct: 541 PQVAMWRYLRSVGKNPSLSDDEDFSTDDFTFNYGWTYNTLDRGFFPTAGNRTSLNGKVTL 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLR 665
            G D+ +++       +  L  D   V S R   G     S K L  ++ F    +  +R
Sbjct: 601 PGSDNAFYKATLDTQQYLPLDQDHTWVLSGRGRVGYGGGLSGKELPFYENFYAGGSSTVR 660

Query: 666 GFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVSFPMPLVPERA- 705
           GF    IGP+                        A+GG   + ASA +  P P + E+  
Sbjct: 661 GFRSNTIGPKAAYYNNGSSNCSGSDVTRVCSSDDAVGGNAMAVASAELITPTPFISEKYA 720

Query: 706 -GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
             +R + FVD+ T++  +    A                R+S G+ + W SPLG +   Y
Sbjct: 721 NSVRISLFVDAGTVWDTNWDNTAATSAAGIPDYSKPGNIRMSAGMALQWMSPLGPLVFSY 780

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             P +  +GDK +QF F IG
Sbjct: 781 AQPFKKYDGDKAEQFQFNIG 800


>gi|260459221|ref|ZP_05807476.1| outer membrane protein assembly complex, YaeT protein
           [Mesorhizobium opportunistum WSM2075]
 gi|259034775|gb|EEW36031.1| outer membrane protein assembly complex, YaeT protein
           [Mesorhizobium opportunistum WSM2075]
          Length = 790

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 248/792 (31%), Positives = 415/792 (52%), Gaps = 20/792 (2%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   + L      +     ++         A   +  ++V R+E+ G   V  E I + 
Sbjct: 1   MKAASKFLNAASAAALSAALVVPGALAVQFVATSAAEAAVVSRVEVSGNQRVDAETIRNY 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           I +  G++ S +D+D AVK ++  G FS+V+I  V S L++ + E K++N + F GN  L
Sbjct: 61  ITIKPGKAFSSSDIDSAVKALFGTGLFSDVQINQVGSTLVVKVSEYKVVNQVLFQGNKKL 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KD+ L+  V+ +  + + + T+++DV  +K AY  IG  +  V  Q   +    +N+ + 
Sbjct: 121 KDNALQAAVQLKPRSTFSQATLDSDVEAVKAAYRRIGRDDAGVTTQIMDLGDNRVNVVFK 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRA 246
           I EG + +I +I FVGN  YS  RL  VI+ + S + SF  + DVY ++++  D+E +R 
Sbjct: 181 ITEGDRTQIAAINFVGNSAYSSRRLSDVINTKRSSWVSFILRDDVYDEDKLRADQELLRR 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++ GYA  +V S V       + Y +   + EGE Y  G+IS++ST+ E+  K+L S+
Sbjct: 241 FYYNHGYADFQVVSAVGELDNATNKYTVTITVQEGERYNFGDISVESTIPEVDAKSLQSV 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           +  + G++YN + +++S   +++        F +V  R +R+F    + + Y IDQG+  
Sbjct: 301 VETQKGDVYNAKNVEDSIIALTEKVAGSGYAFAQVTPRGDRNFENHTISVVYTIDQGTKA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           Y++RIEI GND++ D VIRRE ++SEGD  N  +++RAK+R+    YF +V+IS +P + 
Sbjct: 361 YIERIEIRGNDRTRDYVIRREFDVSEGDAFNQVLVQRAKKRLEDLNYFDKVDISTVPGSQ 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF-GRHA 484
               V++   V++ +      A         G             G    +     G   
Sbjct: 421 PDQVVLVVDVVEKSTGEFSVGAGYSTGGDTAGPSVEGSITERNFLGRGQFIKVSAGGGKN 480

Query: 485 VQNYTFSVEDPYFLGSPISAGFDLQK-THLEDGSLDINDESAAVRMIVPITESISTSFKY 543
            ++Y+ S  +PYFLG  I+AGFD+ K T   + + D +   A +R  +PIT SI+T   Y
Sbjct: 481 SRDYSLSFTEPYFLGRRIAAGFDIYKSTREYNNNYDSDTTGATIRFGLPITNSITTQLAY 540

Query: 544 DLRFLQY-----------GAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVP 592
           ++   +Y           G +     I       I    +   S+S  ++YNT+D+   P
Sbjct: 541 NISQEKYKVDDSCGPTGPGNLDGTCTISPAILDGIAQSPWIKSSVSLGLVYNTIDDMKNP 600

Query: 593 RKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCV--IPSNKNL 650
            +G+  +++ + AG GGD+++ ++  R S +  LS+  D+VG +  G G V     + +L
Sbjct: 601 HEGIYANTTVEVAGLGGDAKFVKVTGRGSVYQTLSEQLDLVGLISGGAGHVEAYGGDGSL 660

Query: 651 QLFDQFSVSSNYYLRGFAYKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRG 709
           ++FDQF  + +  +RGFAY GIGP        +GG  Y +ASA   FP+P+VPE  GLRG
Sbjct: 661 RIFDQFQST-DRMIRGFAYGGIGPVDPTTGDHLGGVTYFNASAEAQFPLPVVPESFGLRG 719

Query: 710 AFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDK 769
           A F D+ATLY + +    ++   +    R S G+ +MW SP G + + Y IP+R    D 
Sbjct: 720 AVFADAATLYGSKIDTSVNQSSLD-MKLRASVGIGLMWASPFGPIRIDYAIPVRKEATDD 778

Query: 770 IQQFGFRIGNRM 781
           +Q+F F I  R 
Sbjct: 779 VQEFNFGISTRF 790


>gi|90580979|ref|ZP_01236780.1| putative surface antigen [Vibrio angustum S14]
 gi|90437857|gb|EAS63047.1| putative surface antigen [Vibrio angustum S14]
          Length = 808

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 167/808 (20%), Positives = 300/808 (37%), Gaps = 49/808 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNT-SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
             +  +++   +   S  + +    +V  I   G   V     L ++PV VG ++   D+
Sbjct: 1   MAIKKLLVASLLLTSSVAHSAEDKFVVDNIRFEGLQRVTLGAALLKMPVRVGDTVDQQDI 60

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RS 138
              +K++Y+ G F N+++    + L ID+ ER  I  + FSGN  +K +QLK  +     
Sbjct: 61  SELIKSLYSSGNFENIRVYRDGNTLQIDVTERPTIADITFSGNKAIKAEQLKENLEASGL 120

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R   A D  T+      ++  Y S+G  N  V+     +     +I +V  EGV AKI  
Sbjct: 121 RVGEALDRTTLRKIEKGLEDFYYSVGKYNATVEAVVTPLPRNRADIKFVFTEGVSAKIKQ 180

Query: 199 IRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  +GN  +S   L    +      +++F   + Y K+ +  D E +R+ Y + GY   +
Sbjct: 181 INILGNHVFSDDELRSKFTLKDDVPWWNFMANEKYQKQVLQGDLETLRSQYLNNGYLKYR 240

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           +    +        V I                       +      L+  ++G++YN  
Sbjct: 241 LDDTQVSISPDKKGVYITLKIHEGHQYKVKNVQFRGDVTGRVAEFDKLVTFKTGSVYNGA 300

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            +    E + +        + +V T    D     V +   ++QG  +YV+ IE  GN  
Sbjct: 301 AVTSLEEAVKRKLGEAGYAYPKVTTYPEFDDKTNEVSLVVNVEQGKRIYVRNIEFRGNTN 360

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RRE+   EG  +N   IE  K R+  TG+F  V++  +      D V ++ +VK
Sbjct: 361 TKDEVLRREMRQMEGTWLNAKKIETGKTRLNRTGFFENVDVQTVRVPGSDDQVDIKYNVK 420

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVE 493
           + ++GSV     Y  + G+  +  +  +NF G G R  + A    ++             
Sbjct: 421 EANSGSVNFGVGYGTESGISFQAGLTQDNFLGTGNRFGINAMTNDYSKNISLEYNDPYFT 480

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        + + +              ++    P  E    +F       +    
Sbjct: 481 INNVSLGGKIYYNEFEASDANISDYTNQSYGTSLTWGFPFNELNYFNFSLGYDHNKISNT 540

Query: 554 SEKEKIPSIYT------TLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
            +  +I                     +S +     N L+    P  G     S+     
Sbjct: 541 QDYYQIQQFKKIHGFDLDSDNAITLDDYSWTFGWTRNNLNRGYFPTSGNRQDFSFKMTIP 600

Query: 608 GGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKN-----LQLFDQFSVSS 660
           G DSQY +       +  L++  +  ++   + GYG    +  N     +  ++ F    
Sbjct: 601 GSDSQYFKAQYNVRQYIPLTESQNFSLLLRGKLGYGNGYGTTDNGSDQLMPFYENFYAGG 660

Query: 661 NYYLRGFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVP 702
              +RGF    +GP+                       A GG   + AS  +  P P V 
Sbjct: 661 FSTIRGFRSNTVGPKAVFVGGCGVNGQGNNNCATGTDDAAGGNAIALASMELIVPTPFVS 720

Query: 703 ER--AGLRGAFFVDSATLYANHVALGADKLEG-------NDSFWRVSTGVEIMWNSPLGM 753
           +     +R +FFVD+ +++     L     +G       +    R S G  + W SP+G 
Sbjct: 721 DELKNQIRTSFFVDAGSVWDTEYNLNYKSSDGQKLADYSDPGMIRASAGAALQWMSPMGP 780

Query: 754 MGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +      P++  EGD  + F F IG   
Sbjct: 781 LVFSVAKPIKKYEGDDEEFFTFTIGQTF 808


>gi|85059913|ref|YP_455615.1| outer membrane protein assembly factor YaeT [Sodalis glossinidius
           str. 'morsitans']
 gi|123518941|sp|Q2NRL5|YAET_SODGM RecName: Full=Outer membrane protein assembly factor yaeT; Flags:
           Precursor
 gi|84780433|dbj|BAE75210.1| outer membrane protein [Sodalis glossinidius str. 'morsitans']
          Length = 808

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 178/806 (22%), Positives = 328/806 (40%), Gaps = 51/806 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +   + VYG++  +V+ I   G   V     L  +P+ VG + +D D+ 
Sbjct: 1   MAMKKLLIASLLLSSATVYGADGFVVKDIHFEGLQRVAVGAALLSMPIRVGDTATDEDIG 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      +++ + ER  I  + FSGN  +K++ LK  +     R
Sbjct: 61  NTIRALFATGNFEDVRVLRDGDSVVVQVKERPTIASITFSGNKAVKEEMLKQNLDAQGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTISNIEKGLEDFYYSAGKYSTTVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  ++   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NIVGNHAFTTDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            + ++ +         +  L ++  G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITLNITEGAQYKLSGTVVNGNMAGHSAEIEQLAKVHPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +    I +        + RV T+   + A + V +   +D G+  YV+ +  EGND +
Sbjct: 301 VTKMENDIKQLLGRYGYAYPRVATQQEINDADKTVKLHISVDAGNRFYVRHVRFEGNDIT 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            DSV+RRE+   EG  +  +++++ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDSVLRREMRQMEGAWLGSNLVDQGKERLNRLGYFETVDTETQRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            + GS+ +   +  + G+  +  I  +N+ G G     +     +               
Sbjct: 421 RNTGSINVGVGFGTESGVSFQFGIQQDNWLGTGNSVGFSGTKNDYQTYAELSMTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       D      +    D+        +  PI+E+ S +F  D        + 
Sbjct: 481 DGVSLGGKIFYNDFSADDADLSDYDLRRYGVGTTLGFPISENHSLNFGLDYVHDDLTNMQ 540

Query: 555 EKEKIPSIYTTLIEHGKFSSHS--------------ISQSIIYNTLDNPIVPRKGMLISS 600
            +  +     ++  + K  + +              +S    YN LD    P  G   S 
Sbjct: 541 PQVTMWRYLDSVGINPKVVTTNKADSDADFSADDFFLSMGWSYNNLDRGYFPTAGSRASL 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSV 658
           +      G D++Y++I   AS++  LS+  +  ++G  R GY   +   KN+  +D F  
Sbjct: 601 TGKVTVPGSDNEYYKITFDASHYIPLSESGNWVLMGRARAGYADGLG-GKNVPFYDNFYA 659

Query: 659 SSNYYLRGFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPL 700
             +  +RGF    IGP+                       A+GG   + ASA +  P P 
Sbjct: 660 GGSNTVRGFRSNTIGPKAAYYKCNSGNTRYSDCPVDKSSDAVGGNAMAIASAELIMPTPF 719

Query: 701 VPERA--GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLG 752
           + E+    +R + FVD  T++       +           +    R+S+G+ + W SPLG
Sbjct: 720 LSEKYANSVRTSLFVDGGTVWDTSWQNTSATRAAGIPDYSDPGNIRISSGIALQWMSPLG 779

Query: 753 MMGVYYGIPLRHREGDKIQQFGFRIG 778
            +   Y  P++  +GDK +QF F IG
Sbjct: 780 PLVFSYAQPVKKYDGDKSEQFQFNIG 805


>gi|307317020|ref|ZP_07596461.1| outer membrane protein assembly complex, YaeT protein
           [Sinorhizobium meliloti AK83]
 gi|306897108|gb|EFN27853.1| outer membrane protein assembly complex, YaeT protein
           [Sinorhizobium meliloti AK83]
          Length = 776

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 272/777 (35%), Positives = 436/777 (56%), Gaps = 4/777 (0%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   R L      +     +     +  ++    +  +++ R+E+RGAT V  E + + 
Sbjct: 1   MKAGSRFLNAVSAFALSASMVATGTGVGLVAGTSVAQAAVINRVEVRGATRVSAETVRAN 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           I +V G+S S+AD+D +VK +YA GYFS+V I +    L++ + E +++N + F+GN  +
Sbjct: 61  ITIVPGKSFSNADIDASVKRLYATGYFSDVSITVSGGSLVVSVSENQLVNQVVFNGNRKI 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KDD+L+ +VR++    Y E TV  D+  I+ AYA+IG  +V V  Q   I+   +N+ +V
Sbjct: 121 KDDKLQGVVRTQPLGPYSEATVETDIQAIRDAYAAIGRSDVTVTTQVAPIAEGRVNLAFV 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRA 246
           I EG + KI  I FVGN+ YS  RL+ VI+ + SG FSF  + DVY+ +++  DEE +R 
Sbjct: 181 INEGERTKITQINFVGNEVYSDGRLQSVIATKESGIFSFLTRKDVYNPDKLRADEEFLRQ 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++RGYA  +V S      +  + Y +   I+EG  Y  G ++I+ST++ I  + L  L
Sbjct: 241 FYYNRGYADFQVVSSEAALNEATNEYTVTITIEEGPRYDFGPVNIESTVEGIDAEELRGL 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           ++ R G +Y  ++I+ +  +ISK   S   PF RV  R NRD A   + ++YL+DQG   
Sbjct: 301 VQSREGTVYKAKDIQSTMSEISKRVASEGYPFARVTPRGNRDLANHTIAVDYLVDQGERA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RIEI GN ++ D VIRRE ++ EGD  N  M+ RAKRR+ A GYFS VNIS  P + 
Sbjct: 361 YVERIEIRGNTRTRDYVIRREFDVGEGDAFNQEMVARAKRRLEALGYFSSVNISTQPGSA 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
               VI+     Q +      A     D G  +     +   F    +    A       
Sbjct: 421 ADRVVIVVDVQDQSTGSFGIGAGYSAGDGGGFLVEASIEEKNFLGRGQYIRLAAGKGEDS 480

Query: 486 QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
           Q Y  S  +PYFLG  ++AGFDL K   +    + +       + V    + + S     
Sbjct: 481 QTYNVSFTEPYFLGYRLAAGFDLFKNENDFDDDNYSYNDQGFSLRVTAPITENLSTTLRY 540

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            + +     +++++ S Y  +I+   ++  SISQSI YNTLD+  +P +G+L S + ++A
Sbjct: 541 NYTELEYFGDRDELSSPYDRVIDGSPWTRSSISQSITYNTLDDAQLPHEGILASVTQEFA 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G GG S ++++  +A ++Y L D++DI+GSL    G +  ++ +L++FDQF + ++  +R
Sbjct: 601 GLGGTSDFYKLTGKAKWYYTLHDEADIIGSLSGSAGHLFETSGSLEVFDQFQL-NSNDIR 659

Query: 666 GFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAL 725
           GF   G+GPR++   A+GG  Y +ASA  +FP+P +P  +G RGA FVD+ TLY N V +
Sbjct: 660 GFERNGLGPRMNNGDALGGTTYFTASAEATFPLPGLPRDSGFRGALFVDAGTLYGNDVEI 719

Query: 726 GA-DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           G  + + G+D+  R S GV ++W SP G + V Y +P+   + D++Q F F I +  
Sbjct: 720 GPGESVRGDDASLRASVGVSLIWASPFGPLRVDYAVPVAKEDFDEVQNFKFGINSSF 776


>gi|289675270|ref|ZP_06496160.1| surface antigen (D15):surface antigen variable number [Pseudomonas
           syringae pv. syringae FF5]
          Length = 791

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 174/792 (21%), Positives = 331/792 (41%), Gaps = 36/792 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGNK +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNKVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNINEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLSVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GKYTVDEIFDFVEKEGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG         V FP+P V ++  LR + F D   +
Sbjct: 660 PRSTPSNGSKPGTLADPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRSLRTSVFWDVGNV 719

Query: 719 YANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD-K 769
           +  +                  + S    S G+ + W + LG +     +P++  + + +
Sbjct: 720 FDTNCDSKKTTASNKTVECNNIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPDDEAE 779

Query: 770 IQQFGFRIGNRM 781
            Q F F +G   
Sbjct: 780 TQVFQFSLGQTF 791


>gi|322835500|ref|YP_004215526.1| outer membrane protein assembly complex, YaeT protein [Rahnella sp.
           Y9602]
 gi|321170701|gb|ADW76399.1| outer membrane protein assembly complex, YaeT protein [Rahnella sp.
           Y9602]
          Length = 807

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 188/805 (23%), Positives = 327/805 (40%), Gaps = 50/805 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  ++L   +F  + V+ +   +V+ I + G   V     L  IPV VG ++SD D+ 
Sbjct: 1   MTMKKLLLASLLFSSAPVFAAGGFVVKDIHVEGLQRVTVGAALLSIPVRVGDTVSDDDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F +VK+    + LI+ + ER  I  + FSGN  +KD+ L+  +     R
Sbjct: 61  QTIRALFATGNFDDVKVLEDGNTLIVQVKERPTIASITFSGNKAIKDEMLQQNLEASGIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+++    ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGDALDRTTISSIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDVKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK ++   L           +++      Y K+++S D E +R+FY DRGYA   +
Sbjct: 181 NIVGNKAFTSDDLIAHFQLRDEVPWWNVIGDKKYEKQKLSGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +  + +         + SL  I +G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNIAEGAQYTVSGVVVTGDMAGHSSEIESLATIPAGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +    I          +  V T+ + +   + V +   +D G+   V+RI  EGND S
Sbjct: 301 VTKVEGDIKNLLGRYGYAYPHVTTQSDINETDKTVKLHISVDTGNRYSVRRIRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +   ++++ K R+  TGYF  V++   P    +D V +   VK+
Sbjct: 361 KDEVLRREMRQMEGAWLGNDLVQKGKDRLNRTGYFESVDVDTQPVPGSADQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G+  +   Y  D G+  +  +  +N+ G G     +     +               
Sbjct: 421 RNTGTFNVGLGYGTDSGISYQLGVTQDNWLGSGNTVSFSGTRNSYQTYVEVSATNPYYTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                              +  + ++      V + +P++E+ + +   D        + 
Sbjct: 481 DGISLGGKVFYNHYDAEDNDLAAYNLQSYGTGVNLGLPVSENNTLNLGLDYVHSTLSDME 540

Query: 555 EKEKIPSI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSS 601
            +  +                 T        +    S    YN L+    P  G   S +
Sbjct: 541 PQVAVWRYLNASGVHPGLVTTSTNSDAQLSTNDFFASVGWAYNDLNRGFFPSSGTRASLA 600

Query: 602 YDYAGFGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKNLQLFDQFSVS 659
                 G D  Y++I   A+++  LSD  D  ++G  + GY   I SN+ +  +D F   
Sbjct: 601 AKVTTPGSDDSYYKITFDANHYIPLSDKSDWVLMGRAKAGYAAGIGSNE-VPFYDNFYAG 659

Query: 660 SNYYLRGFAYKGIGPRVD------------------KKYAIGGKIYSSASAAVSFPMPLV 701
            +  +RGF+   IGP+                       A+GG   + ASA +  P P +
Sbjct: 660 GSSSVRGFSSNTIGPKAAYYKCSSADSSYSTCPVTKSTDAVGGNAMAIASAELYVPTPFI 719

Query: 702 PERA--GLRGAFFVDSATLYANHVALGAD------KLEGNDSFWRVSTGVEIMWNSPLGM 753
            E+    +R + FVDS T++       +           + +  RVS+G+ + W SPLG 
Sbjct: 720 SEKYASSVRTSLFVDSGTVWDTRWKNTSATEAAGIPDYSDPTHIRVSSGIALQWQSPLGP 779

Query: 754 MGVYYGIPLRHREGDKIQQFGFRIG 778
           +   Y  PL   EGD  +QF F IG
Sbjct: 780 LVFSYAQPLVKYEGDSAEQFQFNIG 804


>gi|110633741|ref|YP_673949.1| surface antigen (D15) [Mesorhizobium sp. BNC1]
 gi|110284725|gb|ABG62784.1| surface antigen (D15) [Chelativorans sp. BNC1]
          Length = 788

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 238/792 (30%), Positives = 400/792 (50%), Gaps = 22/792 (2%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            + + RL+      +   G ++    +  L+A   +  + V RIE+RG   V  E I ++
Sbjct: 1   MKAVSRLMSAVSAVALSAGIVVSGAMVAELTATVSAYAATVSRIEVRGNRRVDAETIRNQ 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           + +  GQ+ + AD+D AVK ++A G F++V I      L++ + E  I+N + F GN  +
Sbjct: 61  VGIRPGQNFTTADVDEAVKRLFATGLFADVSITQQGGALVVSVDEYAIVNQVLFQGNRKV 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KD  L   ++ +  +A+    V +D   I++AY  +G     V  +   +    +N+ + 
Sbjct: 121 KDQTLSEAIQLKPRSAFSNQLVESDAEVIREAYRRVGRDEATVTSEVQDLGEGRVNVIFH 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIRA 246
           ++EG + KI  I F GN  +S  RL  VI+ + S  F    + DVY + R+  DEE +R 
Sbjct: 181 VQEGDRTKITEINFEGNTAFSDRRLRDVITTKRSNVFSFMMRNDVYDEARLQADEELLRR 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLI 306
           FY++RGYA  +V S          Y +   +DEG+ YT G++SI+ST+  +    L S +
Sbjct: 241 FYYNRGYADFRVISSDAQLVDN-KYTITIMVDEGQRYTFGDVSIESTIPGVDVSALQSAL 299

Query: 307 RIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLY 366
           + R G +Y+ +++++S   +++        F +V  R NRDF  R + + Y ID+G   Y
Sbjct: 300 KTRQGAVYSAEDVEQSIIGLTEDVAGHGYAFAQVTPRGNRDFQNRTISVVYSIDEGPRAY 359

Query: 367 VKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDV 426
           V+RIEI  N+++ D VIRRE ++SEGD  N  +I+RAKRR+    +F  VNI+ +P +  
Sbjct: 360 VERIEIRANNRTRDYVIRREFDVSEGDAFNQILIQRAKRRLERLNFFQTVNITTVPGSQP 419

Query: 427 SDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAA-------- 478
              V++   V++ +      A            G   + +   + +  R           
Sbjct: 420 DQVVLVVDVVEKSTGEFSIGAGYTTSASSGSSGGFSVEGSVTERNFLGRGQFIRFAAAGG 479

Query: 479 GFGRHAVQNYTFSVE--DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITES 536
              R    ++T           G  +       +    D   D       VR  +PIT++
Sbjct: 480 EKSRDYTFSFTEPYFLGRRIAAGFDVFRNTRTFEDSDGDNIYDREVTGGTVRFGLPITDA 539

Query: 537 ISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGM 596
           ++    Y+L   +Y  +++   + +     ++ GK+   S+S S+IYNT+DN   P  G+
Sbjct: 540 LTAQLAYNLTQEEYERLADSSDLSTGINQALDQGKWVKSSVSASLIYNTIDNMQNPHDGI 599

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQ 655
             + + + AG GGD+++ +  +RA+Y+  LSD+ D+VG L  G G ++   ++ L++FDQ
Sbjct: 600 YANLTTEIAGLGGDAKWAKFTARANYYRTLSDELDLVGLLTVGGGHIVAFGDEPLRIFDQ 659

Query: 656 FSVSSNYYLRGFAYKGIGP------RVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRG 709
           F+  ++  +RGF Y GIGP        D +  +GG  Y  ASA   FP+P+VPE  GLRG
Sbjct: 660 FNS-NDRIIRGFEYNGIGPFELRSAGDDDRDYLGGTTYFHASAEAQFPLPIVPESFGLRG 718

Query: 710 AFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDK 769
           A F D+ATLY +     +  + G D  WR S G  ++W SP G + V Y  P+   + D+
Sbjct: 719 AVFADAATLYGSDYT--SPLVRGTDMEWRASVGASLIWASPFGPLRVDYAEPVVKEDTDR 776

Query: 770 IQQFGFRIGNRM 781
           I+ + F I  R 
Sbjct: 777 IRHWNFGISTRF 788


>gi|330977888|gb|EGH77791.1| surface antigen (D15):surface antigen variable number [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 790

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 171/785 (21%), Positives = 318/785 (40%), Gaps = 31/785 (3%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           ++L + +     +  ++T  +  I + G   V    + S +P+ VG    +  L  A ++
Sbjct: 6   LLLSFCLLISVPLAHADTFSISDIRVNGLQRVSAGSVFSALPLNVGDQADEQRLADASRS 65

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAY 144
           ++  G+F ++ +    +VL+I+++ER  I  +   GN  +  D L   ++         +
Sbjct: 66  LFKTGFFQDINVARDGNVLVINVVERPSIASIEIVGNKVISTDDLMKGLKQSELSEGEIF 125

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
              T+    + +++ Y S G  +  V  +        + +   I+EG  A I  I  VGN
Sbjct: 126 QRATLEGVRNELQRQYVSQGRYSASVDTEALPAPRNRIALKITIDEGTVASIQHINVVGN 185

Query: 205 KNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL 263
             +S  +L     ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++S  +
Sbjct: 186 TVFSDEQLADQFQLKTSNWLSFFKNDDKYAREKLSGDLERLRSWYLDRGYINMDINSTQV 245

Query: 264 FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESS 323
                   V I                     ++ K  L  LI ++ G +++ + + +S+
Sbjct: 246 SLTPDKKGVFITVNITEGDRYTVGSVKLGGDLKVPKDQLEQLILVKPGQVFSRKVMTDST 305

Query: 324 EKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVI 383
             I++   +    F  V      + A   VDI +++D G   Y  RI   GN ++ D V+
Sbjct: 306 NLITRRLGNDGYTFANVNGLPKANDADHTVDISFVVDPGKRAYANRINFRGNTKTADEVL 365

Query: 384 RRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS 443
           RRE+   EG   +  +I+++K R+   G+F EVN+    A    D V +  +V++ ++G+
Sbjct: 366 RREMRQMEGGWASTYLIDQSKVRLERLGFFKEVNVETPAAPGTDDQVDINYAVEEQASGN 425

Query: 444 VGIATNYEVDKGMGVEGHIDDNNFFGQGY-------RARLAAGFGRHAVQNYTFSVEDPY 496
           +  +  +    G+ + G I  NN  G G        R+     +       Y        
Sbjct: 426 ITASVGFSQSAGLILGGSISQNNILGTGNFASLGMTRSEYQTKYNFAFTNPYFTPDGVSL 485

Query: 497 FLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
                 +A    +    +D     +  S    + +    S ++   Y L   +    +  
Sbjct: 486 GYNVFYNATDYSKYYDDDDEVSYYSLNSVGAGVNLGYPISETSRLTYGLSIQRDTLDAGS 545

Query: 557 EKIPSIYTTLIEHGK-FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
                IY  +   G  F++   S     +TL+  ++  +G   S +      G D Q ++
Sbjct: 546 YSADEIYDFIEREGDAFTNLKASVGWSESTLNKGVLATRGHSQSLTLTSTVPGSDLQLYK 605

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           +      F  LSD + +    + GYG        L  ++ ++      +RGF    +GPR
Sbjct: 606 LDYNGQTFLPLSDTTSLRLHTKLGYGNGYGDTDGLPFYENYTAGGQATVRGFKDGTLGPR 665

Query: 676 -----------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
                                 A+GG I  +      FPMP V ++  LR + F D  T+
Sbjct: 666 NTPATGTYASQGQIYYSDRDTEALGGNILITGGMEYLFPMPFVKDQKSLRTSLFWDFGTV 725

Query: 719 YANHV--ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFR 776
           YA+        +    N      S GV + W SPLG +     +P++  E  + Q F F 
Sbjct: 726 YADKCYLTTTQNCGNINIDQMASSVGVGVTWYSPLGPLSFDLAVPIKKPEDAETQVFQFS 785

Query: 777 IGNRM 781
           +G   
Sbjct: 786 LGQTF 790


>gi|107103162|ref|ZP_01367080.1| hypothetical protein PaerPA_01004231 [Pseudomonas aeruginosa PACS2]
          Length = 781

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 166/776 (21%), Positives = 325/776 (41%), Gaps = 38/776 (4%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           + +  V  I + G   V    + + +P+ VG++I D  L  A ++++  G+F ++++   
Sbjct: 7   AESFTVSDIRVNGLQRVSAGSVFAALPLNVGETIDDQALVQATRSLFKTGFFQDIQLGRD 66

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQA 159
            +VL++ ++ER  I+ +   GN  +  + L   ++         +   T+    + +++ 
Sbjct: 67  GNVLVVTVVERPSISSIEIEGNKAISKEDLLKGLKQSGLAEGEIFQRATLEGVRNELQRQ 126

Query: 160 YASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIR 219
           Y + G  +  +  +        + +   I EG  A I+ I  VGN  +S   L  +  ++
Sbjct: 127 YVAQGRYSAEINAEVIPQPRNRVALKININEGTVAAISHINVVGNTVFSEEDLTDLFELK 186

Query: 220 TSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQID 278
           T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S  +       +V I    
Sbjct: 187 TTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIASTQVSITPDKKHVYITVNI 246

Query: 279 EGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFV 338
                        +   ++ ++ +  L+ ++ G +++ + +  +S+ I++   +    F 
Sbjct: 247 NEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTTTSDLITRRLGNEGYTFA 306

Query: 339 RVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYS 398
            V          + V + +++D G   YV RI   GN ++ D V+RRE+   EG   +  
Sbjct: 307 NVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDEVLRREMRQMEGGWASTY 366

Query: 399 MIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGV 458
           +I+++K R+   GYF EVN+         D V +  SV++  +GS+  +  +    G+ +
Sbjct: 367 LIDQSKARLERLGYFKEVNVETPAVPGTDDQVDVNYSVEEQPSGSITASVGFAQSAGLIL 426

Query: 459 EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSL 518
            G I  NNF G G +  +           Y F   DPY+    +S G++      +   L
Sbjct: 427 GGSISQNNFLGTGNKVSIGL-TRSEYQTRYNFGFVDPYWTVDGVSLGYNAFYRKTDYDEL 485

Query: 519 DINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHG-KF 572
           D++  S +V      M +    S ++   Y L   +    + +  +  IY  L + G  F
Sbjct: 486 DVDVASYSVNSLGAGMSIGYPISETSRLTYGLSVQRDQIDTGRYTVDEIYDFLDKEGDNF 545

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDI 632
           ++   S     +TL+  ++  +G   S + +    G D  +++I  R   F  L+D+  +
Sbjct: 546 TNFKASIGWSESTLNKGVLATRGHSQSLTLETTLPGSDLSFYKIDYRGQVFAPLTDNYTM 605

Query: 633 VGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR----------------- 675
                 GYG    S + L  ++ +       +RGF    +GPR                 
Sbjct: 606 RFHTELGYGDGYGSTERLPFYENYYAGGFNSVRGFKDSTLGPRSTPSRAYKDGKIIPGPD 665

Query: 676 --------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVA--L 725
                        A GG I  +  A + FP+P V ++  LR   F D  + +        
Sbjct: 666 ERGRYTDPDQDPEAFGGNILITGGAELLFPLPFVKDQRQLRTVLFWDVGSTFDTDCPTKT 725

Query: 726 GADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             +           S GV + W + LG +      P++  +  + Q F F +G   
Sbjct: 726 TTNCDGIKTDNLASSVGVGLTWITALGPLSFSLATPIKKPDNAETQVFQFSLGQTF 781



 Score = 59.3 bits (141), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/187 (16%), Positives = 67/187 (35%), Gaps = 18/187 (9%)

Query: 34  IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDA----DLDHAVKNIY 89
           ++    +       +R +++ G   V +E +   + V  GQ  S        D   + + 
Sbjct: 240 VYITVNINEGEKYTIRDVKLTGDLKVPEEEVKRLLLVQKGQVFSRKVMTTTSDLITRRLG 299

Query: 90  AMGY-FSNV----KIKIVDSVLIIDLI----ERKIINHLFFSGNNNLKDDQLKMIVRSRS 140
             GY F+NV    +    D  + +  +    +R  +N + F GN   +D+ L+  +R   
Sbjct: 300 NEGYTFANVNGVPEAHDDDKTVSVTFVVDPGKRAYVNRINFRGNTKTEDEVLRREMRQME 359

Query: 141 AAAYDEDTVNADVHNIKQA-YASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
                   ++     +++  Y    +  V V+      +   +++ Y +EE     I + 
Sbjct: 360 GGWASTYLIDQSKARLERLGY----FKEVNVETPAVPGTDDQVDVNYSVEEQPSGSITAS 415

Query: 200 RFVGNKN 206
                  
Sbjct: 416 VGFAQSA 422


>gi|148547606|ref|YP_001267708.1| surface antigen (D15) [Pseudomonas putida F1]
 gi|148511664|gb|ABQ78524.1| surface antigen (D15) [Pseudomonas putida F1]
          Length = 787

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 166/775 (21%), Positives = 322/775 (41%), Gaps = 33/775 (4%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           + +  ++   +  I + G   V    +   +P+ VG    D  L  + ++++  G+F ++
Sbjct: 15  ATLAQASPFRIADIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVDSTRSLFKTGFFQDI 74

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVH 154
           ++    +VLII+++ER  ++ +   GN  +  + L   ++         +   T+    +
Sbjct: 75  QLSRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAEGEIFQRATLEGVRN 134

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
            +++ Y + G  +  V  +        + +   I EG  A I  I  VGN  +    L +
Sbjct: 135 ELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHINIVGNNVFDDETLGQ 194

Query: 215 VISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVL 273
           +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S  +       +V 
Sbjct: 195 LFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIASTQVSITPDKKHVY 254

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
           I                 S   ++ +  + SL+ ++ G +++ + +  +SE I++   + 
Sbjct: 255 ITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVMTTTSELITRRLGNE 314

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
              F  V      +     VDI +++D G   YV RI   GN ++ D V+RRE+   EG 
Sbjct: 315 GYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTEDEVLRREMRQMEGG 374

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             +  +I+++K R+   G+F EVN+         D V +  SV++ ++GS+  +  +   
Sbjct: 375 WASTYLIDQSKTRLERLGFFKEVNVETPQVPGTDDQVDVNYSVEEQASGSITASVGFAQS 434

Query: 454 KGMGVEGHIDDNNFFGQGYRAR-------LAAGFGRHAVQNYTFSVEDPYFLGSPISAGF 506
            G+ + G I  NNF G G +             +    V  Y  +           ++  
Sbjct: 435 AGLILGGSISQNNFLGTGNKVSIGLTRSEYQTKYNFGFVDPYFTADGVSLGYNLFYNSTD 494

Query: 507 DLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTL 566
                        IN   A V    PI E+   ++   L+       +       IY  +
Sbjct: 495 YSDYYDDGVSYYAINSYGAGVSFGYPINETSRLTYGLTLQHDDISPGTY--SADEIYDFI 552

Query: 567 IEHGK-FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              GK F++   S     +TL+  ++  +G   S +      G D  ++++      F  
Sbjct: 553 SREGKSFNNLKASIGWSESTLNKGVLATRGHSQSLTLMATTPGSDLSFYKLDYNGQAFLP 612

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---------- 675
           ++ ++ +      GYG    S   L  ++ ++      +RGF    +GPR          
Sbjct: 613 VTSNTTLRLHTNLGYGNGYGSTDGLPFYESYNAGGQGSVRGFKDGTLGPRSTPATGAYSS 672

Query: 676 -------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGAD 728
                        +GG I  +  A   FP+P V +++ LR + FVD+  +YA+   L   
Sbjct: 673 AGQAYYSDRDTDVLGGNILITGGAEYLFPLPFVKDQSQLRSSVFVDAGNVYADTCYLSTT 732

Query: 729 KLEG--NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +  G  + +   VS GV + W SP+G +      PL+  +  + Q F F +G   
Sbjct: 733 QGCGSVDLAQMAVSLGVGVTWYSPMGPLSFSLAAPLKKPDNAETQVFQFSLGQTF 787


>gi|241760579|ref|ZP_04758671.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           flavescens SK114]
 gi|241318760|gb|EER55286.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           flavescens SK114]
          Length = 798

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 182/799 (22%), Positives = 343/799 (42%), Gaps = 41/799 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     +  LS +  ++   ++ I + G        + + +PV VG + +DA  +
Sbjct: 1   MKLNQIASALMVLSLSPMALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDNFNDARSE 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K +YA G+F +V+++ +D+ +++ +IER  I+ L  +G   L++D +K  +      
Sbjct: 60  EIIKKLYATGFFDDVRVETMDNQVLLTVIERPTISSLNITGAKMLQNDAIKKNLEAFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y S G  +V +      ++   ++I   IEEG   KI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLSRGKQSVQITPTVTKLARNRVSIDIAIEEGKSTKITDI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  RL + +S      +    K++ +++++ + D E I  FY + GY   ++
Sbjct: 180 SFEGNEVYSDRRLMKQMSLSEGGMWTWITKSNQFNEQKFAQDMEKITNFYQNNGYFNFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EG+ +  GN+ I+    E+ K+ L  L+ ++ G  Y   
Sbjct: 240 LDTDIQTNEDKTKQTIKVTVSEGDRFRWGNVRIEGDTLEVPKEDLEKLLTMKPGKWYERA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++  S E I          F  +  +   +     VD    +  G  +YV  I I GN++
Sbjct: 300 QMSNSLEAIQNRMGQAGYAFSEINVQPIPNAETHTVDFVLTVQPGRKIYVNEINITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D VIRREL   E  P + + ++R+K R+   GYF  V    +P  +  D V L +S+ 
Sbjct: 360 TRDEVIRRELRQMESAPYDSAKLQRSKERVELLGYFDNVQFDAVPVANTPDQVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG----FGRHAVQNYTFSVE 493
           + S GS+ ++  +  D G+ +   +  +N FG G    L A         ++        
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVAQDNLFGTGKSVALRASRSKTTVNGSLSFTDPYFT 479

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                      G           +      +    + + I  +      + L   +    
Sbjct: 480 PDGVSLGYDLYGKSYDPRKASSSTKQYKTTTFGGGLRIGIPVTEYDRVNFGLAAERLTVN 539

Query: 554 SEKEKIPSIYTTLIEHGKFSSHSI----------SQSIIYNTLDNPIVPRKGMLISSSYD 603
           + K         + ++GK     +          +     N  DN + P +G L   + +
Sbjct: 540 TYKGAPKRYADFINQYGKGDGSGVGNFKGWLYKGTIGWGRNKTDNALWPTRGYLTGVNGE 599

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
            A  G D QY+ +    ++F+ LS D  ++     GYG      K +  F+ F       
Sbjct: 600 IALPGSDLQYYTLTHNQTWFFPLSKDFTLMLGGEVGYGNGYGKTKTMPFFENFYGGGLGS 659

Query: 664 LRGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           +RGF    +GP+V  +Y    + GG   ++ SA + FPMP + +   +R + F D+ +++
Sbjct: 660 VRGFESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDSRTVRLSLFADAGSVW 719

Query: 720 A-----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPL 762
                             N   +G        +  R S G  + W SPLG M   Y  P+
Sbjct: 720 DGKTYNDGSSSNSNGVSQNVYGVGTTHKSTFKNELRYSAGAAVTWLSPLGPMKFSYAYPI 779

Query: 763 RHREGDKIQQFGFRIGNRM 781
           + +EGD+IQ+F F++G   
Sbjct: 780 KKKEGDEIQRFQFQLGTTF 798


>gi|15965255|ref|NP_385608.1| putative outer membrane transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307309278|ref|ZP_07588946.1| outer membrane protein assembly complex, YaeT protein
           [Sinorhizobium meliloti BL225C]
 gi|15074435|emb|CAC46081.1| Putative outer membrane transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306900279|gb|EFN30896.1| outer membrane protein assembly complex, YaeT protein
           [Sinorhizobium meliloti BL225C]
          Length = 776

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 271/777 (34%), Positives = 436/777 (56%), Gaps = 4/777 (0%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   R L      +     +     +  ++    +  +++ R+E+RGAT V  E + + 
Sbjct: 1   MKAGSRFLNAVSAFALSASMVATGTGVGLVAGTSVAQAAVINRVEVRGATRVSAETVRAN 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           I +V G+S S+AD+D +VK +YA GYFS+V I +    L++ + E +++N + F+GN  +
Sbjct: 61  ITIVPGKSFSNADIDASVKRLYATGYFSDVSITVSGGSLVVSVSENQLVNQVVFNGNRKI 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KDD+L+ +VR++    Y E TV  D+  I+ AYA+IG  +V V  Q   I+   +N+ +V
Sbjct: 121 KDDKLQGVVRTQPLGPYSEATVETDIQAIRDAYAAIGRSDVTVTTQVVPIAEGRVNLAFV 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRA 246
           I EG + KI  I FVGN+ YS  RL+ VI+ + SG FSF  + DVY+ +++  DEE +R 
Sbjct: 181 INEGERTKITQINFVGNEVYSDGRLQSVIATKESGIFSFLTRKDVYNPDKLRADEELLRQ 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++RGYA  +V S      +  + Y +   I+EG  Y  G ++I+ST++ I  + L  L
Sbjct: 241 FYYNRGYADFQVVSSEAALNEATNEYTVTITIEEGPRYDFGPVNIESTVEGIDAEELRGL 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           ++ R G +Y  ++I+ +  +ISK   S   PF RV  R NRD A   + ++YL+DQG   
Sbjct: 301 VQSREGTVYKAKDIQSTMSEISKRVASEGYPFARVTPRGNRDLANHTIAVDYLVDQGERA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RIEI GN ++ D VIRRE ++ EGD  N  M+ RAKRR+ A GYFS VNIS  P + 
Sbjct: 361 YVERIEIRGNTRTRDYVIRREFDVGEGDAFNQEMVARAKRRLEALGYFSSVNISTQPGSA 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
               VI+     Q +      A     D G  +     +   F    +    A       
Sbjct: 421 ADRVVIVVDVQDQSTGSFGIGAGYSAGDGGGFLVEASIEEKNFLGRGQYIRLAAGKGEDS 480

Query: 486 QNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
           Q Y  S  +PYFLG  ++AGFDL K   +    + +       + V    + + S     
Sbjct: 481 QTYNVSFTEPYFLGYRLAAGFDLFKNENDFDDDNYSYNDQGFSLRVTAPITENLSTTLRY 540

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
            + +     +++++ S Y  +I+   ++  SISQSI YNTLD+  +P +G+L S + ++A
Sbjct: 541 NYTELEYFGDRDELSSPYDRVIDGSPWTRSSISQSITYNTLDDAQLPHEGILASVTQEFA 600

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G GG S ++++  +A ++Y L D++DI+GSL    G +  ++ +L++FDQF + ++  +R
Sbjct: 601 GLGGTSDFYKLTGKAKWYYTLHDEADIIGSLSGSAGHLFETSGSLEVFDQFQL-NSNDIR 659

Query: 666 GFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAL 725
           GF   G+GPR++   A+GG  Y +ASA  +FP+P +P  +G RGA FVD+ TLY N V +
Sbjct: 660 GFERNGLGPRMNNGDALGGTTYFTASAEATFPLPGLPRDSGFRGALFVDAGTLYGNDVEI 719

Query: 726 GA-DKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           G  + + G+++  R S GV ++W SP G + V Y +P+   + D++Q F F I +  
Sbjct: 720 GPGESVRGDNASLRASVGVSLIWASPFGPLRVDYAVPVAKEDFDEVQNFKFGINSSF 776


>gi|190891614|ref|YP_001978156.1| outer membrane lipoprotein [Rhizobium etli CIAT 652]
 gi|190696893|gb|ACE90978.1| outer membrane lipoprotein [Rhizobium etli CIAT 652]
          Length = 779

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 285/780 (36%), Positives = 455/780 (58%), Gaps = 7/780 (0%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   + L      +     +          +   +  ++++RI++RGA+ VG E + S 
Sbjct: 1   MKAGSKFLNAVSAVALSASVVASGAGALTFVSATAAEAAVIQRIDVRGASRVGAEAVRSN 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           + +  G+S S+ D+D++VK +Y  GYFS+VKI +    L+++L E +++N + F+GN  +
Sbjct: 61  LTITPGKSFSNTDIDNSVKQLYGTGYFSDVKISVSGGTLVVNLQEAQLVNQVVFNGNRKI 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KDD+L  IV++ +A  Y +  + +D+  IK+AYA+ G   V V  Q   +    +N+ +V
Sbjct: 121 KDDKLATIVQTHAAGPYSDTQIQSDIQAIKEAYAATGRSEVEVTTQVVPLGEGRVNLAFV 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY-FSFGKTDVYSKERMSFDEEAIRA 246
           I EG + KI+SI FVGN  YS  RL  VI+ + S +     + DVY+++++  DEEA+R 
Sbjct: 181 INEGDRTKIDSINFVGNNAYSAGRLAAVINTKRSNFLSFLTRKDVYNEDKLHADEEALRQ 240

Query: 247 FYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++RGYA +++ S      +  + Y L F I+EG+ Y  G +++QST++ +    LL L
Sbjct: 241 FYYNRGYADMRIVSSDASFDEATNKYTLTFNIEEGQRYDFGPVTVQSTVEGVGSDQLLPL 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           +R + G++Y+ +E+++S E IS    S   PF RV  R NRD     + +EYL+DQG   
Sbjct: 301 VRTKEGHVYSAKEVQKSIEAISDQVASAGYPFARVTPRGNRDLNNNTIGVEYLVDQGERA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RIEI GN ++ D VIRRE ++SEGD  N  MI +AKRR+ A GYFS VNIS  P + 
Sbjct: 361 YVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMITKAKRRLEALGYFSSVNISTQPGSS 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV 485
               V++     Q +      A       G+ +E  I++ NF G+G   R++AG G+   
Sbjct: 421 PDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLEASIEEKNFLGRGQYIRISAGGGQEGS 480

Query: 486 QNYTFSVEDPYFLGSP-ISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYD 544
           + Y  S  +PYFLG    +           + + D  + S  +R+  PITE ++T+F+Y+
Sbjct: 481 RAYGVSFTEPYFLGYRLAAGFDVNHSETSSNDNYDYEETSVVLRVTAPITEDLATTFRYN 540

Query: 545 LRFLQYGAISEK-EKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYD 603
            + ++Y A +     + + Y  L+E   ++  SISQ++ YNTLD+ ++PR+G+  +++ +
Sbjct: 541 YKQMKYDADNNDLSDLSAPYQHLVEDSPWTRSSISQTLTYNTLDDTVLPREGIYATATQE 600

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
            AG GGDSQ+++I  +A Y++LL+DD+DI+GS+    G V+   ++L +FDQF+++ N  
Sbjct: 601 IAGLGGDSQFYKIYGKARYYHLLADDADIIGSVSASAGYVVGFGEHLNVFDQFTLT-NGD 659

Query: 664 LRGFAYKGIGPRV--DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYAN 721
           +RGF  KGIGPRV       +GG  Y +ASA  +FPMP  P    LRGA F D+ TL+ N
Sbjct: 660 IRGFENKGIGPRVAGTNDDPLGGTTYFTASAEATFPMPGFPRDFNLRGAVFADAGTLFGN 719

Query: 722 HVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            V L  D +EG D+  R S GV ++W SP G + + Y IP+   + DK Q F F I N+ 
Sbjct: 720 DVDLRGDGIEGEDASLRASVGVGVVWQSPFGSLRLDYAIPVLKEDFDKTQNFKFGINNQF 779


>gi|26990088|ref|NP_745513.1| surface antigen family protein [Pseudomonas putida KT2440]
 gi|24985017|gb|AAN68977.1|AE016529_8 bacterial surface antigen family protein [Pseudomonas putida
           KT2440]
          Length = 787

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 165/775 (21%), Positives = 322/775 (41%), Gaps = 33/775 (4%)

Query: 38  SAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNV 97
           + +  ++   +  I + G   V    +   +P+ VG    D  L  + ++++  G+F ++
Sbjct: 15  ATLAQASPFRIADIRVNGLQRVSAGSVFGALPLNVGDQADDRRLVDSTRSLFKTGFFQDI 74

Query: 98  KIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVH 154
           ++    +VLII+++ER  ++ +   GN  +  + L   ++         +   T+    +
Sbjct: 75  QLSRDGNVLIINVVERPSVSSIEIEGNKAISTEDLMKGLKQSGLAEGEIFQRATLEGVRN 134

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
            +++ Y + G  +  V  +        + +   I EG  A I  I  VGN  +    L +
Sbjct: 135 ELQRQYVAQGRYSAEVDAEVVPQPRNRVALKIKINEGTVAAIQHINIVGNNVFDDETLGQ 194

Query: 215 VISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVL 273
           +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S  +       +V 
Sbjct: 195 LFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIASTQVSITPDKKHVY 254

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
           I                 S   ++ +  + SL+ ++ G +++ + +  +SE I++   + 
Sbjct: 255 ITVNINEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVMTTTSELITRRLGNE 314

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGD 393
              F  V      +     VDI +++D G   YV RI   GN ++ D V+RRE+   EG 
Sbjct: 315 GYTFANVNGVPQPNDQDHTVDIMFVVDPGKRAYVNRINYRGNTKTEDEVLRREMRQMEGG 374

Query: 394 PINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVD 453
             +  +I+++K R+   G+F EVN+         D V +  SV++ ++GS+  +  +   
Sbjct: 375 WASTYLIDQSKTRLERLGFFKEVNVETPQVPGTDDQVDVNYSVEEQASGSITASVGFAQS 434

Query: 454 KGMGVEGHIDDNNFFGQGYRAR-------LAAGFGRHAVQNYTFSVEDPYFLGSPISAGF 506
            G+ + G I  +NF G G +             +    V  Y  +           ++  
Sbjct: 435 AGLILGGSISQSNFLGTGNKVSIGLTRSEYQTKYNFGFVDPYFTADGVSLGYNLFYNSTD 494

Query: 507 DLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTL 566
                        IN   A V    PI E+   ++   L+       +       IY  +
Sbjct: 495 YSDYYDDGVSYYAINSYGAGVSFGYPINETSRLTYGLTLQHDDISPGTY--SADEIYDFI 552

Query: 567 IEHGK-FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYL 625
              GK F++   S     +TL+  ++  +G   S +      G D  ++++      F  
Sbjct: 553 SREGKSFNNLKASIGWSESTLNKGVLATRGHSQSLTLMATTPGSDLSFYKLDYNGQAFLP 612

Query: 626 LSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR---------- 675
           ++ ++ +      GYG    S   L  ++ ++      +RGF    +GPR          
Sbjct: 613 VTSNTTLRLHTNLGYGNGYGSTDGLPFYESYNAGGQGSVRGFKDGTLGPRSTPATGAYSN 672

Query: 676 -------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGAD 728
                        +GG I  +  A   FP+P V +++ LR + FVD+  +YA+   L   
Sbjct: 673 AGQAYYSDRDTDVLGGNILITGGAEYLFPLPFVKDQSQLRSSVFVDAGNVYADTCYLSTT 732

Query: 729 KLEG--NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +  G  + +   VS GV + W SP+G +      PL+  +  + Q F F +G   
Sbjct: 733 QGCGSVDLAQMAVSLGVGVTWYSPMGPLSFSLAAPLKKPDNAETQVFQFSLGQTF 787


>gi|330445153|ref|ZP_08308805.1| outer membrane assembly complex, YaeT protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489344|dbj|GAA03302.1| outer membrane assembly complex, YaeT protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 808

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 178/809 (22%), Positives = 312/809 (38%), Gaps = 51/809 (6%)

Query: 23  FQMGFIILFYAIFGLSAVYGS-NTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
             +  +++   +   S  + + +  +V  I   G   V     L ++PV VG +++  D+
Sbjct: 1   MAIKKLLVASLLLTSSVAHSAEDNFVVDNIRFEGLQRVTLGAALLKMPVRVGDTVNQQDI 60

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RS 138
              +K++YA G F ++K+    + L ID+ ER  I ++ F+GN  +K +QLK  +     
Sbjct: 61  SELIKSLYASGNFEDIKVYRDGNTLQIDVTERPTIANITFAGNKAIKAEQLKENLEASGL 120

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R   A D  T+      ++  Y S+G  N  V+     +     ++ +V  EGV AKI  
Sbjct: 121 RVGEALDRTTLRKIEKGLEDFYYSVGKYNATVEAVVTPLPRNRADVKFVFTEGVSAKIKQ 180

Query: 199 IRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  +GN  +S   L    +      +++F   + Y K+ +  D EA+R+ Y + GY   +
Sbjct: 181 INILGNHVFSDDELRSKFTLKDDVPWWNFMANEKYQKQVLQGDLEALRSQYLNNGYLKYR 240

Query: 258 -VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNP 316
              +QV     K G  +  +I EG  Y V N+  +  ++  +      L+  +  ++YN 
Sbjct: 241 LDETQVSISPDKKGVYITLKIHEGHQYKVKNVQFRGDVEG-RVAEFDKLVTFKPNSVYNG 299

Query: 317 QEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGND 376
            E+    E I +        + +V T    D     V +   ++QG  +YV+ IE  GN 
Sbjct: 300 AEVTSLEEAIKRKLGEAGYAYPQVTTYPEFDDKNNEVSLIVNVEQGKRIYVRNIEFRGNT 359

Query: 377 QSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSV 436
            + D V+RRE+   EG  +N   IE  K R+  TG+F  V++  +      D V ++ +V
Sbjct: 360 NTKDEVLRREMRQMEGTWLNAKAIETGKTRLNRTGFFENVDVQTVRVPGSDDQVDIKYNV 419

Query: 437 KQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSV 492
           K+ ++GSV     Y  + G+  +  +  +NF G G R  + A    ++            
Sbjct: 420 KEANSGSVNFGVGYGTESGISFQAGLTQDNFLGTGNRFGINAQTNDYSKNISLEYNDPYF 479

Query: 493 EDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA 552
                         + + +              ++    P  E    +F       +   
Sbjct: 480 TINNVSLGGRVYYNEFEASDANISDYTNQSYGTSLTWGFPYNELNYFNFSLGYDHNKISN 539

Query: 553 ISEKEKIPSIYTTLIEHGKF------SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
             +  +I                      S +     N L+    P  G     S+    
Sbjct: 540 TQDYYQIQQFKKIHGFDLDSDSAIELDDFSWTIGWTRNNLNRGYFPTSGNRQDFSFKMTI 599

Query: 607 FGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKN-----LQLFDQFSVS 659
            G DSQY +       +  L++  D  ++   R GYG       N     +  ++ F   
Sbjct: 600 PGSDSQYFKANYNVRQYIPLTEKQDYTLLLRGRLGYGNGYGKTDNGSDQLMPFYENFYAG 659

Query: 660 SNYYLRGFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLV 701
               +RGF    +GP+                       A GG   + AS  +  P PLV
Sbjct: 660 GFSTIRGFRSNTVGPKSVFVGGCGVNGQGNNNCATGTDDAAGGNAIALASMELIVPTPLV 719

Query: 702 PER--AGLRGAFFVDSATLYANHVALGADKLEGN-------DSFWRVSTGVEIMWNSPLG 752
            +     +R +FFVD+ +++            G            R S G  + W SP+G
Sbjct: 720 SDELKNQIRTSFFVDAGSVWDTEYNPSYKSSNGQKLEDYSKPDMIRASYGAALQWMSPMG 779

Query: 753 MMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            +      P++  EGD  + F F IG   
Sbjct: 780 PLVFSIAKPIKKYEGDDEEFFTFTIGQTF 808


>gi|330957644|gb|EGH57904.1| OMP85 family outer membrane protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 790

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 166/790 (21%), Positives = 313/790 (39%), Gaps = 31/790 (3%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
                +++   +     +  + T  +  I + G   V    + + +P+ VG    +  L 
Sbjct: 1   MIYSRLLVSLCLLFSVPLVHAETFAISDIRVNGLQRVSAGSVFAALPLNVGDQADEQRLA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
            + ++++  G+F ++ +    +VL+I ++ER  I  +   GN  +  + L   ++     
Sbjct: 61  DSARSLFKTGFFQDIDVARDGNVLVITVVERPSIASIEIEGNKAISTEDLMKGLKQSGLS 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
               +   T+    + +++ Y S G  +  V  Q        + +  +I+EG  A I  I
Sbjct: 121 EGEIFQRATLEGVRNELQRQYVSQGRYSASVDAQAVPAPRNRIALKIIIDEGTVASIQHI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +S   L     ++TS + SF K D  Y++E++S D E +R++Y DRGY  + +
Sbjct: 181 NVVGNTVFSDEELADQFQLKTSNWLSFFKNDDKYAREKLSGDLERLRSWYLDRGYINMDI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
           +S  +        V I                     ++ +  L  LI ++ G +++ + 
Sbjct: 241 NSTQVSLTPDKKSVFITVNITEGARYTVGSVKLGGDLKVPQDQLEQLILVKPGQVFSRKV 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + +++  I++   +    F  V      D A   VDI +++D G   Y  RI   GN ++
Sbjct: 301 MTDTTNLITRRLGNDGYTFANVNGVPKPDEADHTVDISFVVDPGKRAYANRINFRGNTKT 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG   +  +I+++K R+   G+F EVN+         D V +  +V++
Sbjct: 361 ADEVLRREMRQMEGGWASTYLIDQSKVRLERLGFFKEVNVETPAVPGTDDQVDVNYAVEE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGY-------RARLAAGFGRHAVQNYTFS 491
            ++G++  +  +    G+ + G I  NN  G G        R+     +       Y   
Sbjct: 421 QASGNITASVGFSQSAGLILGGSISQNNILGTGNFASLGMTRSEYQTKYNFAFTNPYFTP 480

Query: 492 VEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG 551
                      +A    +    +D     +  S    + +    S ++   Y L      
Sbjct: 481 DGVSLGYNVFYNATDYSKYYDDDDEVSYYSLNSVGAGVNLGYPISETSRLTYGLSIQHDT 540

Query: 552 AISEKEKIPSIYTTLIEHGK-FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
                     IY  +   G  F++   S     +TL+  ++  +G   + +      G D
Sbjct: 541 LDPGSYSADEIYDFIQREGDAFTNLKASVGWSESTLNKGVLATRGHSQNLTLTTTVPGSD 600

Query: 611 SQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYK 670
            Q+++I      F  LS  + +    + GYG        L  ++ +S      +RGF   
Sbjct: 601 LQFYKIDYSGQTFVPLSSATSLRLHTKLGYGNGYGDTDGLPFYENYSAGGQSSVRGFKDG 660

Query: 671 GIGPR-----------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFV 713
            +GPR                      A+GG I  +      FPMP V ++  LR + F 
Sbjct: 661 TLGPRNTPATGTYASQGQIYYSDRDTEALGGNILITGGMEYLFPMPFVKDQKSLRTSLFW 720

Query: 714 DSATLYANHV--ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQ 771
           D  T+YA+    +   +  E N      S GV + W S LG +     +P++  E  + Q
Sbjct: 721 DFGTVYADKCYLSTTQNCGELNIDQMASSVGVGVTWYSALGPLSFNLAVPIKKPEDAETQ 780

Query: 772 QFGFRIGNRM 781
            F F +G   
Sbjct: 781 VFQFSLGQTF 790


>gi|89092096|ref|ZP_01165051.1| probable outer membrane protein [Oceanospirillum sp. MED92]
 gi|89083831|gb|EAR63048.1| probable outer membrane protein [Oceanospirillum sp. MED92]
          Length = 772

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 157/768 (20%), Positives = 310/768 (40%), Gaps = 16/768 (2%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           ++L   I+   A   +++  ++ I + G   V   ++    P+  G  +S A L  A + 
Sbjct: 7   LLLALVIWSSVAQANNSSFEIQDIRLEGLQRVSPGLVFRNFPITAGDQVSSAALAKATRK 66

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAY 144
           ++  GYF +VK+   + VL++ L+ER  ++ +   GN+ ++ + L   ++    +    +
Sbjct: 67  LFKTGYFDDVKLSRDNGVLVLKLLERPSVSLIRIEGNDVIETEMLLEGLKQGGLQEGDVF 126

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
              T+ +   ++ + YAS G     V     ++    + +   + EG  A I  I  VGN
Sbjct: 127 KRATLESIKQDLVRVYASQGRYGASVTTDVETLPGNRVALNIDVAEGQIATIQHINIVGN 186

Query: 205 KNYSHARLERVISIRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL 263
             Y+   L+ + S++   ++  + K D Y+++++S D E +R++Y D GYA   + S  +
Sbjct: 187 TVYTDEELKELFSLKLPHFWSFYKKDDRYARQKLSGDLEKLRSYYLDSGYANFSIDSTQV 246

Query: 264 FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESS 323
                   + I                 +    + +  L+  +R+  G  ++ + I ES 
Sbjct: 247 SITPDKKNIFITVNVTEGEKHTIRAVDIAGEMVVPENQLMETVRVEEGQTFSRKLIVESQ 306

Query: 324 EKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVI 383
           + ++    +    F  +            V +++ +D G   YV+RI I GN ++ D VI
Sbjct: 307 DALATTIGNAGYMFANISPVPEVHDDN-TVTVKFFLDPGKRTYVRRINISGNTRTADDVI 365

Query: 384 RRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS 443
           R+ L+  E    +  MIE++K R+  TGYF  VN+         D V +   V++  +GS
Sbjct: 366 RQHLKQMESAVASNEMIEQSKVRLEKTGYFKSVNVETTSVPGSDDLVDVSYVVEEQQSGS 425

Query: 444 VGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG----FGRHAVQNYTFSVEDPYFLG 499
              +  +  + G+ +  ++  +NF G G +  +          ++               
Sbjct: 426 FSASLGFSQNSGIILGFNLQQDNFLGTGKKVGVGISNSDTLTEYSYSYVDPYYTVDGVSR 485

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKI 559
                  +         +   ++    V    PI +    +F  +L  +     + +   
Sbjct: 486 GFSLYYRERDFDEDNTSAFSTDEIGGGVNFGYPIDDYQRLNFGLNLEQVSINTNATETPA 545

Query: 560 PSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSR 619
                   E   + +  +  +   N L+    P KG   ++S +    G D  Y++    
Sbjct: 546 EINQYIADEGNDYFNMILRSTWTDNHLNRGFFPTKGYSHTASLELGLPGSDLSYYKASFN 605

Query: 620 ASYFYLL--SDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVD 677
             Y+  L  + +  +    RFGYG  +  N+    +  F       +RGF    +GPR  
Sbjct: 606 TKYYRPLDDNRNWVLSLRGRFGYGGELGGNE-YPFYKHFFAGGLKTVRGFEQNSLGPRDS 664

Query: 678 KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAL----GADKLEGN 733
           K    GG +  +  A   FP P V +++G R   FVD+  ++    +     G  +    
Sbjct: 665 KNDPFGGDVLITGGAEFIFPTPFVKDQSGWRTLLFVDAGNVFDTQCSSASIAGNCEEGIK 724

Query: 734 DSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
               R S G  + W +P+G +      PL  + GD+ + F F +G   
Sbjct: 725 LDELRYSAGFGLSWLTPIGPLSFAIAAPLNDKSGDETEVFQFALGQTF 772


>gi|330810545|ref|YP_004355007.1| Surface antigen protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378653|gb|AEA70003.1| Surface antigen protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 788

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 166/790 (21%), Positives = 318/790 (40%), Gaps = 33/790 (4%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
                ++   A+     +  +    +  I I G   V    +   +P+ VG +  +  L 
Sbjct: 1   MNFSRLLCSAALLLNVTLAHAQGFKISDIRINGLQRVSAGSVFGALPLNVGDNADERRLV 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
            + + ++  G+F ++++     VL+I ++ER  I  +   GN  +  + L   ++     
Sbjct: 61  ESTRALFKTGFFQDIQLGHDGDVLVITVVERPSIASIEIEGNKAISTEDLMKGLKQSGLA 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
               +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I
Sbjct: 121 EGEIFQRATLEGVRNELQRQYVAQGRYSATVDTEVVPQPRNRVGLKVNINEGTVAAIQHI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGN  +    L  +  ++T+ + SF K D  Y++E++S D E +R++Y DRGY  + +
Sbjct: 181 NVVGNTVFPDEDLIDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
           +S  +       +V I                 S   ++ +  + SL+ ++ G +++ + 
Sbjct: 241 ASTQVSITPDKKHVYITVNVNEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQKGQVFSRKL 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  +SE I++   +    F  V            VDI + +D G   YV RI   GN +S
Sbjct: 301 MTTTSELITRRLGNEGYTFANVNGVPQPHDEDHTVDITFAVDPGKRAYVNRINFRGNTKS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG   +  +I+++K R+   G+F EVN+       V D + +  SV++
Sbjct: 361 EDEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPAVPGVDDQIDVNYSVEE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGY-------RARLAAGFGRHAVQNYTFS 491
            ++GS+  +  +    G+ + G I  NNF G G        R+   + +       Y   
Sbjct: 421 QASGSISASVGFSQSAGLILGGSITQNNFLGTGNYASLGLTRSSYQSKYNIGFTDPYFTP 480

Query: 492 VEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG 551
                   +  +A    +    ++    IN   A   +  PI E+   +F   ++     
Sbjct: 481 DGVSLGYNAFYNATDYNEYYDDDNSYYSINSYGAGTSLGYPINETSRLNFGVTVQHDSIE 540

Query: 552 AISEKEKIPSIYTTLIEHGK-FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGD 610
             +       IY  +   GK F++   +     +TL+  ++  +G   S +      G D
Sbjct: 541 PGTY--SADEIYDFIEREGKDFTNFKANLGWSESTLNKGVLATRGHSQSLNLMATVPGSD 598

Query: 611 SQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYK 670
             +++I      F  +SD + +    + GYG    S   L  ++ ++      +RGF   
Sbjct: 599 LSFYKIDYTGQTFLPVSDATSLRLHTKLGYGNSYGSTDGLPFYENYTAGGEGSVRGFESG 658

Query: 671 GIGPR-----------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFV 713
            +GPR                      ++GG I  +      FP+P + +   LR + F 
Sbjct: 659 TLGPRNTPATGTYASAGQAYYSDRDTESLGGNILITGGVEYLFPLPFIKDNKSLRTSVFW 718

Query: 714 DSATLYANHVALGADKLEG--NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQ 771
           D  ++Y++   L   +     + S    S GV + W SPLG +      P+R  +    Q
Sbjct: 719 DVGSVYSDKCYLSTTQGCDGVDLSQMASSVGVGVTWYSPLGPLSANVAFPVRTPDNADTQ 778

Query: 772 QFGFRIGNRM 781
            F F +G   
Sbjct: 779 VFQFSLGQTF 788


>gi|323497984|ref|ZP_08102993.1| outer membrane protein assembly factor YaeT [Vibrio sinaloensis DSM
           21326]
 gi|323317029|gb|EGA70031.1| outer membrane protein assembly factor YaeT [Vibrio sinaloensis DSM
           21326]
          Length = 803

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 173/803 (21%), Positives = 316/803 (39%), Gaps = 44/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+L   +    +  G+   +V+ I++ G   V     L ++PV +G SI + D+ 
Sbjct: 1   MAMKKILLATLLATSVSANGAEDFVVQDIQVEGLQRVTLGAALLKMPVRIGDSIDNQDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ +YA G F ++K+   D+VL++ + ER  I+ + FSGN  +K++QL+  +     R
Sbjct: 61  QIIRALYASGNFEDIKVLRQDNVLVVQVKERPTISSVSFSGNKAIKEEQLQQNLEASGIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+      ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLANIEKGLEDFYYSVGKYNANVKAVVTPLPRNRADLKFVFSEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ +S   L     +     +      D Y K+ ++ D EA++++Y DRGY   KV
Sbjct: 181 NFIGNEVFSDDDLLSRFELNVDVAWWNFLSDDKYQKQVLAGDIEALKSYYLDRGYLKFKV 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        V I    +                   ++ L  L+    G LYN   
Sbjct: 241 DSTQVSISPDKKGVYITLGLDEGEPYTVKDVKFRGDLVPSEQELEKLVSFEMGELYNGSA 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E + +        + +V+T    D   + V +   I+ G  +YV+ I   GN+ +
Sbjct: 301 VTSLEESVKRQLGEAGYAYPQVRTISEFDDETKEVSLVVNIEAGKRIYVRDIRFVGNNST 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +N   I+  K R+   G+F  V++  +      D V L  SVK+
Sbjct: 361 KDEVLRREMRQMEGSWLNSKAIDTGKSRLNRLGFFETVDVQTVRVPGSEDQVDLVYSVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVEDP 495
            ++GSV     Y  + G+  +  +  +NF G G R  ++A    + ++   +Y     + 
Sbjct: 421 ANSGSVNFGIGYGTESGVSFQVGLQQDNFLGSGNRVGISAMMNDYQKNVSLDYRDPYWNL 480

Query: 496 YFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITES-ISTSFKYDLRFLQYGAIS 554
             +       ++  +          N+            +      F       + G + 
Sbjct: 481 DGVSLGGKIFYNQFEASEAGIVDYTNESYGTSLTWGFPFDELNRFEFGVGYTHNKIGNVP 540

Query: 555 EKEKIPSIYTTLIEHGK---FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDS 611
             ++      ++ +       +   ++ S   N L+    P  G    +         D+
Sbjct: 541 TYDQAQLFAQSIDQADGDIVTNDFDLNASWTRNNLNRGYFPTAGNYQRAFAKATVPSSDA 600

Query: 612 QYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIP---SNKNL-QLFDQFSVSSNYYLR 665
           QY ++      +  L+   +       R GYG        N NL   ++ +       LR
Sbjct: 601 QYFKVQYDVRQYIPLTKKHEFTLLMRGRLGYGNGYGQTDGNDNLFPFYENYYAGGFTTLR 660

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
           GF     GP+                       ++GG   + AS  +  P P   +   +
Sbjct: 661 GFRSNTAGPKAVYTVNSNPSICSGSSCVNATDDSVGGNAVALASLELIVPTPFASDEVRS 720

Query: 706 GLRGAFFVDSATLYANHVALGADKLE-------GNDSFWRVSTGVEIMWNSPLGMMGVYY 758
            +R + F+D+A+++       +   +        + + +R S GV + W SP+G +    
Sbjct: 721 QIRTSMFLDAASVWDTEFDYDSAYADQRYYMDYSDPTNYRASYGVALQWMSPMGPLVFSV 780

Query: 759 GIPLRHREGDKIQQFGFRIGNRM 781
             P+   EGD  + F F IG   
Sbjct: 781 AKPIEIYEGDDEEFFTFTIGRTF 803


>gi|121604668|ref|YP_981997.1| surface antigen (D15) [Polaromonas naphthalenivorans CJ2]
 gi|120593637|gb|ABM37076.1| surface antigen (D15) [Polaromonas naphthalenivorans CJ2]
          Length = 766

 Score =  387 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 174/777 (22%), Positives = 312/777 (40%), Gaps = 21/777 (2%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           ++K F +        +   +F  +A +  +   VR I + G   V    I + +P  VG+
Sbjct: 1   MQKQFNQFKVRAVCAIAAGLFFANAAWAVDPFTVRDIRVEGLQRVEPGTIFASLPFRVGE 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
           + SD     A++ ++ +G F +V++++   VL++ + ER  +  + F G      D LK 
Sbjct: 61  TYSDDKGTSAIRALFGLGLFKDVRLEVSGDVLVVIVEERPTVADVDFVGTKEFDKDVLKK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +          +D+   +     +K+ Y +     V +      I    +N+T+ + EG
Sbjct: 121 ALRDAGIADGQPFDKALADKAEQELKRQYINKSLYGVEIITTVTPIERNRVNLTFSVVEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHD 250
             AKIN I   GNK +S + L  +           + K+D YS+ +++ D E +R++Y  
Sbjct: 181 DVAKINEIHITGNKAFSESTLLGLFDLDTGGWLSWYTKSDRYSRTKLNADIETLRSYYLS 240

Query: 251 RGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRS 310
           RGY   KV +  +        + I          V +          ++    SL+ I+ 
Sbjct: 241 RGYLEFKVDTTQVAISPDKQNIAITLNVTEGERFVVSGVKLEGNYLGKEDEFKSLVTIKP 300

Query: 311 GNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           G  YN   + E+++  + YF      F +V+     D +   V      +     YV+RI
Sbjct: 301 GEPYNADAVAETTKAFTDYFGVFGFAFAKVEAVPQIDRSNNRVAFVLQAEPSRRAYVRRI 360

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            + GN+++ D V+RRE    E    +   I  ++ R+   G+F+EVN+        SD V
Sbjct: 361 NVSGNNRTRDEVVRREFRQFESSWYDGDKIRLSRDRVDRLGFFTEVNVETQEVTGTSDQV 420

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ---- 486
            + V+V +   G++ +   Y     + +   I   N FG G    +     +   Q    
Sbjct: 421 DITVNVAEKPTGNLQLGAGYSSADSVSLMFGIKQENVFGSGNYLGIEVNTSKSNRQLVLS 480

Query: 487 NYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLR 546
                        S        Q    + G   +    A++R  VP TE+ +  F     
Sbjct: 481 TIDPYFTADGISRSIDVYDRTSQPLSGQGGDYKLKTRGASIRFGVPFTETDTVYFGSGYE 540

Query: 547 FLQYGAISEKEKIPSIYTTLIEHGKFSSHSI--SQSIIYNTLDNPIVPRKGMLISSSYDY 604
            L    I     +P  Y        F S+SI  +     ++ D+ +VP  G      Y  
Sbjct: 541 SL---TIVPGTNLPVSYLDYANQFGFKSNSIPLTVGWSRDSRDSALVPTSGRYQKV-YAD 596

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
            G  GD ++ R   +   +  ++    +  +   G+G  + + +   LF  +       +
Sbjct: 597 WGIAGDIKFVRANYQIQQYIPINKQFTLALNGELGWGKGL-NGQPYPLFKNYYSGGLGSV 655

Query: 665 RGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVA 724
           RGF    +GPR     ++G     + +A +  P P       LR   FVD+  ++ +   
Sbjct: 656 RGFQQGSLGPRDSSDLSVGAPKKLTLNAELIAPFPGAGNDRTLRMYGFVDAGNVFKDSYK 715

Query: 725 LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           L            R STG+ I W SP+G + + Y +PLR + GDKI++  F+IG   
Sbjct: 716 LSG------PDGLRASTGLGISWISPVGPLRIAYAVPLRKQAGDKIERLQFQIGTSF 766


>gi|290473665|ref|YP_003466537.1| putative outer membrane antigen [Xenorhabdus bovienii SS-2004]
 gi|289172970|emb|CBJ79741.1| putative outer membrane antigen [Xenorhabdus bovienii SS-2004]
          Length = 811

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 183/791 (23%), Positives = 319/791 (40%), Gaps = 34/791 (4%)

Query: 22  SFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
           +  M  +++   +FG +  Y S+  +VR I   G   V     L  +PV VG +ISD D+
Sbjct: 18  TMAMKKLLIASLLFGSATAYSSDGFVVRDIHFEGLQRVTSGAALLNMPVRVGDTISDEDI 77

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS--- 138
              +  ++A G F +V++    + L++ + ER  I  + FSGN ++KDD LK  + S   
Sbjct: 78  SRTIHTLFATGNFEDVRVLRDGNTLVVQVKERPTIASITFSGNKSVKDDMLKKNLESSRV 137

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
               A D   ++     ++  Y S+G  N  VK     +    +++  +  EG+ A+I  
Sbjct: 138 SVGEALDRTMLSNMEKGLEDFYYSVGKYNATVKAVVTPLPRNRIDLKLIFSEGISAQIQQ 197

Query: 199 IRFVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  VGNK +S   L     +R    +     D  Y K++++ D E +R+FY DRGYA   
Sbjct: 198 INIVGNKAFSTNELLNRFQLRDDIPWWNFMADQKYQKQKLAGDLETLRSFYLDRGYARFN 257

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           + S  +        + I                 +      +     L  I+ G+LYN  
Sbjct: 258 IDSTQVNLTPDKKGIYITVNINEGAQYKIASVDLNGNLAGYQSEATKLTNIQPGSLYNGT 317

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           E+    + I          + RV T+   +   + V +   +D G+  YV++I  EGND 
Sbjct: 318 EVTSMEKAIKNLLGRYGYAYPRVITQPEINDTDKTVKLHVNVDAGNRFYVRKIRFEGNDI 377

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           S DSV+RRE+   EG  +    +E+ K R+   G+F  VN+     +   D V +   VK
Sbjct: 378 SRDSVLRREMRQMEGAWLGSDRVEQGKERLDRLGFFETVNVDTERVSGSPDLVDVVYKVK 437

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAV----QNYTFSVE 493
           + + GS+     +  + GM  +  +   N+ G G    ++A    ++             
Sbjct: 438 ERNTGSMNFGVGFGTESGMSFQVGLQQENWLGTGNSVGISASKNDYSTSADLSFTDPYFT 497

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
                        D +    E              +  P+ E+   + +          +
Sbjct: 498 VDGVSLGGRVYYNDFRADDAELSGYTNKAYGTEGILGFPLNENNRLAMRLGYAHNSLSNM 557

Query: 554 SEKEKIPSIYTTL--------IEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
             +  +      +              +   ++ S IY   D    P  G   S     A
Sbjct: 558 RPQAAMWRYLKKMGKEPPLKGKASFDSNDFPLTFSWIYGNFDRGFFPTSGFKSSVDAKVA 617

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGY-GCVIPSNKNLQLFDQFSVSSNYYL 664
             G D+QY+++   A+ +Y + D +  +   R           K +  ++ F    +  +
Sbjct: 618 LPGSDNQYYKLTWSATGYYPIDDKNSWIMMGRTRMGYGGGLGGKEMPFYENFYAGGSNSV 677

Query: 665 RGFAYKGIGPRV-------------DKKYAIGGKIYSSASAAVSFPMPLVPERA--GLRG 709
           RGF    IGP+                + A+GG   ++AS  +  P P +  +    +R 
Sbjct: 678 RGFRSNNIGPKAIYLGENKEPEKNSPSRDAVGGNALATASFELITPTPFLDAKYANTVRT 737

Query: 710 AFFVDSATLYANHVALGADKLEG--NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREG 767
           +FFVD+ T++  +    +  L      +  RVS G+ + W SPLG +   YG P++  EG
Sbjct: 738 SFFVDAGTVWDTNWNNISPGLPDYSKPNNIRVSAGIALQWLSPLGPLTFSYGKPIKEYEG 797

Query: 768 DKIQQFGFRIG 778
           D+ +QF F IG
Sbjct: 798 DRAEQFQFNIG 808


>gi|330959206|gb|EGH59466.1| outer membrane protein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 795

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 173/796 (21%), Positives = 329/796 (41%), Gaps = 40/796 (5%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSATVDAEVVPQPRNRVGLKIDINEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNVNEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            +  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GRYTVDEIFDFVDKEGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D   +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDSYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
           PR                          GG         V FP+P V ++  LR + F D
Sbjct: 660 PRSTPSRGAAVTGNQGTSADPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRSLRTSVFWD 719

Query: 715 SATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
              ++            G        + S    S G+ + W + LG +     +P++  +
Sbjct: 720 VGNVFDTKCDSSRTTGNGKKVECNDIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPD 779

Query: 767 GD-KIQQFGFRIGNRM 781
            + + Q F F +G   
Sbjct: 780 DEAETQVFQFSLGQTF 795


>gi|288958459|ref|YP_003448800.1| outer membrane protein [Azospirillum sp. B510]
 gi|288910767|dbj|BAI72256.1| outer membrane protein [Azospirillum sp. B510]
          Length = 777

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 207/738 (28%), Positives = 348/738 (47%), Gaps = 12/738 (1%)

Query: 47  IVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVL 106
            VR I + G   +    + S + V  G       +D ++K ++  G F++V +K     L
Sbjct: 49  TVRDIRVEGTQRIEPSTVRSYLTVQPGDPFDPDRIDQSLKALFNTGLFADVVLKREGETL 108

Query: 107 IIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYL 166
           ++ + E  IIN + F GN  +  D L   ++ R    Y    V +DV  I++ Y   G  
Sbjct: 109 VVTVAENPIINRIAFEGNRRIDKDTLDKEIQLRPRVVYTRTRVQSDVQRIQEIYRRQGRF 168

Query: 167 NVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTS-GYFS 225
              V+ +   +    +++ + I EGV+  +  I F+GN+++S   L   +  + S  +  
Sbjct: 169 GATVEPKIIQLDQNRVDLVFEINEGVRTGVRGITFIGNEHFSDGTLRENVQTKESAWWRF 228

Query: 226 FGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQV-LFDKQKSGYVLIFQIDEGEIYT 284
               D Y  +R+++D + +R FY   GYA  +V S V      KS + + F I+EGE Y 
Sbjct: 229 LSSDDNYDPDRLNYDRDLLRRFYLREGYADFRVVSAVAELTPDKSDFFITFTIEEGERYK 288

Query: 285 VGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRI 344
            G + I++TL+++    L + +    G+ YN Q+++++  K++      +  FV V+ RI
Sbjct: 289 FGKVDIKTTLKQLDPTVLQNSVITTEGDWYNAQKVEDTITKLTNAVGDLQYAFVDVRPRI 348

Query: 345 NRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAK 404
           +R+     +DI Y I++G   +V RI+I GN ++ D VIRRE+ LSEGDP N S ++R++
Sbjct: 349 SRNRETHTIDITYEINEGPRTFVDRIDISGNVRTLDKVIRREMLLSEGDPFNSSKLKRSE 408

Query: 405 RRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDD 464
           +RI   G+F  VN++   +    D  ++ V V + S G + I   +    G   +  I +
Sbjct: 409 QRIKDLGFFERVNVTTAES-SAPDRTVVNVDVAEQSTGEISIGAGFSTSDGPLGDFSIRE 467

Query: 465 NNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDES 524
            N  G+G   RL A       Q Y  S  +PYF+   +SAG D+ +T     +    +E 
Sbjct: 468 RNLLGRGQDLRLGATLS-SKRQLYDISFTEPYFMDRDLSAGVDIFRTRYNYQNESSFNEK 526

Query: 525 AAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYN 584
                 + +   ++   +  + +     + E+    +      + G+  +  I Q + Y+
Sbjct: 527 -NTGFALRLGYPLTEQLRQRVYYQLQDTLIEEVPSNASRYIREQRGERLTSLIGQELTYD 585

Query: 585 TLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVI 644
             ++ + P +G  I  + D AG GG  ++ R      Y+  L +D   V S     G + 
Sbjct: 586 VRNSKLTPTEGYFIRLTNDVAGLGGSVRFLRNKLAGGYYIPLGEDQ-WVLSTTGEIGYIY 644

Query: 645 PSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV-DKKYAIGGKIYSSASAAVSFPMPLVPE 703
              K + L D+F +  +  LRGF   GIGPR      A+GG  Y+ AS  +SFP  L PE
Sbjct: 645 GMGKKVDLGDRFFIGGD-TLRGFKTAGIGPRDISTGDALGGTRYARASVEMSFPFGL-PE 702

Query: 704 RAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
             GL G  F D  TL    ++   D    +D   RVS G  + W SP G + +   +P+R
Sbjct: 703 EFGLLGHAFTDVGTLGKVDIS---DPNVKDDESIRVSVGTGVSWKSPFGPIRLDVALPIR 759

Query: 764 HREGDKIQQFGFRIGNRM 781
               DK +   F  G R 
Sbjct: 760 KEGYDKKELIRFSFGTRF 777


>gi|261364378|ref|ZP_05977261.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           mucosa ATCC 25996]
 gi|288567648|gb|EFC89208.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           mucosa ATCC 25996]
          Length = 799

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 185/800 (23%), Positives = 349/800 (43%), Gaps = 42/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG   SDA  +
Sbjct: 1   MKLKQIASALMVLGMSPLAFAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDQFSDARSE 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++ + + +++ +IER  I+ L  +G   L++D +K  +      
Sbjct: 60  EIIKSLYATGFFDDVRVETMGNQVLLTVIERPTISTLNITGAKMLQNDVIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  ++  T++  V ++K+ Y S G  +V +      ++   ++I   I+EG   KI  I
Sbjct: 120 QSQYFNPATLSQSVASLKEEYKSRGKQSVQITPTVTKLARNRVSIDIAIDEGKTTKITDI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GNK YS  +L + +S      +    K++ +++++ S D E +  FY + GY   ++
Sbjct: 180 EFEGNKVYSDRKLMKQMSLSEGGMWTWLTKSNQFNEQKFSQDMERVSEFYQNNGYFNFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+  ++   +DEGE +  G++ I+   +E+ K+ L  L+ ++ G  Y   
Sbjct: 240 LDTDIQTNEDKTKQIIKITVDEGERFRWGDVRIEGDTREVPKEELQKLLTMKKGKWYERA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +S E I     +    F  V  +   +   + VD    ++ G  +YV  I I GN++
Sbjct: 300 QMVKSLEAIQNRMGTAGYAFSEVNVQPIPNAETQTVDFVLNVEPGRKIYVNEINITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P  +  D V L +SV 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPVANTPDQVDLNMSVN 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G    L A       +   ++T     
Sbjct: 420 ERSTGSLDMSAGWVQDTGLVMSVGVSQDNLFGTGKSVSLRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDG---SLDINDESAAVRMIVPITESISTSFKYDLRFLQYG 551
           P  +                             A VRM +P+TE    +       L   
Sbjct: 480 PDGVSLGYDIYGKSYDPRKASSSAKQYKTTTAGAGVRMGIPVTEYDRVNLGLAAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
                 K  + +      G     S        +     N  D+ + P +G +   + + 
Sbjct: 540 TYKGAPKRYADFINQYGKGTDGVGSFKGWLYKGTIGWGRNKTDSALWPTRGYMTGINGEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G D QY+ +    ++F+ L+ D  ++     G G      K +  F+ F       +
Sbjct: 600 ALPGSDLQYYTLTHNQTWFFPLTKDFTLMLGGEVGVGNGYGKTKTMPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP + +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDSRSVRLSLFADAGSVWD 719

Query: 721 -------------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
                              N   LG           R S G  + W SPLG M   Y  P
Sbjct: 720 GKTYNDSSSNTYYTNNAAQNPYGLGKTHKSTFKEELRYSAGAAVTWLSPLGPMKFSYAYP 779

Query: 762 LRHREGDKIQQFGFRIGNRM 781
           L+ ++ D+IQ+F F++G   
Sbjct: 780 LKKKDSDEIQRFQFQLGTTF 799


>gi|255067005|ref|ZP_05318860.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           sicca ATCC 29256]
 gi|255048830|gb|EET44294.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           sicca ATCC 29256]
          Length = 799

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 184/800 (23%), Positives = 348/800 (43%), Gaps = 42/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG   SDA  +
Sbjct: 1   MKLKQIASALMVLGMSPLAFAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDQFSDARSE 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++ + + +++ +IER  I+ L  +G   L++D +K  +      
Sbjct: 60  EIIKSLYATGFFDDVRVETMGNQVLLTVIERPTISTLNITGAKMLQNDVIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  ++  T++  V ++K+ Y S G  +V +      ++   ++I   I+EG   KI  I
Sbjct: 120 QSQYFNPATLSQSVASLKEEYKSRGKQSVQITPTVTKLARNRVSIDIAIDEGKTTKITDI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GNK YS  +L + +S      +    K++ +++++ S D E +  FY + GY   ++
Sbjct: 180 EFEGNKVYSDRKLMKQMSLSEGGMWTWLTKSNQFNEQKFSQDMERVSEFYQNNGYFNFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   +DEGE +  G++ I+   +E+ K+ L  L+ ++ G  Y   
Sbjct: 240 LDTDIQTNEDKTKQTIKITVDEGERFRWGDVRIEGDTREVPKEELQKLLTMKKGKWYERA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +S E I     +    F  V  +   +   + VD    ++ G  +YV  I I GN++
Sbjct: 300 QMVKSLEAIQNRMGTAGYAFSEVNVQPVPNAETQTVDFVLNVEPGRKIYVNEINITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P  +  D V L +SV 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPVANTPDQVDLNMSVN 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G    L A       +   ++T     
Sbjct: 420 ERSTGSLDMSAGWVQDTGLVMSVGVSQDNLFGTGKSVSLRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDG---SLDINDESAAVRMIVPITESISTSFKYDLRFLQYG 551
           P  +                             A VRM +P+TE    +       L   
Sbjct: 480 PDGVSLGYDIYGKSYDPRKASSSAKQYKTTTAGAGVRMGIPVTEYDRVNLGLAAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
                 K  + +      G     S        +     N  D+ + P +G +   + + 
Sbjct: 540 TYKGAPKRYADFINQYGKGTDGVGSFKGWLYKGTIGWGRNKTDSALWPTRGYMTGINGEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G D QY+ +    ++F+ L+ D  ++     G G      K +  F+ F       +
Sbjct: 600 ALPGSDLQYYTLTHNQTWFFPLTKDFTLMLGGEVGVGNGYGKTKTMPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP + +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDSRSVRLSLFADAGSVWD 719

Query: 721 -------------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
                              N   LG           R S G  + W SPLG M   Y  P
Sbjct: 720 GKTYNDSSSNTYYTNNAAQNPYGLGKTHKSTFKEELRYSAGAAVTWLSPLGPMKFSYAYP 779

Query: 762 LRHREGDKIQQFGFRIGNRM 781
           ++ ++ D+IQ+F F++G   
Sbjct: 780 IKKKDSDEIQRFQFQLGTTF 799


>gi|89075412|ref|ZP_01161829.1| putative surface antigen [Photobacterium sp. SKA34]
 gi|89048828|gb|EAR54398.1| putative surface antigen [Photobacterium sp. SKA34]
          Length = 801

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 171/802 (21%), Positives = 313/802 (39%), Gaps = 44/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNT-SIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
             +  +++   +   S  + +    +V  I   G   V     L ++PV VG ++   D+
Sbjct: 1   MAIKKLLVASLLLTSSVAHSAEDKFVVDNIRFEGLQRVTLGAALLKMPVRVGDTVDQQDI 60

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RS 138
              +K++Y+ G F N+++    + L ID+ ER  I  + F+GN  +K +QLK  +     
Sbjct: 61  SELIKSLYSSGNFENIRVYRDGNTLQIDVTERPTIADITFAGNKAIKAEQLKENLDASGL 120

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
           R   A D  T+      ++  Y S+G  N  V+     +     +I +V  EGV AKI  
Sbjct: 121 RVGEALDRTTLRKIEKGLEDFYYSVGKYNATVEAVVTPLPRNRADIKFVFTEGVSAKIKQ 180

Query: 199 IRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I  +GN  +S   L    +      +++F   + Y K+ +  D EA+R+ Y + GY   +
Sbjct: 181 INILGNHVFSDDELRSKFTLKDDVPWWNFMANEKYQKQVLQGDLEALRSQYLNNGYLKYR 240

Query: 258 -VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNP 316
              +QV     K G  +  +I EG  Y V N+  +  +   +      L+  ++G++YN 
Sbjct: 241 LDDTQVSISPDKKGVYITLKIHEGHQYKVKNVQFRGDVSG-RAAEFDKLVTFKTGSVYNG 299

Query: 317 QEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGND 376
             +    E +          + +V T    D     V +   ++QG  +YV+ IE  GN 
Sbjct: 300 AAVTSLEEAVKSKLGEAGYAYPKVTTYPEFDDKTNEVSLVVNVEQGKRMYVRNIEFRGNT 359

Query: 377 QSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSV 436
            + D V+RRE+   EG  +N   I+  K+R+  TG+F  V++  +      D V ++ +V
Sbjct: 360 NTKDEVLRREMRQMEGTWLNAKKIDTGKKRLNRTGFFENVDVQTVRVPGSDDQVDIKYNV 419

Query: 437 KQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSV 492
           K+ ++GSV     +  + G+  +  +  +NF G G R  + A    ++            
Sbjct: 420 KEANSGSVNFGVGFGTESGISFQAGLTQDNFLGTGNRFGINAMTNDYSKNISLEYNDPYF 479

Query: 493 EDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGA 552
                         + + +              ++    P  E    +F       +   
Sbjct: 480 TINNVSLGGKIYYNEFKASDANISDYTNQSYGTSLTWGFPFNELNYFNFSLGYDHNKISD 539

Query: 553 ISEKEKIPS------IYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
           +++  ++                 +    S +     N L+    P  G     S+    
Sbjct: 540 VADSYQVSQFKRAHGFNLDPDSTIELDDFSWTIGWTRNNLNRGYFPTSGNRQDLSFKMTI 599

Query: 607 FGGDSQYHRIGSRASYFYLLSD--DSDIVGSLRFGYGCVIPSNKN-----LQLFDQFSVS 659
            G DSQY +       +  L++  D  ++   + GYG    +  N     +  ++ F   
Sbjct: 600 PGSDSQYFKAQYNVRQYIPLTEKQDFSLLLRGKLGYGNGYGTTDNGSDQLMPFYENFYAG 659

Query: 660 SNYYLRGFAYKGIGPR--------------VDKKYAIGGKIYSSASAAVSFPMPLVPER- 704
               +RGF    +GP+              V+   A GG   + AS  +  P P   +  
Sbjct: 660 GFSTIRGFRSNTVGPKAIYRSGSQGNNPSWVNSDDADGGNAIALASMELIVPTPFASDEL 719

Query: 705 -AGLRGAFFVDSATLYANHV----ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
              +R +FFVD+ +++                 +    R S G  + W SP+G +     
Sbjct: 720 KNQIRTSFFVDAGSVWNTEYHPAGTTNNIPDYSDPGMIRASAGAALQWMSPMGPLVFSVA 779

Query: 760 IPLRHREGDKIQQFGFRIGNRM 781
            P++  EGD  + F F IG   
Sbjct: 780 KPIKKYEGDDEEFFTFTIGQTF 801


>gi|298488174|ref|ZP_07006211.1| Outer membrane protein assembly factor YaeT precursor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298157453|gb|EFH98536.1| Outer membrane protein assembly factor YaeT precursor [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 790

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 165/785 (21%), Positives = 315/785 (40%), Gaps = 31/785 (3%)

Query: 28  IILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKN 87
           + L + +     +  ++T  +  I + G   V    + + +P+ VG    +  L  A ++
Sbjct: 6   LFLSFCLLFSVPLAHADTFSISDIRVNGLQRVSAGSVFAALPLNVGDQADEQRLADASRS 65

Query: 88  IYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAY 144
           ++  G+F ++ +    +VL+I+++ER  I  +   GN  +  + L   ++         +
Sbjct: 66  LFKTGFFQDINVARDGNVLVINVVERPSIASIEIIGNKAISTEDLMKGLKQSGLSEGEIF 125

Query: 145 DEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGN 204
              T+    + +++ Y + G  +  V  +        + +   I+EG  A I  I  VGN
Sbjct: 126 QRATLEGVRNELQRQYVAQGRYSASVDTEALPAPRNRIALKITIDEGTVASIQHINVVGN 185

Query: 205 KNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL 263
             +S   L     ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++S  +
Sbjct: 186 TVFSDEELADQFQLKTSNWLSFFKNDDKYAREKLSGDLERLRSWYLDRGYINMDINSTQV 245

Query: 264 FDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESS 323
                   V I                     ++ +  L  LI ++ G +++ + + +++
Sbjct: 246 SLTPDKKGVFITVNITEGERYTVGSVKLGGDLKVPQAQLEQLILVKPGQVFSRKVMTDTT 305

Query: 324 EKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVI 383
             I++   +    F  V      + A   VDI +++D G   Y  RI   GN ++ D V+
Sbjct: 306 NLITRRLGNDGYTFANVNGVPKANDADHTVDISFMVDPGKRAYANRINFRGNTKTADEVL 365

Query: 384 RRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGS 443
           RRE+   EG   +  +I+++K R+   G+F EVN+         D V +  +V++ ++G+
Sbjct: 366 RREMRQMEGGWASTYLIDQSKVRLERLGFFKEVNVETPAVPGTDDQVDINYAVEEQASGN 425

Query: 444 VGIATNYEVDKGMGVEGHIDDNNFFGQGY-------RARLAAGFGRHAVQNYTFSVEDPY 496
           +  +  +    G+ + G I  NN  G G        R+     +       Y        
Sbjct: 426 ITASVGFAQSAGLILGGSISQNNILGTGNFASLGMTRSEYQTKYNFAFTNPYFTPDGVSL 485

Query: 497 FLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEK 556
                 +A    +    +D     +  S    + +    S ++   Y L           
Sbjct: 486 GYNVFYNATDYSKYYDDDDEVSYYSLNSVGAGVNLGYPISETSRLTYGLSIQHDTLDPGS 545

Query: 557 EKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHR 615
                IY  +   G  F++   S     +TL+  ++  +G   S +      G D Q+++
Sbjct: 546 YSADEIYDFIEREGSSFTNLKASIGWSESTLNKGVLATRGHSQSLTLTSTVPGSDLQFYK 605

Query: 616 IGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR 675
           +      F  LSD + +    + GYG        L  ++ ++      +RGF    +GPR
Sbjct: 606 LDYNGQTFLPLSDTTSLRLHTKLGYGNGYGETDGLPFYENYTAGGQATVRGFKDGTLGPR 665

Query: 676 -----------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
                                 A+GG I  +      FPMP V ++  LR + F D  T+
Sbjct: 666 NTPATGTYASQGQIYYSDRDTEALGGNILITGGMEYLFPMPFVKDQKSLRTSLFWDFGTV 725

Query: 719 YANHV--ALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFR 776
           YA+    +   +    N      S GV + W SPLG +     +P++  E  + Q F F 
Sbjct: 726 YADKCYLSTTQNCGNINIDQMASSVGVGVTWYSPLGPLSFDLAVPIKKPEDAETQVFQFS 785

Query: 777 IGNRM 781
           +G   
Sbjct: 786 LGQTF 790


>gi|89900781|ref|YP_523252.1| surface antigen (D15) [Rhodoferax ferrireducens T118]
 gi|89345518|gb|ABD69721.1| surface antigen (D15) [Rhodoferax ferrireducens T118]
          Length = 779

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 176/776 (22%), Positives = 312/776 (40%), Gaps = 21/776 (2%)

Query: 14  LLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVG 73
           +L+  F R        +   +F     +  +   VR I I G   V    +   +PV VG
Sbjct: 17  ILKMQFNRFALRTVSAVASLVFVAGTAWAVSPFTVRDIRIEGLQRVEPGTVFVSLPVRVG 76

Query: 74  QSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLK 133
              +D     A++ ++A+G F +V+I++   VL+I + ER  +  + F G      D LK
Sbjct: 77  DVYNDEVGSSAIRTLFALGLFKDVRIEVSGDVLVIVVEERPTVAEVEFVGTKEFDKDVLK 136

Query: 134 MI---VRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEE 190
                +       +D+  ++     +K+ Y +       V      I    +N+T+ + E
Sbjct: 137 KALRDIGLADGRPFDKAQLDRAEQELKRQYINRSLYAAEVVTTVTPIERNRVNLTFTVTE 196

Query: 191 GVKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYH 249
           G  AKI+ IR VGN  +  + L  +           + K+D YS+ +++ D E +R++Y 
Sbjct: 197 GEAAKISEIRIVGNHVFGESTLRGLFDLDTGGWLSWYTKSDRYSRAKLNADIETLRSYYL 256

Query: 250 DRGYAAVKVSSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRI 308
            RGY   KV S        K+   +   I EGE + V  + ++            SL+ I
Sbjct: 257 TRGYLEFKVDSTQVAILPNKTDISITINITEGERFIVSGVKLEGNFLGKD-DEFKSLVTI 315

Query: 309 RSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVK 368
           R G  YN  E+ ++++  + YF +    F RV+ R + D     V +    +     YV+
Sbjct: 316 RPGQAYNADEVAKTTKAFTDYFGNFGFAFARVQARPDIDRVNNRVALVLQAEPSRRAYVR 375

Query: 369 RIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSD 428
           +I + GN ++ D V+RRE    E    +   I+ ++ R+   GYFSEV I         D
Sbjct: 376 KINVAGNSRTRDVVVRREFRQFEASWYDADKIKLSRDRVDRLGYFSEVGIETQEVAGSPD 435

Query: 429 YVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNY 488
            V L ++V +   GS+ +   +    G+G+   +   N FG G    +     +      
Sbjct: 436 QVDLSINVVEKPTGSLSLGAGFSSADGLGLSFGLKQENAFGSGNSLGVQVNTSKINRVIV 495

Query: 489 ---TFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDL 545
              T        +   I         + +     +     ++R  VP TE+ +  F    
Sbjct: 496 FNTTDPYFTADGVSRTIDVYHRTSSPYQDTSYYKVVTSGGSLRFGVPFTETDTVYFGAGA 555

Query: 546 RFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYA 605
              +   I+    +P+ Y   ++H    +  ++     +  D+ + P  G    ++    
Sbjct: 556 ---EKTTITPGTLLPNSYLPYVDH-DNVAIPLTVGWSRDRRDSALAPNSGRYQRAN-AEW 610

Query: 606 GFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
              GD +Y R   +   +  L+       +   G G  +  +K   +F  F       +R
Sbjct: 611 SVAGDLRYVRATYQYQEYIPLNKQFTAAFNGELGLGAAVG-DKTYPVFKNFYGGGLGSVR 669

Query: 666 GFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAL 725
           GF    +GP+      +GG    + +A +  P P       LR   F+D  ++       
Sbjct: 670 GFEQGSLGPKDSTGTVLGGTKKVNLNAEILSPFPGAGNDRTLRMFAFLDVGSV------S 723

Query: 726 GADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           G+  +  N    R S GV + W SP+G + +    P++  EGDKIQ   F+IG   
Sbjct: 724 GSGAVNENAGSLRSSVGVGVSWISPVGPLRLAIAKPIKKFEGDKIQTMQFQIGTTF 779


>gi|225077045|ref|ZP_03720244.1| hypothetical protein NEIFLAOT_02097 [Neisseria flavescens
           NRL30031/H210]
 gi|224951602|gb|EEG32811.1| hypothetical protein NEIFLAOT_02097 [Neisseria flavescens
           NRL30031/H210]
          Length = 799

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 185/800 (23%), Positives = 347/800 (43%), Gaps = 42/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     +  LS +  ++   ++ I + G        + + +PV VG + +DA  +
Sbjct: 1   MKLNQIASALMVLSLSPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDNFNDARSE 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K +YA G+F +V+++ +D+ +++ +IER  I+ L  +G   L++D +K  +      
Sbjct: 60  EIIKKLYATGFFDDVRVETMDNQVLLTVIERPTISSLNITGAKILQNDAIKKNLEAFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y S G  +V +      ++   ++I   IEEG   KI  I
Sbjct: 120 QSQYFNQATLNQVVAGLKEEYLSRGKQSVQITPTVTKLARNRVSIDIAIEEGKSTKITDI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  RL + +S  ++  +    +++ +++++ + D E +  +Y + GY   ++
Sbjct: 180 SFEGNEVYSDRRLMKQMSLSKSGMWTWITRSNQFNEQKFAQDMEKVTNYYQNNGYFNFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EG+ +  GN+ I+    E+ K+ L  L+ ++ G  Y   
Sbjct: 240 LDTDIQTNEDKTKQTIKVTVSEGDRFRWGNVRIEGDTLEVPKEDLEKLLTMKPGKWYERA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++  S E I          F  +  +   +     VD    +  G  +YV  I I GN++
Sbjct: 300 QMSNSLEAIQNRMGQAGYAFSEINVQPIPNAETHTVDFVLTVQPGRKIYVNEINITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D VIRREL   E  P + + ++R+K R+   GYF  V    +P  +  D V L +S+ 
Sbjct: 360 TRDEVIRRELRQMESAPYDSAKLQRSKERVELLGYFDNVQFDAVPVANTPDQVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G    L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVAQDNLFGTGKSVALRASRSKTTVNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDG---SLDINDESAAVRMIVPITESISTSFKYDLRFLQYG 551
           P  +                               +R+ +P+TE    +F      L   
Sbjct: 480 PDGVSLGYDLYGKTYDPRKASSSAKQYKTTTFGGGLRIGIPVTEYDRVNFGLAAERLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
                 K  + +      G     S        +     N  DN + P +G L   + + 
Sbjct: 540 TYKVAPKRYADFIKQYGKGTDGVGSFKGWLYKGTIGWGRNKTDNALWPTRGYLTGVNGEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G D QY+ +    ++F+ LS D  ++     GYG      K +  F+ F       +
Sbjct: 600 ALPGSDLQYYTLTHNQTWFFPLSKDFTLMLGGEVGYGNGYGKTKTMPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RGF    +GP+V  +Y    + GG   ++ SA + FPMP + +   +R + F D+ +++ 
Sbjct: 660 RGFESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDSRTVRLSLFADAGSVWD 719

Query: 721 -------------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
                              N   LG        +  R S G  + W SPLG M   Y  P
Sbjct: 720 DKTYNDRSSNSYYTNNAAQNPYGLGKTHKSTFKNELRYSAGAAVTWLSPLGPMKFSYAYP 779

Query: 762 LRHREGDKIQQFGFRIGNRM 781
           ++ +EGD+IQ+F F++G   
Sbjct: 780 IKKKEGDEIQRFQFQLGTTF 799


>gi|302187906|ref|ZP_07264579.1| outer membrane protein [Pseudomonas syringae pv. syringae 642]
          Length = 791

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 174/792 (21%), Positives = 332/792 (41%), Gaps = 36/792 (4%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNINEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G++          LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYNAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GKYTVDEIFDFVEKEGDKYLNFKGSIGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYGGGFNSVRGFKDSTLG 659

Query: 674 PR---------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
           PR                      GG         V FP+P V ++  LR + F D   +
Sbjct: 660 PRSTPSNGSKPGTLADPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRSLRTSVFWDVGNV 719

Query: 719 YANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD-K 769
           +  +         G        + S    S G+ + W + LG +     +P++  + + +
Sbjct: 720 FDTNCDSSRKTASGKNVECNNIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPDDEAE 779

Query: 770 IQQFGFRIGNRM 781
            Q F F +G   
Sbjct: 780 TQVFQFSLGQTF 791


>gi|91788549|ref|YP_549501.1| surface antigen (D15) [Polaromonas sp. JS666]
 gi|91697774|gb|ABE44603.1| surface antigen (D15) [Polaromonas sp. JS666]
          Length = 784

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 169/781 (21%), Positives = 307/781 (39%), Gaps = 22/781 (2%)

Query: 11  IKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPV 70
               ++K   +        +   +F ++A +  +   VR I + G   V    I + +P 
Sbjct: 16  FIHFMQKQLNKFKIRAVCAIAAGLFAVNAAWAVDPFTVRDIRVEGLQRVEPGTIFASLPF 75

Query: 71  VVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDD 130
            VG++ +D     A++ ++ +G F +V++++   VL++ + ER  +  + F G      +
Sbjct: 76  RVGETYNDEKGSTAIRALFGLGLFKDVRLEVSGDVLVVIVEERPTVADVDFVGTKEFDKE 135

Query: 131 QLKMIV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
            LK  +          +D+   +     +K+ Y +       V      I    +N+T+ 
Sbjct: 136 ALKKALRDVGIADGQPFDKALADKAEQELKRQYINKSLYGAEVVTTVTPIERNRVNLTFS 195

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRA 246
           + EG  AKI  I   GNK +S + L  +           + K+D YS+ +++ D E +R+
Sbjct: 196 VVEGDVAKIKEIHITGNKAFSESTLLGLFDLDTGGWLSWYTKSDRYSRAKLNADIETLRS 255

Query: 247 FYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLI 306
           +Y  RGY   KV S  +        + +          V +          +++   SL+
Sbjct: 256 YYLSRGYLEFKVDSTQVAISPDKQSIAVTVNVTEGERFVVSSVKLEGDYLGKEEEFKSLV 315

Query: 307 RIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLY 366
            I+    YN   + E+ +    YF +    F RV+     D     V      +     Y
Sbjct: 316 TIKPAEAYNADAVAETRKAFIDYFGTFGFAFARVEAVPEIDRVNNRVAFVLQAEPSRRAY 375

Query: 367 VKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDV 426
           V+R+ + GN+++ D V+RRE    E    +   I  ++ R+   G+F+EVNI        
Sbjct: 376 VRRVNVSGNNRTRDEVVRREFRQFESSWYDGDKIRLSRDRVDRLGFFNEVNIDTQEVTGT 435

Query: 427 SDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ 486
           +D V + VSV +   G++ +   Y     + +   I   N FG G    +     +   Q
Sbjct: 436 ADQVDVNVSVVEKPTGNLQLGAGYSSADSVSLLFGIKQENVFGSGNYLGIEVNTSKSNRQ 495

Query: 487 N----YTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFK 542
                            +        +    + G   +    A++R  VP TE+ +  F 
Sbjct: 496 MVLSTIDPYFTADGISRTIDVYDRTSKPLSGQGGDYSLKTRGASIRFGVPFTENDTVYFG 555

Query: 543 YDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSI--SQSIIYNTLDNPIVPRKGMLISS 600
                L    I     +P  Y T  +   F S+SI  +     +  D+ +VP  G     
Sbjct: 556 SGFESL---TIVPGTNLPVSYQTYADQFGFKSNSIPLTVGWSRDNRDSALVPTSGRYQRL 612

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
            Y   G  GD ++ R   +   +  L+    +  +   G+G  + S +   LF  +    
Sbjct: 613 -YGDWGVAGDIKFVRANYQVQQYIPLNKQFTVALNGELGWGKGL-SGQPYPLFKNYYSGG 670

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
              +RGF    +GPR     A GG    + +A +  P P       LR   FVD+  ++ 
Sbjct: 671 LGSVRGFEQSSLGPRDASDLATGGPKKLTLNAELIAPFPGAGNDRTLRMYGFVDAGNVFG 730

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
              +   +         R S G+ I W SP+G + + Y +P+R   GD+I++  F+IG  
Sbjct: 731 EKESYRVND-------LRASAGIGISWISPVGPLRIAYAMPIRKMAGDRIERLQFQIGTS 783

Query: 781 M 781
            
Sbjct: 784 F 784


>gi|90413537|ref|ZP_01221528.1| putative surface antigen [Photobacterium profundum 3TCK]
 gi|90325469|gb|EAS41952.1| putative surface antigen [Photobacterium profundum 3TCK]
          Length = 806

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 169/806 (20%), Positives = 300/806 (37%), Gaps = 47/806 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             +  +++   + G S    +   +V  I   G   V     L ++PV VG ++ D D+ 
Sbjct: 1   MAIKKLLIASLLLGSSVAQSAEQFVVDDIRFEGLQRVTMGAALLKMPVRVGDNVDDRDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ ++A G F ++K+      L++ ++ER  I ++ FSGN  +K++QL   +     R
Sbjct: 61  EIIQALFASGNFEDIKVFRDGDALVVKVLERPTIANITFSGNKAIKEEQLTDNLDSSNLR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  V+     +     ++ +V  EGV AKI  I
Sbjct: 121 IGEALDRTTLSKIEKGLEDFYYSVGKYNASVQAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFGKTD-VYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN  ++ A L    +++    +     D  Y K+ ++ D E +R+ Y + GY   K+
Sbjct: 181 NFIGNDVFTDAELSSKFNLKADIPWWNFLADEKYQKQVLAGDLEILRSQYLNNGYLKYKL 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        V I    +                      L  L+ I +G+ YN  +
Sbjct: 241 DSTQVSISPDKKGVYITLKIDEGEQYQVKDVTFRGDLSKDNNDLNELVTINTGDTYNGAQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E + +        + +V T  + D     V +   ++ G  +YV+ I+  GN  +
Sbjct: 301 VTALEEAVKRTLGESGYAYPQVTTIPDFDDDNNEVSLLVNVESGKRIYVRNIQFSGNTST 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +N   +E  K R+  TG+F  V++  +      D V ++  VK+
Sbjct: 361 KDEVLRREMRQMEGSWLNSKSVESGKSRLNRTGFFETVDVQTVRVPGSDDEVDIKYVVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVED 494
            +AGS+     Y  + G+  +  I  +NF G G R  + A    +               
Sbjct: 421 ANAGSINFGVGYGTESGISFQAGIQQDNFLGTGNRFGINAMMNDYQKNVSLEYRDPYFTI 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
                       + + +              ++    P  E     F       +     
Sbjct: 481 DGISLGGKIYYNEFEASDANISDYTNQSYGTSLTWGFPFDELNFFEFGLGYDHNKISNTQ 540

Query: 555 EKEKIPSI-----YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGG 609
           E  +I        +       +      S S   N L+    P  G    +S+     G 
Sbjct: 541 EYYQIEKFKKIHGFDRGQNVIELDDFDWSVSWTRNNLNRGYFPTAGNHQRASFRMTIPGS 600

Query: 610 DSQYHRIGSRASYFYLLSDDSDIV--GSLRFGYGCVIPSNKN-----LQLFDQFSVSSNY 662
           D+QY +       ++ L+D  D       R GYG    +  N     L  ++ F      
Sbjct: 601 DAQYFKTQYDVRQYFPLNDGHDFSLLLRGRLGYGNGYGTTDNGSDQLLPFYENFYAGGFT 660

Query: 663 YLRGFAYKGIGPRV--------------------DKKYAIGGKIYSSASAAVSFPMPLVP 702
            LRGF    +GP+                         A GG   + AS  +  P P   
Sbjct: 661 TLRGFRSNTVGPKAVYVGGCSSGSSIGGNNNCATGTDDAAGGNAVALASMELIVPTPFAS 720

Query: 703 ER--AGLRGAFFVDSATLYANHVALGADK-----LEGNDSFWRVSTGVEIMWNSPLGMMG 755
           +     +R + F+D+ T++     L            +    R S G  + W SP+G + 
Sbjct: 721 DEIRNQIRTSLFIDAGTVWDTEYDLKDTDGKYLEDYSDMGLIRASYGAALQWMSPMGPLV 780

Query: 756 VYYGIPLRHREGDKIQQFGFRIGNRM 781
                P++  +GD  + F F IG   
Sbjct: 781 FSIARPIKKYDGDDEEFFTFTIGRTF 806


>gi|330975391|gb|EGH75457.1| outer membrane protein [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 795

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 173/796 (21%), Positives = 330/796 (41%), Gaps = 40/796 (5%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG    I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVPSIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGNK +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNKVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNINEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            K  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GKYTVDEIFDFVQKEGDKYLNFKGSVGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PR-------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
           PR                          GG         V FP+P V ++  LR + F D
Sbjct: 660 PRSTPSRGAGVTGNQGTLEDPDQDPLPFGGNALVQGGVEVMFPLPFVKDQRSLRTSVFWD 719

Query: 715 SATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
              ++  +                  + S    S G+ + W + LG +     +P++  +
Sbjct: 720 VGNVFDTNCDSKKTTASNKTVECNNIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPD 779

Query: 767 GD-KIQQFGFRIGNRM 781
            + + Q F F +G   
Sbjct: 780 DEAETQVFQFSLGQTF 795


>gi|302878996|ref|YP_003847560.1| outer membrane protein assembly complex, YaeT protein [Gallionella
           capsiferriformans ES-2]
 gi|302581785|gb|ADL55796.1| outer membrane protein assembly complex, YaeT protein [Gallionella
           capsiferriformans ES-2]
          Length = 757

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 171/763 (22%), Positives = 324/763 (42%), Gaps = 18/763 (2%)

Query: 27  FIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVK 86
            +    ++   +  +  +   V  I + G        + S +PV VG+ ++D     A++
Sbjct: 5   KLAGILSLLFAAPAWAISPFTVTDIRVEGIQRTEAGTVFSYLPVKVGEVMNDEQAAVAIR 64

Query: 87  NIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAA 143
            +Y  G+F +V++++   VLI+ + ER  I  +  +G  +   DQLK  ++      A  
Sbjct: 65  ALYGTGFFKDVRLEVEQGVLIVLVKERPSIASIQVNGVKDFSKDQLKDNMKYAGLAEARI 124

Query: 144 YDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVG 203
           +D+  ++  V ++K+ Y + G   V V  +   +    + + + + EG  +KI  I  VG
Sbjct: 125 FDKGALDKAVQDLKRQYVARGKYGVSVNAKVTELERNRVGVVFDVVEGEISKIKQINIVG 184

Query: 204 NKNYSHARLERVISIRTSGYFSFGK-TDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQV 262
           NK YS A L  ++ + T  + S+    D YSK+++S D E++R+FY D G+    ++S  
Sbjct: 185 NKAYSEADLLDLMKLSTPDWMSWMSKNDQYSKQKLSADMESMRSFYMDSGFLEFNINSTQ 244

Query: 263 LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKES 322
           +        + I            +    S    + K+ +  L++++  + ++ + + E+
Sbjct: 245 ISITPDKKDIYITINVTEGEKYTISKVAVSGNTLVAKEEIEKLVQVKPNDAFSRKALSET 304

Query: 323 SEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSV 382
           S+ + +   +    F  V    + +  K  V   +++D G  +Y++RI I GN ++ D V
Sbjct: 305 SKLVGERLAAEGYAFANVNAIPDLNKEKHEVAFNFVVDPGQRVYIRRINIAGNTKTRDEV 364

Query: 383 IRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAG 442
           IRRE    EG   + + I+++K+R+    +FSEVN+        SD + +  SVK+ S G
Sbjct: 365 IRREFRQVEGAWFDVTKIKKSKQRVDRLNFFSEVNVETPAVQGTSDQMDVNASVKEKSTG 424

Query: 443 SVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFL 498
           S  +       +G+ + G +   N FG G          +               D    
Sbjct: 425 SFTVGAGISQGEGLVLSGGVTQANLFGSGNMLSTQLNTSKINKNISVSYTNPYYTDEGVS 484

Query: 499 GSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEK 558
                   +   T+              VR  +PI+E  S SF         G  +    
Sbjct: 485 RGFDIYQRNTNATNTIMSRYTSATTGGGVRFGIPISEDQSISFGLSAEKSTIGLTALSPL 544

Query: 559 IPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGS 618
               Y T       +    +     ++ D+ I   +G +  +  + A    D +Y+++  
Sbjct: 545 SYQNYVTTFGSTNTTVLG-TLGWGRDSRDSAIYTTEGTVQRAYAEVALPVMDMRYYKVNY 603

Query: 619 RASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDK 678
              ++Y +S D  ++ +   G G      K +  F  F    +  +RG+    +GPR   
Sbjct: 604 DQQWYYPISSDFTLMLNGMAGAGRGYG-GKQMPFFKNFYAGGSGSVRGYEANSLGPRDAN 662

Query: 679 KYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWR 738
            +++GG+   +AS  +  P+P + ++  +R + FVD   +Y      G           R
Sbjct: 663 NFSLGGQRRVAASMEIMAPIPGIKDK-SVRLSGFVDGGAVYGTGTLPG-------SVGMR 714

Query: 739 VSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            S G  + W SP+G M   YG+PL  +  DK+Q F F +G   
Sbjct: 715 YSYGAAVTWLSPMGPMKFSYGLPLNKQAVDKLQAFQFTLGTMF 757


>gi|312173380|emb|CBX81634.1| Outer membrane protein assembly factor yaeT precursor [Erwinia
           amylovora ATCC BAA-2158]
          Length = 803

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 178/800 (22%), Positives = 308/800 (38%), Gaps = 44/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +   + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLIASLLLSSATVYGADGFVVKDIHFDGLQRVAVGAALLSMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  NTIRALFATGNFEDVQVLRDGDTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+      ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTITTIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NVVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +++ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGEQYKLSGVAVSGNLAGHSAEIEGLSKVKPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  + + I K        + RV+T+   D A + V +   +D G+  YV+++  EGND S
Sbjct: 301 VTRTEDDIKKLLGRYGYAYPRVQTQTEIDDANKTVKLHINVDAGNRYYVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E+ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVEQGKERLNRLGYFETVDTDTRRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G++     Y  + G+  +  I   N+ G G    L+     +               
Sbjct: 421 RNTGTLNFGVGYGTESGVSFQAGITQENWLGTGNTVGLSGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI- 553
                       D +    +              +  P+ E+ +              + 
Sbjct: 481 DGVSLGGRLFYNDFKADDADLSDYTNKSYGVDGTLGFPVNENNTLRVGLGYVHNSLSNMQ 540

Query: 554 -------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                    +    +   +  E       + +    YNTLD    P  G   + +     
Sbjct: 541 PQVAMWRYLRSVGKNPSLSGDEDFSADDFTFNYGWTYNTLDRGFFPTAGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
            G D+ +++       +  L  D   V             S K L  ++ F    +  +R
Sbjct: 601 PGSDNAFYKATLDTQQYLPLDQDHSWVLLGRGRVGYGGGLSGKELPFYENFYAGGSSTVR 660

Query: 666 GFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVSFPMPLVPERA- 705
           GF    IGP+                        A+GG   + ASA +  P P + ++  
Sbjct: 661 GFRSNTIGPKAAYYNNGSSKCSGSDVTRICSSDDAVGGNAMAVASAELITPTPFLSDKYA 720

Query: 706 -GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
             +R + FVD+ T++  +    A                R+S G+ + W SPLG +   Y
Sbjct: 721 NSVRTSLFVDAGTVWDTNWDNTAATSAEGIPDYSKPGNIRMSAGLALQWMSPLGPLVFSY 780

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             P +  +GDK +QF F IG
Sbjct: 781 AQPFKKYDGDKAEQFQFNIG 800


>gi|300311501|ref|YP_003775593.1| outer membrane /protective OMA87 antigen protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074286|gb|ADJ63685.1| outer membrane /protective OMA87 antigen protein [Herbaspirillum
           seropedicae SmR1]
          Length = 791

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 173/789 (21%), Positives = 312/789 (39%), Gaps = 38/789 (4%)

Query: 22  SFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADL 81
           +F    I         S        +V+ I + G        + S +PV VG + +D   
Sbjct: 12  TFSRRLIAAAAFALCSSQAMAVTPFVVKDIRVEGIQRTEAGTVFSYLPVRVGDTFTDEKG 71

Query: 82  DHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQL---KMIVRS 138
             A+K +YA G+F +V+I+    VL++ ++ER  I  + FSG      +QL      +  
Sbjct: 72  TAAIKALYATGFFRDVRIESEGDVLVVQVVERPAIASVDFSGIKEFDKEQLTKALKEIGV 131

Query: 139 RSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINS 198
             +  +D   V+     +K+ Y S G     V      +    + IT+ ++EG  ++I  
Sbjct: 132 AESRIFDRSQVDRAEQELKRQYLSRGLYGAKVSTTVTPVERNRVAITFSVDEGDVSRIKQ 191

Query: 199 IRFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVK 257
           I FVGNK +S + L   I       +  + K D YSKE++  D E +R++Y DRGY  ++
Sbjct: 192 INFVGNKVFSDSTLRDQIKLTTPGWFTWYTKADQYSKEKLQGDIETLRSYYLDRGYLEMQ 251

Query: 258 VSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
           V S  +        + I    +       +           +  L  L+++++G++Y+  
Sbjct: 252 VESTQVSITPDKKDIYITVNIKEGEKYTVSGVKLEGEMFGMEPELAKLVQLKAGDVYSGA 311

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +S++KI +   +    F  V    N D  K+ V    +ID G  +YV+ I I GN +
Sbjct: 312 KLTDSTKKIGERLGNFGYAFANVNANPNVDREKKEVAFTIMIDPGKRVYVRHINIAGNTK 371

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D VIRRE    E    +   I+ ++ R+   GYF EV +        SD V + + V+
Sbjct: 372 TRDEVIRREFRQFEDSWYDGEKIKLSRDRVDRLGYFKEVTLDTPEVPGTSDQVDVNMKVE 431

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG----FGRHAVQNYTFSVE 493
           +   G++ +   +     + + G I   N FG G    +       +   +V        
Sbjct: 432 EKPTGNIMVGAGFSQSDKLSLTGSISQENAFGSGNTVGIDINTSSRYRTVSVSTTNPYFT 491

Query: 494 DPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
           D     +       ++ +    G   +     +++  VP +E     F   L        
Sbjct: 492 DDGISRTYEVYLRTVRPSVYATGDYRVKTLGGSIKFGVPFSELDRVFFGVGLENTDVSTD 551

Query: 554 SEKEKIPSIY-----------TTLIEHGK--------FSSHSISQSIIYNTLDNPIVPRK 594
           +    +   Y             +   G          +S  ++ +   +  D+ +VP  
Sbjct: 552 TTSPTLYRQYVRDFGGAGVAGCDVTSSGNGCGIGSARTTSIPLTVAWQRDGRDSALVPTT 611

Query: 595 GMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDD-SDIVGSLRFGYGCVIPSNKNLQLF 653
           G    ++     + G  +Y+R   +  YF         +  +    YG  I S K   +F
Sbjct: 612 GRYQRAN-LEVSYLGTLKYYRASYQHQYFQPFFSKAVTLALNGEVDYGRGIGS-KPYPVF 669

Query: 654 DQFSVSSNYYLRGFAYKGIGP-RVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFF 712
             +       +RG+    +G  +     ++GG      +  + FP P   +   LR   F
Sbjct: 670 KNYYAGGIGTVRGYEASSLGSLKDQYGDSMGGASRLYGNVELQFPFPGSGQDRTLRWFTF 729

Query: 713 VDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQ 772
            D   ++A+   +  +         R S GV I W SP+G + + +G PL  + GDK Q 
Sbjct: 730 FDGGNVFADGQNIKFND-------LRYSAGVGISWVSPIGPLKLSFGKPLNLKTGDKSQT 782

Query: 773 FGFRIGNRM 781
           F F++G   
Sbjct: 783 FQFQLGTGF 791


>gi|292489219|ref|YP_003532106.1| outer membrane protein assembly factor yaeT [Erwinia amylovora
           CFBP1430]
 gi|292898547|ref|YP_003537916.1| outer membrane protein assembly factor [Erwinia amylovora ATCC
           49946]
 gi|291198395|emb|CBJ45502.1| outer membrane protein assembly factor [Erwinia amylovora ATCC
           49946]
 gi|291554653|emb|CBA22339.1| Outer membrane protein assembly factor yaeT precursor [Erwinia
           amylovora CFBP1430]
          Length = 803

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 178/800 (22%), Positives = 308/800 (38%), Gaps = 44/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  +++   +   + VYG++  +V+ I   G   V     L  +PV VG ++SD DL 
Sbjct: 1   MAMKKLLIASLLLSSATVYGADGFVVKDIHFDGLQRVAVGAALLSMPVRVGDTVSDEDLS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
           + ++ ++A G F +V++      LI+ + ER  I  + FSGN  +K+D LK  +     R
Sbjct: 61  NTIRALFATGNFEDVQVLRDGDTLIVQVKERPTIASITFSGNKAVKEDMLKQNLEASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+      ++  Y S+G  +  VK     +    +++  V  EGV AKI  I
Sbjct: 121 VGEALDRTTITTIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VGNK +S   L           +++      Y K++++ D E +R+FY DRGYA   +
Sbjct: 181 NVVGNKAFSSDELISRFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSFYLDRGYARFNI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I            +    S         +  L +++ G LYN  +
Sbjct: 241 DSTQVSLTPDKKGIYITVNITEGEQYKLSGVAVSGNLAGHSAEIEGLSKVKPGELYNGAK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +  + + I K        + RV+T+   D A + V +   +D G+  YV+++  EGND S
Sbjct: 301 VTRTEDDIKKLLGRYGYAYPRVQTQTEIDDANKTVKLHINVDAGNRYYVRKVRFEGNDTS 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D+V+RRE+   EG  +   ++E+ K R+   GYF  V+          D V +   VK+
Sbjct: 361 KDAVLRREMRQMEGAWLGSDLVEQGKERLNRLGYFETVDTDTRRVPGSPDQVDVVYKVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQN----YTFSVED 494
            + G++     Y  + G+  +  I   N+ G G    L+     +               
Sbjct: 421 RNTGTLNFGVGYGTESGVSFQAGITQENWLGTGNTVGLSGTKNDYQTYAEFSLTDPYFTV 480

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI- 553
                       D +    +              +  P+ E+ +              + 
Sbjct: 481 DGVSLGGRLFYNDFKADDADLSDYTNKSYGVDGTLGFPVNENNTLRVGLGYVHNSLSNMQ 540

Query: 554 -------SEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAG 606
                    +    +   +  E       + +    YNTLD    P  G   + +     
Sbjct: 541 PQVAMWRYLRSVGKNPSLSGDEDFSADDFTFNYGWTYNTLDRGFFPTAGNRTNLNGKVTI 600

Query: 607 FGGDSQYHRIGSRASYFYLLSDDSDIV-GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
            G D+ +++       +  L  D   V             S K L  ++ F    +  +R
Sbjct: 601 PGSDNAFYKATLDTQQYLPLDQDHSWVLLGRGRVGYGGGLSGKELPFYENFYAGGSSTVR 660

Query: 666 GFAYKGIGPRV-------------------DKKYAIGGKIYSSASAAVSFPMPLVPERA- 705
           GF    IGP+                        A+GG   + ASA +  P P + ++  
Sbjct: 661 GFRSNTIGPKAAYYNNGSSNCSGSDVTRICSSDDAVGGNAMAVASAELITPTPFLSDKYA 720

Query: 706 -GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
             +R + FVD+ T++  +    A                R+S G+ + W SPLG +   Y
Sbjct: 721 NSVRTSLFVDAGTVWDTNWDNTAATSAEGIPDYSKPGNIRMSAGLALQWMSPLGPLVFSY 780

Query: 759 GIPLRHREGDKIQQFGFRIG 778
             P +  +GDK +QF F IG
Sbjct: 781 AQPFKKYDGDKAEQFQFNIG 800


>gi|116251984|ref|YP_767822.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256632|emb|CAK07720.1| putative outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 780

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 283/780 (36%), Positives = 455/780 (58%), Gaps = 7/780 (0%)

Query: 7   DFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILS 66
           + +   + L      +     +          +   +  ++++RI++RGA+ VG E + S
Sbjct: 3   EMKAGSKFLNAVSAVALSASVVASGAGALTFVSATAAEAAVIQRIDVRGASRVGAEAVRS 62

Query: 67  RIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNN 126
            + +  G+S S++D+D +VK +Y  GYFS+VKI +  S L++++ E +++N + F+GN  
Sbjct: 63  NLTIAPGKSFSNSDIDASVKQLYGTGYFSDVKISVSGSTLVVNVQEAQLVNQVVFNGNRK 122

Query: 127 LKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITY 186
           +KDD+L  IV++ +A  Y +  + AD+ +IK+AYA+ G   V V  Q   +    +N+ +
Sbjct: 123 IKDDKLATIVQTHAAGPYSDTQIQADIQSIKEAYAATGRSEVEVTTQVVPLGEGRVNLAF 182

Query: 187 VIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY-FSFGKTDVYSKERMSFDEEAIR 245
           VI EG + KI+SI FVGN  YS  RL  VI+ + S +     + DVY+++++  DEEA+R
Sbjct: 183 VINEGDRTKIDSINFVGNNAYSAGRLAAVIATKRSNFLSFLTRKDVYNEDKLHADEEALR 242

Query: 246 AFYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLS 304
            FY++RGYA +++ S         + Y L F I+EG+ Y  G +++QST++ +  + L  
Sbjct: 243 QFYYNRGYADMRIVSSDATFDDATNKYTLTFNIEEGQRYDFGPVTVQSTVEGVGSEQLQP 302

Query: 305 LIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSP 364
           L+R R G +YN +E+++S E IS    S   PF RV  R NRD     + +EYL+DQG  
Sbjct: 303 LVRTREGQVYNAKEVQKSIEAISDQVASAGYPFARVTPRGNRDLNNNTIGVEYLVDQGER 362

Query: 365 LYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAN 424
            YV+RIEI GN ++ D VIRRE ++SEGD  N  MI +AKRR+ A GYFS VNIS  P +
Sbjct: 363 AYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMITKAKRRLEALGYFSSVNISTQPGS 422

Query: 425 DVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHA 484
                V++     Q +      A       G+ +E  I++ NF G+G   R++AG G+  
Sbjct: 423 SPDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLEASIEEKNFLGRGQYIRISAGGGQEG 482

Query: 485 VQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYD 544
            + Y  S  +PYFLG  ++AGFD+ ++     + D + E  +V + V    +   +  + 
Sbjct: 483 SRAYGVSFTEPYFLGYRLAAGFDVNRSETS-SNDDYDYEETSVVLRVTAPITEDLATTFR 541

Query: 545 LRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
             + Q     +   + + Y  L++   ++  S+SQ++ YNTLD+ ++PR+G+  +++++ 
Sbjct: 542 YNYKQMKYDGDTSDLSATYANLVDESPWTRSSVSQTLTYNTLDDTVLPREGIYATATHEL 601

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           AG GGDSQ+++I  +A Y++LL+DD+DI+GSL    G V+P   +L +FDQF+++ N  +
Sbjct: 602 AGLGGDSQFYKIYGKARYYHLLADDADIIGSLSASAGYVVPLGDHLNVFDQFTLT-NGDI 660

Query: 665 RGFAYKGIGPRV--DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH 722
           RGF  KGIGPR+  D    +GG  Y +ASA  +FPMP  P    LRGA F D+ TL+ N 
Sbjct: 661 RGFENKGIGPRIRGDNDDPLGGTTYFTASAEATFPMPGFPRDFNLRGAVFADAGTLFGND 720

Query: 723 VA-LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           V  LG+D+ +G  +  R S GV ++W SP G + + Y IP+   + DK Q F F I N+ 
Sbjct: 721 VELLGSDQADGTSASLRASVGVGVVWQSPFGALRLDYAIPVLKEDFDKTQNFKFGINNQF 780


>gi|298370299|ref|ZP_06981615.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298281759|gb|EFI23248.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 799

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 186/800 (23%), Positives = 346/800 (43%), Gaps = 42/800 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + GLS +  ++  I++ I + G        + + +PV VG + SDA  +
Sbjct: 1   MKLKQIASTLMVLGLSPLAMAD-FIIQDIRVEGLQRTEPSTVFNYLPVKVGDNFSDARSE 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +KN+YA G+F +V+++ + + +++ ++ER  I  L  +G   L++D +K  +      
Sbjct: 60  EIIKNLYATGFFDDVRVETMGNQVLLTVVERPTIATLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  ++  Y   G  +V +      ++   ++I   I+EG   KI  I
Sbjct: 120 QSQYFNQATLNQAVVALRDEYVGRGKQSVKITPTVKKLARNRVSIDIAIDEGKSTKIADI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN  YS  +L + +S      +    +++ +++++ S D E +  FY + GY   ++
Sbjct: 180 EFEGNHVYSDRKLMKQMSLSEGGMWTWLTQSNQFNEQKFSQDLERVSEFYQNNGYFGFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + V  ++ K+   +   +DEGE Y  G ++I    +E+ K+ L  ++ ++ G  Y  Q
Sbjct: 240 VDTDVQTNEDKTKQTIKITVDEGERYRWGKVTIDGDTREVLKEELYKMLTMKEGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++ +S E +     S    F  +  +   +   + VD    ++ G  +YV +I I GN++
Sbjct: 300 KMVKSLEAMQNRMGSAGYAFSEINVQPVPNPQTKTVDFVLHVEPGRKVYVNQINITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V     P     D V + +SV+
Sbjct: 360 TRDEVVRRELRQMEAAPYDTSKLQRSKERVELLGYFDNVQFDAKPVEGSPDQVDVNMSVQ 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D GM +   +  +N FG G  A           +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGMVLSAGVSQDNLFGTGKSASARVSRSKTTVNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDG---SLDINDESAAVRMIVPITESISTSFKYDLRFLQYG 551
           P  +                             A +RM +P+TE    +F      L   
Sbjct: 480 PDGVSLGYDVYGKSYDPRKASSSAKQYKTTTAGAGIRMGIPVTEYDRVNFGLAAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHG-------KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
             +   K    +      G       K   +  +     N  DN + P +G     + + 
Sbjct: 540 TYTGAPKRYRDFINRYGKGSDGVGSFKGWLYKGTIGWGRNKTDNALWPTRGYQTGINGEV 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G D +Y+ +    ++F+ L+    ++     GYG      K +  F+ F       +
Sbjct: 600 ALPGSDLKYYTLTHNQTWFFPLNKSLTLMLGGEVGYGNGYGKTKEMPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RGF    +GP+V  +Y    + GG   ++ SA + FPMP + +   +R + F D+ +++ 
Sbjct: 660 RGFESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDARTVRLSLFADAGSVWD 719

Query: 721 -------------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
                              N   LG           R S G  + W SPLG M   Y  P
Sbjct: 720 GKTYTDKDNDEYYNGRAKQNVYGLGTSHKSTFKEELRASAGAAVTWLSPLGPMKFSYAYP 779

Query: 762 LRHREGDKIQQFGFRIGNRM 781
            + +EGD+IQ+F F++G   
Sbjct: 780 FKKKEGDEIQRFQFQLGTTF 799


>gi|241764765|ref|ZP_04762774.1| outer membrane protein assembly complex, YaeT protein [Acidovorax
           delafieldii 2AN]
 gi|241365755|gb|EER60427.1| outer membrane protein assembly complex, YaeT protein [Acidovorax
           delafieldii 2AN]
          Length = 765

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 167/777 (21%), Positives = 312/777 (40%), Gaps = 22/777 (2%)

Query: 15  LEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQ 74
           ++K+  R        +   +F  +A +      V+ I + G   V    I + +P+ VG 
Sbjct: 1   MKKHINRLGVRTAATVAAMVFVANAAWALEPFKVQDIRVEGLQRVEPGTIFASMPLRVGD 60

Query: 75  SISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKM 134
             +D     A++ ++ +G F +V+++   +VL++ + ER  I  + F+G      + LK 
Sbjct: 61  DYNDEKGAAAIRALFGLGLFKDVRLEAAGNVLVVVVEERPTIADVDFAGTKEFDKEALKK 120

Query: 135 IV---RSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEG 191
            +          YD+   +     +K+ Y +       V      I    +N+T+ + EG
Sbjct: 121 SMRDVGLTEGRPYDKALADRAEQELKRQYINKSMYGAEVVTTVTPIERNRVNLTFTVVEG 180

Query: 192 VKAKINSIRFVGNKNYSHARLERVISIRT-SGYFSFGKTDVYSKERMSFDEEAIRAFYHD 250
             A+I  +R VGNK +S + L+ +    T      + K+D Y++ +++ D E +R++Y  
Sbjct: 181 EPARIKEVRIVGNKAFSESTLKGLFDQDTGGWLSWYTKSDRYARAKLNADLETLRSYYLQ 240

Query: 251 RGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRS 310
           RGY   +V S  +        + I          V +          ++    S + IR 
Sbjct: 241 RGYLEFRVDSTQVAISPDKQDISIVVNITEGERFVVSGVKLEGNYLDREDEFKSRVTIRP 300

Query: 311 GNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRI 370
           G  YN  ++ E+++  S+YF      F RV+     D     V +    +     YV+RI
Sbjct: 301 GEPYNADQVTETTKAFSEYFGRFGFAFARVEAVPEIDRENNRVTLVLQAEPARRAYVRRI 360

Query: 371 EIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYV 430
            + GN+++ D V+RRE    E    +   I  ++ R+   G+F+EV I         D V
Sbjct: 361 NVSGNNRTRDEVVRREFRQYEASWYDGEKIRLSRDRVDRLGFFTEVGIETQEVPGSPDQV 420

Query: 431 ILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYT- 489
            L ++V +   GS+ +   +   + + +   I   N FG G    +     ++       
Sbjct: 421 DLVINVAEKPTGSLQLGVGFSSAEKVALSFAIKQENVFGSGNYLGVDVNTSKYRRTLVFS 480

Query: 490 ---FSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLR 546
                        +        +    + G+  +    A++R  VP +E+ +  F   + 
Sbjct: 481 TTDPYFTKDGISRTFDLYYRTAKPYEDQGGNYQLVTTGASMRFGVPFSETDTVFFGGGIE 540

Query: 547 FLQYGAISEKEKIPSIYTTLIEHGKFSSHSI--SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             +         IP+ Y    E   +SS +I  +     +  D+ + P  G     +   
Sbjct: 541 QTKIK---PGTNIPANYLAYAETYGYSSSAIPLTIGWSRDDRDSALAPNSGRYQRLN-SE 596

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
               GD++Y R   +   +  L+    +  +   GYG  + + +   +F  F       +
Sbjct: 597 WSVAGDARYMRANYQYQQYVPLNKRFTVAFNGELGYGKGM-NGRPFPVFKNFYSGGLGSV 655

Query: 665 RGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVA 724
           RGF    +GPR     ++GG    + +A +  P P       LR   FVD   +Y  +  
Sbjct: 656 RGFDQGTLGPRDVTGASLGGPKKVTLNAELMAPFPGAGNDRTLRVFTFVDVGNVYGENDK 715

Query: 725 LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           +         S  R S G+ + W SPLG + + +  P+R   GD+IQ+  F+IG   
Sbjct: 716 VSF-------SDMRASVGLGLSWISPLGPLRIAFAQPVRKFAGDRIQKLQFQIGTSF 765


>gi|261253720|ref|ZP_05946293.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           orientalis CIP 102891]
 gi|260937111|gb|EEX93100.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           orientalis CIP 102891]
          Length = 803

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 170/803 (21%), Positives = 308/803 (38%), Gaps = 44/803 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+    +    +  G+   +V+ I I G   V     L ++PV VG ++ + D+ 
Sbjct: 1   MAMKNILFATLLATSVSANGAENFVVQDIRIEGLQRVALGAALLKMPVRVGDTVDNQDVS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ +YA G F ++K+   + VL++ + ER  I  + FSGN  +K++QL+  +     R
Sbjct: 61  ETIRALYATGNFEDIKVLRDNDVLVVQVKERPTIASISFSGNKAIKEEQLQQNLDASGIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSTIEKGLEDFYYSVGKYNAGVKAVVTPLPRNRSDLKFVFTEGVSAKIKQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN  Y+   L     +     +      D Y K+ ++ D EA++++Y DRGY   ++
Sbjct: 181 NFIGNTQYTDEELLSRFDLNVDVAWWNFLADDKYQKQVLAGDIEALKSYYLDRGYLKFQI 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        V I            +          ++     L+   SG  YN   
Sbjct: 241 DSTQVAISPDKKGVYITLGLNEGQPYSVSDVKFRGELLGKEAEFEKLVPFESGETYNGSA 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E + +        + +V+T    D   + V +   ++ G  +YV+ I   GN+ +
Sbjct: 301 VTGLEENVKRLLGEAGYAYPQVRTIPEFDDENQTVSLVVNVEAGQRIYVRDIRFVGNNST 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +N   IE  K R+   GYF  V++  +     +D V L  +VK+
Sbjct: 361 KDEVLRREMRQMEGSWLNSKSIETGKSRLNRLGYFETVDVQTVRVPGSTDQVDLVYNVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVEDP 495
            ++GSV     Y  + G+  +  +  +NF G G R  + A    + ++   +Y     + 
Sbjct: 421 ANSGSVNFGIGYGTESGVSFQVGLQQDNFVGSGNRVGINAMMNDYQKNISLDYRDPYWNL 480

Query: 496 YFLGSPISAGFDLQKTHLE-DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
             +       ++  +               A++    P  E     F       + G + 
Sbjct: 481 DGVSLGGKIFYNEFEASEAGIVDYTNESYGASLTWGFPFDELNRFEFGVGYTHNKIGNVP 540

Query: 555 EKEKIPSIYTTLIEHGK---FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDS 611
             ++      ++ +       +   ++ S   N L+    P  G    +         D+
Sbjct: 541 TYDQAQLFAQSIGQENGDILTNDFDVNVSWTRNNLNRGYFPTAGNYQRAFAKATVPSSDA 600

Query: 612 QYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIP---SNKNL-QLFDQFSVSSNYYLR 665
           QY ++      +  ++   +       R GYG        N NL   ++ +       LR
Sbjct: 601 QYFKVQYDVRQYVPITKKHEFTLLMRGRLGYGNGYGQTDGNDNLFPFYENYYAGGFTTLR 660

Query: 666 GFAYKGIGPRV------------------DKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
           GF     GP+                       ++GG   + AS  +  P P   E    
Sbjct: 661 GFGSNSAGPKAVYTTNGNPATCNSASCVSATDDSVGGNAVALASLELIVPTPFASEEVRN 720

Query: 706 GLRGAFFVDSATLYANHVALGAD-------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
            +R + FVD+A+++    +               +    R S G  + W SP+G +    
Sbjct: 721 QIRTSVFVDAASVWDTEFSYDPSYAGERYYDDYSDPMNIRASYGAALQWMSPMGPLVFSI 780

Query: 759 GIPLRHREGDKIQQFGFRIGNRM 781
             P+   EGD  + F F IG   
Sbjct: 781 AKPIESYEGDDEEFFTFTIGRTF 803


>gi|319638841|ref|ZP_07993599.1| outer membrane protein omp85 [Neisseria mucosa C102]
 gi|317399745|gb|EFV80408.1| outer membrane protein omp85 [Neisseria mucosa C102]
          Length = 800

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 184/801 (22%), Positives = 346/801 (43%), Gaps = 43/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     +  LS +  ++   ++ I + G        + + +PV VG + +DA  +
Sbjct: 1   MKLNQIASALMVLSLSPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDNFNDARSE 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K +YA G+F +V+++ +D+ +++ +IER  I+ L  +G   L++D +K  +      
Sbjct: 60  EIIKKLYATGFFDDVRVETMDNQVLLTVIERPTISSLNITGAKMLQNDAIKKNLEAFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y S G  +V +      ++   ++I   IEEG   KI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLSRGKQSVKITPTVTKLARNRVSIDIAIEEGKSTKITDI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  RL + +S      +    K++ +++++ + D E I  +Y + GY   ++
Sbjct: 180 SFEGNEVYSDRRLLKQMSLSEGGMWTWVTKSNQFNEQKFAQDMEKITNYYQNNGYFNFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EG+ +  GN+ I+    E+ K+ L  L+ ++ G  Y   
Sbjct: 240 LDTDIQTNEDKTKQTIKVTVSEGDRFRWGNVRIEGDTLEVPKEDLEKLLTMKPGKWYERA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++  S E I          F  +  +   +     VD    +  G  +YV  I I GN++
Sbjct: 300 QMSNSLEAIQNRMGQAGYAFSEINVQPIPNAETHTVDFVLTVQPGRKIYVNEINITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D VIRREL   E  P + + ++R+K R+   GYF  V    +P  +  D V L +S+ 
Sbjct: 360 TRDEVIRRELRQMESAPYDSAKLQRSKERVELLGYFDNVQFDAVPVANTPDQVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G    L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVAQDNLFGTGKSVALRASRSKTTVNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDG---SLDINDESAAVRMIVPITESISTSFKYDLRFLQYG 551
           P  +                               +R+ +P+TE    +F      L   
Sbjct: 480 PDGVSLGYDIYGKTYDPRKASSSAKQYKTTTFGGGLRIGIPVTEYDRVNFGLAAERLTVN 539

Query: 552 AISEKEKIPSIYTTLI--------EHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYD 603
                 K  + +             + K   +  +     N  DN + P +G L   + +
Sbjct: 540 TYKGAPKRYADFINQYGKGNGNGVGNFKGWLYKGTIGWGRNKTDNALWPTRGYLTGVNGE 599

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
            A  G D QY+ +    ++F+ LS D  ++     GYG      K +  F+ F       
Sbjct: 600 IALPGSDLQYYTLTHNQTWFFPLSKDFTLMLGGEVGYGNGYGKTKTMPFFENFYGGGLGS 659

Query: 664 LRGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           +RGF    +GP+V  +Y    + GG   ++ SA + FPMP + +   +R + F D+ +++
Sbjct: 660 VRGFESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDSRTVRLSLFADAGSVW 719

Query: 720 ANH-------------------VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
            +                      +G        +  R S G  + W SPLG M   Y  
Sbjct: 720 DDKTYDNSSSNTYYTNGALQNVYGVGKTHKSTFKNELRYSAGAAVTWLSPLGPMKFSYAY 779

Query: 761 PLRHREGDKIQQFGFRIGNRM 781
           P++ +EGD+IQ+F F++G   
Sbjct: 780 PIKKKEGDEIQRFQFQLGTTF 800


>gi|257094436|ref|YP_003168077.1| outer membrane protein assembly complex, YaeT protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046960|gb|ACV36148.1| outer membrane protein assembly complex, YaeT protein [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 766

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 173/771 (22%), Positives = 319/771 (41%), Gaps = 19/771 (2%)

Query: 25  MGFIILFYAI--FGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
           M   +L   +               V+ I + G   V    + S +PV VG++++D    
Sbjct: 1   MKKNLLAGLLATLFACGATAMEPFTVKDIRVEGIQRVEAGTVFSYLPVKVGETMTDEKAA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
            A+K ++A G+F +V+I++  SVLI+ L ER  I  + F G      DQL   ++     
Sbjct: 61  QAIKALFATGFFKDVRIEVDGSVLIVVLEERPAIAQIDFVGLKEFDKDQLLKGLKEVGIA 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
           ++  +D  T+      +K+ Y + G   V +      +    + I + I+EG  A+I  I
Sbjct: 121 ASRTFDRATLEKAEQELKRQYLARGRYAVAITTTITPLDRNRVAINFNIDEGEAARIKQI 180

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
             VG + +    L  V+     +    + K+D YSK+++S D E +R++Y DRGY    V
Sbjct: 181 NIVGAQAFKEKELVGVMQLRTPNWISWYTKSDQYSKQKLSADLETLRSYYLDRGYLEFSV 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        + I          + +    +    + ++     ++I++G++++ ++
Sbjct: 241 ESTQVSISPDKKDIYITVSINEGERFMVSSVKLAGELILSEEEFRKAVKIKAGDVFSREK 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           + ES++ I+    +    F  V      D  KR V     +D G   YV+R+ I GN ++
Sbjct: 301 LNESTKAIADKLGAQGYAFANVNAAPELDKEKRQVAFTIFVDPGKRAYVRRVNITGNTKT 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D VIR+E+   EG   +   +  ++ RI  TGYF+EVN+   P     D V + V+V +
Sbjct: 361 RDEVIRQEMRQMEGAWYDAERVSASRERIDRTGYFAEVNVETPPVPGTIDLVDVNVNVTE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ---NYTFSVEDP 495
            S G++ I   Y   + + + G I  +N FG G    L    G+       NYT      
Sbjct: 421 KSTGNISIGAGYSSAEKVILSGSISQSNIFGSGKFLSLQVNTGKLNRTLGINYTNPYFTV 480

Query: 496 YFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG---A 552
             +                  +   +     +R   PI E  + S    +          
Sbjct: 481 DGISQGFDLYDRKLNPTSLGYAFQSHSTGGGIRFGFPIDEKDTLSVGLAVDQTTIDITPI 540

Query: 553 ISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQ 612
                 +  I           +   +     +T ++ I    G +  +  ++A  G D  
Sbjct: 541 TPGVTPVQYIKFQAEHGDSNITVPATVGWTRDTRNSSIYTTSGGIQRAGLEWAIPGADLT 600

Query: 613 YHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGI 672
           ++R+  +   F+ L+ D  ++ +  FGY   +   + L  +  F       +RG+    +
Sbjct: 601 FYRLTYQNQQFFSLAKDVVLMLNAEFGYANGLQ-GQTLPFYKNFFAGGVNSVRGYDTASL 659

Query: 673 GPR--VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKL 730
           GP    +    +GG   +  +A +  P+P + +    R   F D+  ++ ++ A+     
Sbjct: 660 GPVEITNPDTRLGGTRKAVFNAEILMPIPGMDKA--FRIGPFFDAGNVFTDNNAV--PSY 715

Query: 731 EGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             +    R S G+   W SPLG +   YG PL  +  DK+Q+F F++G   
Sbjct: 716 TYSKEGLRYSAGLAAAWISPLGPLKFSYGQPLNEQSNDKLQKFQFQLGTTF 766


>gi|290512379|ref|ZP_06551746.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           sp. 1_1_55]
 gi|289775374|gb|EFD83375.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           sp. 1_1_55]
          Length = 807

 Score =  384 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 175/799 (21%), Positives = 316/799 (39%), Gaps = 50/799 (6%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           I+   +     +Y + +  V  I   G   V     L  +P+  G +++  D+  AV+ +
Sbjct: 7   IISGLLIAPLTLYAATSYQVDDIRFEGLQRVTVGAALLSMPLHAGDAVTPEDVSEAVRAL 66

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYD 145
           YA G F NV+I      L++ + ER  I  + FSGN ++KDD LK  +      + +A D
Sbjct: 67  YASGNFENVQILRDGKTLVVQVKERPTIASVSFSGNKSVKDDALKENLTASGISAGSALD 126

Query: 146 EDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK 205
            ++++     ++  Y S G  +  V      +    +++T+V +EG+ AKI  I  +GN+
Sbjct: 127 RNSLSEIEKGLQDFYYSAGKYSAQVHAVVTPLPRNRVDLTFVFQEGISAKIAQINIIGNQ 186

Query: 206 NYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLF 264
            +    L   +       +++      Y K+++    E +R+FY DRGYA   + S  + 
Sbjct: 187 AFREETLLDQLQLRDNVPWWNVVADKKYQKQKLEAALETLRSFYLDRGYARFAIESTQVS 246

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
                  + I            + +  +         + +L +  +G  Y+  ++     
Sbjct: 247 MTPDKKSLYITIALNEGERYRVDRTQVTGDLAQHGPEIEALAQPLAGAWYSGAQVTTVEN 306

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
           +I K F      + +V T    D A   V +   ++ G    V++I   GND S D+V+R
Sbjct: 307 EIKKRFGKYGYAWPQVTTTPEIDDAHHRVALHIQVNAGRRYSVRQIRFSGNDTSRDAVLR 366

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           RE+   EG  +N   +E+ K R+  TG+F  V    +P +  +D V +   VK+ + GS 
Sbjct: 367 REMRQMEGAWLNNEKVEQGKVRLDRTGFFENVEQQIVPVSGTADQVDVVYKVKERNTGSF 426

Query: 445 GIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFLGS 500
            +   +  D G+  +  +  +N+ G G           +                     
Sbjct: 427 NVGLGFGTDSGVSYQLGVTQDNWLGTGNSVSFNGTRNSYQSYLELGATNPWFTVDGISLG 486

Query: 501 PISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
                     +  + GS +         +  PI+E+ S +   D    +   +  +    
Sbjct: 487 GKIFYNSYDASDADAGSYNQQSYGLGSTLGFPISENNSLNLGLDYVHNRLTNMDPELTTW 546

Query: 561 SI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
                                    + + +S    YN LD    PR G   S S      
Sbjct: 547 RYLSSRGIEPSVVTKDGDSGAKYSANDYFVSLGWGYNDLDRGFFPRAGNKSSLSGKVTLP 606

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G D+ Y+++    + +  LS++   V    LR GY   +   K++  +D F    +  +R
Sbjct: 607 GSDNSYYKLSFDTAQYLPLSENKRWVWMERLRAGYAGGL-DGKSVPFYDNFYAGGSSSVR 665

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           GF+   IGP+                       A+GG   +  ++    P P V ++   
Sbjct: 666 GFSSNTIGPKAAYYRCNGSESSYSACPLDASSDAVGGNAMAVLNSEFIIPTPFVNDKYAD 725

Query: 706 GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            LR + FVD+ T+++      A  L       G+    R+S G+ + W SPLG +   + 
Sbjct: 726 SLRTSLFVDAGTVWSTSWQNTAQTLAAGIPDYGDPGHIRLSAGIAVQWMSPLGPLVFSWA 785

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P +  +GDK +QF F IG
Sbjct: 786 EPFKKYDGDKAEQFQFNIG 804


>gi|238892540|ref|YP_002917274.1| outer membrane protein assembly factor YaeT [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238544856|dbj|BAH61207.1| putative outer membrane antigen [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 807

 Score =  384 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 177/799 (22%), Positives = 318/799 (39%), Gaps = 50/799 (6%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           I+   +     +Y + +  V  I   G   V     L  +P+  G +++  D+  AV+ +
Sbjct: 7   IISGLLIAPLTLYAATSYQVDDIRFEGLQRVTVGAALLSMPLHAGDAVTPEDVSEAVRAL 66

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYD 145
           YA G F NV+I      L++ + ER  I  + FSGN  +KDD LK  +      + +A D
Sbjct: 67  YASGNFENVQILRDGKTLVVQVKERPTIASVSFSGNKAVKDDALKENLTASGISAGSALD 126

Query: 146 EDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK 205
            ++++     ++  Y S G  +  V      +    +++T+V +EG+ AKI  I  +GN+
Sbjct: 127 RNSLSEIEKGLQDFYYSAGKYSAQVHAVVTPLPRNRVDLTFVFQEGISAKIAQINIIGNQ 186

Query: 206 NYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLF 264
            +    L   +       +++      Y K+++  D E +R+FY DRGYA   + S  + 
Sbjct: 187 AFREETLLDQLQLRDNVPWWNVVADKKYQKQKLEADLETLRSFYLDRGYARFAIESTQVS 246

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
                  + I            + +  +         + +L +  +G  Y+  ++     
Sbjct: 247 MTPDKKSLYITIALNEGERYRVDRTQVTGDLAQHGPEIEALAQPLAGAWYSGAQVTTVEN 306

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
           +I K+F      + +V T    D A   V +   ++ G    V++I   GND S D+V+R
Sbjct: 307 EIKKHFGKYGYAWPQVTTTPEIDDAHHRVVLHIQVNAGRRYSVRQIRFSGNDTSRDAVLR 366

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           RE+   EG  +N   +++ K R+  TG+F  V    +P N  +D V +   VK+ + GS 
Sbjct: 367 REMRQMEGAWLNNEKVDQGKVRLDRTGFFENVEQQIVPVNGTADQVDVVYKVKERNTGSF 426

Query: 445 GIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFLGS 500
            +   +  D G+  +  +  +N+ G G           +                     
Sbjct: 427 NVGLGFGTDSGVSYQLGVTQDNWLGTGNSVSFNGTRNSYQSYLELGATNPWFTVDGISLG 486

Query: 501 PISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
                     +  + GS +         +  PI+E+ S +   D    +   +  +    
Sbjct: 487 GKIFYNSYDASDADAGSYNQQSYGLGSTLGFPISENNSLNLGLDYVHNRLTNMDPELTTW 546

Query: 561 SI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
                                    + + +S    YN LD    PR G   S S      
Sbjct: 547 RYLSSRGIEPSVVTKDGDSGAKYSANDYFVSLGWGYNDLDRGFFPRAGNKSSLSGKVTLP 606

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G D+ Y+++    + +  LS++   V    LR GY   +   K++  +D F    +  +R
Sbjct: 607 GSDNSYYKLSFDTAQYLPLSENKRWVWMERLRAGYAGGL-DGKSVPFYDNFYAGGSSSVR 665

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           GF+   IGP+                       A+GG   +  ++    P P V ++   
Sbjct: 666 GFSSNTIGPKAAYYRCNGSESSYSACPLDASSDAVGGNAMAVLNSEFIIPTPFVNDKYAD 725

Query: 706 GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            LR + FVD+ T+++      A  L       G+ S  R+S G+ + W SPLG +   + 
Sbjct: 726 SLRTSLFVDAGTVWSTSWHNTAQTLAAGIPDYGDPSHIRLSAGIAVQWMSPLGPLVFSWA 785

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P +  +GDK +QF F IG
Sbjct: 786 EPFKKYDGDKAEQFQFNIG 804


>gi|288937641|ref|YP_003441700.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           variicola At-22]
 gi|288892350|gb|ADC60668.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           variicola At-22]
          Length = 807

 Score =  384 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 176/799 (22%), Positives = 317/799 (39%), Gaps = 50/799 (6%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           I+   +     +Y + +  V  I   G   V     L  +P+  G +++  D+  AV+ +
Sbjct: 7   IISGLLIAPLTLYAATSYQVDDIRFEGLQRVTVGAALLSMPLHAGDAVTPEDVSEAVRAL 66

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYD 145
           YA G F NV+I      L++ + ER  I  + FSGN ++KDD LK  +      + +A D
Sbjct: 67  YASGNFENVQILRDGKTLVVQVKERPTIASVSFSGNKSVKDDALKENLTASGISAGSALD 126

Query: 146 EDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK 205
            ++++     ++  Y S G  +  V      +    +++T+V +EG+ AKI  I  +GN+
Sbjct: 127 RNSLSEIEKGLQDFYYSAGKYSAQVHAVVTPLPRNRVDLTFVFQEGISAKIAQINIIGNQ 186

Query: 206 NYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLF 264
            +    L   +       +++      Y K+++  D E +R+FY DRGYA   + S  + 
Sbjct: 187 AFREETLLDQLQLRDNVPWWNVVADKKYQKQKLEADLETLRSFYLDRGYARFAIESTQVS 246

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
                  + I            + +  +         + +L +  +G  Y+  ++     
Sbjct: 247 MTPDKKSLYITIALNEGERYRVDRTQVTGDLAQHGPEIEALAQPLAGAWYSGAQVTTVEN 306

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
           +I K F      + +V T    D A   V +   ++ G    V++I   GND S D+V+R
Sbjct: 307 EIKKRFGKYGYAWPQVTTTPEIDDAHHRVALHIQVNAGRRYSVRQIRFSGNDTSRDAVLR 366

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           RE+   EG  +N   +E+ K R+  TG+F  V    +P +  +D V +   VK+ + GS 
Sbjct: 367 REMRQMEGAWLNNEKVEQGKVRLDRTGFFENVEQQIVPVSGTADQVDVVYKVKERNTGSF 426

Query: 445 GIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFLGS 500
            +   +  D G+  +  +  +N+ G G           +                     
Sbjct: 427 NVGLGFGTDSGVSYQLGVTQDNWLGTGNSVSFNGTRNSYQSYLELGATNPWFTVDGISLG 486

Query: 501 PISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
                     +  + GS +         +  PI+E+ S +   D    +   +  +    
Sbjct: 487 GKIFYNSYDASDADAGSYNQQSYGLGSTLGFPISENNSLNLGLDYVHNRLTNMDPELTTW 546

Query: 561 SI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
                                    + + +S    YN LD    PR G   S S      
Sbjct: 547 RYLSSRGIEPSVVTKDGDSGAKYSANDYFVSLGWGYNDLDRGFFPRAGNKSSLSGKVTLP 606

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G D+ Y+++    + +  LS++   V    LR GY   +   K++  +D F    +  +R
Sbjct: 607 GSDNSYYKLSFDTAQYLPLSENKRWVWMERLRAGYAGGL-DGKSVPFYDNFYAGGSSSVR 665

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           GF+   IGP+                       A+GG   +  ++    P P V ++   
Sbjct: 666 GFSSNTIGPKAAYYRCNGSESSYSACPLDASSDAVGGNAMAVLNSEFIIPTPFVNDKYAD 725

Query: 706 GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            LR + FVD+ T+++      A  L       G+    R+S G+ + W SPLG +   + 
Sbjct: 726 SLRTSLFVDAGTVWSTSWQNTAQTLAAGIPDYGDPGHIRLSAGIAVQWMSPLGPLVFSWA 785

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P +  +GDK +QF F IG
Sbjct: 786 EPFKKYDGDKAEQFQFNIG 804


>gi|261379556|ref|ZP_05984129.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           subflava NJ9703]
 gi|284798030|gb|EFC53377.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           subflava NJ9703]
          Length = 800

 Score =  384 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 184/801 (22%), Positives = 346/801 (43%), Gaps = 43/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     +  LS +  ++   ++ I + G        + + +PV VG + +DA  +
Sbjct: 1   MKLNQIASALMVLSLSPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDNFNDARSE 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K +YA G+F +V+++ +D+ +++ +IER  I+ L  +G   L++D +K  +      
Sbjct: 60  EIIKKLYATGFFDDVRVETMDNQVLLTVIERPTISSLNITGAKMLQNDAIKKNLEAFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y S G  +V +      ++   ++I   IEEG   KI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLSRGKQSVQITPTVTKLARNRVSIDIAIEEGKSTKITDI 179

Query: 200 RFVGNKNYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  RL + +S      +    K++ +++++ + D E I  +Y + GY   ++
Sbjct: 180 SFEGNEVYSDRRLLKQMSLSEGGMWTWVTKSNQFNEQKFAQDMEKITNYYQNNGYFNFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EG+ +  GN+ I+    E+ K+ L  L+ ++ G  Y   
Sbjct: 240 LDTDIQTNEDKTKQTIKVTVSEGDRFRWGNVRIEGDTLEVPKEDLEKLLTMKPGKWYERA 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++  S E I          F  +  +   +     VD    +  G  +YV  I I GN++
Sbjct: 300 QMSNSLEAIQNRMGQAGYAFSEINVQPIPNAETHTVDFVLTVQPGRKIYVNEINITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D VIRREL   E  P + + ++R+K R+   GYF  V    +P  +  D V L +S+ 
Sbjct: 360 TRDEVIRRELRQMESAPYDSAKLQRSKERVELLGYFDNVQFDAVPVANTPDQVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G    L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVAQDNLFGTGKSVALRASRSKTTVNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDG---SLDINDESAAVRMIVPITESISTSFKYDLRFLQYG 551
           P  +                               +R+ +P+TE    +F      L   
Sbjct: 480 PDGVSLGYDIYGKTYDPRKASSSAKQYKTTTFGGGLRIGIPVTEYDRVNFGLAAERLTVN 539

Query: 552 AISEKEKIPSIYTTLI--------EHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYD 603
                 K  + +             + K   +  +     N  DN + P +G L   + +
Sbjct: 540 TYKGAPKRYADFINQYGKGNGNGVGNFKGWLYKGTIGWGRNKTDNALWPTRGYLTGVNGE 599

Query: 604 YAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYY 663
            A  G D QY+ +    ++F+ LS D  ++     GYG      K +  F+ F       
Sbjct: 600 IALPGSDLQYYTLTHNQTWFFPLSKDFTLMLGGEVGYGNGYGKTKTMPFFENFYGGGLGS 659

Query: 664 LRGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLY 719
           +RGF    +GP+V  +Y    + GG   ++ SA + FPMP + +   +R + F D+ +++
Sbjct: 660 VRGFESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGIKDSRTVRLSLFADAGSVW 719

Query: 720 ANH-------------------VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
            +                      +G        +  R S G  + W SPLG M   Y  
Sbjct: 720 DDKTYNDSSSNSYYTNGALQNVYGVGTTHKSTFKNELRYSAGAAVTWLSPLGPMKFSYAY 779

Query: 761 PLRHREGDKIQQFGFRIGNRM 781
           P++ +EGD+IQ+F F++G   
Sbjct: 780 PIKKKEGDEIQRFQFQLGTTF 800


>gi|330009092|ref|ZP_08306381.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           sp. MS 92-3]
 gi|328534970|gb|EGF61502.1| outer membrane protein assembly complex, YaeT protein [Klebsiella
           sp. MS 92-3]
          Length = 807

 Score =  384 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 176/799 (22%), Positives = 318/799 (39%), Gaps = 50/799 (6%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           I+   +     +Y + +  V  I   G   V     L  +P+  G +++  D+  AV+ +
Sbjct: 7   IISGLLIAPLTLYAATSYQVDDIRFEGLQRVTVGAALLSMPLHAGDAVTPEDVSEAVRAL 66

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYD 145
           YA G F NV+I      L++ + ER  I  + FSGN  +KDD LK  +      + +A D
Sbjct: 67  YASGNFENVQILRDGKTLVVQVKERPTIASVSFSGNKAVKDDALKENLTASGISAGSALD 126

Query: 146 EDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK 205
            ++++     ++  Y S G  +  V      +    +++T+V +EG+ AKI  I  +GN+
Sbjct: 127 RNSLSEIEKGLQDFYYSAGKYSAQVHAVVTPLPRNRVDLTFVFQEGISAKIAQINIIGNQ 186

Query: 206 NYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLF 264
            +    L   +       +++      Y K+++  D E +R+FY DRGYA   + S  + 
Sbjct: 187 AFREETLLDQLQLRDNVPWWNVVADKKYQKQKLEADLETLRSFYLDRGYARFAIESTQVS 246

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
                  + I            + +  +         + +L +  +G  Y+  ++     
Sbjct: 247 MTPDKKSLYITIALNEGERYRVDRTQVTGDLAQHGPEIEALAQPLAGAWYSGAQVTTVEN 306

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
           +I K+F      + +V +    D A   V +   ++ G    V++I   GND S D+V+R
Sbjct: 307 EIKKHFGKYGYAWPQVTSTPEIDDAHHRVVLHIQVNAGRRYSVRQIRFSGNDTSRDAVLR 366

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           RE+   EG  +N   +++ K R+  TG+F  V    +P N  +D V +   VK+ + GS 
Sbjct: 367 REMRQMEGAWLNNEKVDQGKVRLDRTGFFENVEQQIVPVNGTADQVDVVYKVKERNTGSF 426

Query: 445 GIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFLGS 500
            +   +  D G+  +  +  +N+ G G           +                     
Sbjct: 427 NVGLGFGTDSGVSYQLGVTQDNWLGTGNSVSFNGTRNSYQSYLELGATNPWFTVDGISLG 486

Query: 501 PISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
                     +  + GS +         +  PI+E+ S +   D    +   +  +    
Sbjct: 487 GKIFYNSYDASDADAGSYNQQSYGLGSTLGFPISENNSLNLGLDYVHNRLTNMDPELTTW 546

Query: 561 SI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
                                    + + +S    YN LD    PR G   S S      
Sbjct: 547 RYLSSRGIEPSVVTKDGDSGAKYSANDYFVSLGWGYNDLDRGFFPRAGNKSSLSGKVTLP 606

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G D+ Y+++    + +  LS++   V    LR GY   +   K++  +D F    +  +R
Sbjct: 607 GSDNSYYKLSFDTAQYLPLSENKRWVWMERLRAGYAGGL-DGKSVPFYDNFYAGGSSSVR 665

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           GF+   IGP+                       A+GG   +  ++    P P V ++   
Sbjct: 666 GFSSNTIGPKAAYYRCNGSESSYSACPLDASSDAVGGNAMAVLNSEFIIPTPFVNDKYAD 725

Query: 706 GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            LR + FVD+ T+++      A  L       G+ S  R+S G+ + W SPLG +   + 
Sbjct: 726 SLRTSLFVDAGTVWSTSWHNTAQTLAAGIPDYGDPSHIRLSAGIAVQWMSPLGPLVFSWA 785

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P +  +GDK +QF F IG
Sbjct: 786 EPFKKYDGDKAEQFQFNIG 804


>gi|262045526|ref|ZP_06018548.1| protective surface antigen D15 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259037219|gb|EEW38468.1| protective surface antigen D15 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 807

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 178/799 (22%), Positives = 319/799 (39%), Gaps = 50/799 (6%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           I+   +     +Y + +  V  I   G   V     L  +P+  G +++  D+  AV+ +
Sbjct: 7   IISGLLIAPLTLYAATSYQVDDIRFEGLQRVTVGAALLSMPLHAGDAVTPEDVSEAVRAL 66

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYD 145
           YA G F NV+I      L++ + ER  I  + FSGN  +KDD LK  +      + +A D
Sbjct: 67  YASGNFENVQILRDGKTLVVQVKERPTIASVSFSGNKAVKDDALKENLTASGISAGSALD 126

Query: 146 EDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK 205
            ++++     ++  Y S G  +  V      +    +++T+V +EG+ AKI  I  +GN+
Sbjct: 127 RNSLSEIEKGLQDFYYSEGKYSAQVHAMVTPLPRNRVDLTFVFQEGISAKIALINIIGNQ 186

Query: 206 NYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLF 264
            +    L   +       +++      Y K+++  D E +R+FY DRGYA   + S  + 
Sbjct: 187 AFREETLLDQLQLRDNVPWWNVVADKKYQKQKLEADLETLRSFYLDRGYARFAIESTQVS 246

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
                  + I            + +  +         + SL +  +G  Y+  ++     
Sbjct: 247 MTPDKKSLYITIALNEGERYRVDRTQVTGDLAQHGPEIESLAQPLAGAWYSGAQVTTVEN 306

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
           +I K+F      + +V T    D A   V +   ++ G    V++I   GND S D+V+R
Sbjct: 307 EIKKHFGKYGYAWPQVTTTPEIDDAHHRVVLHIQVNAGRRYSVRQIRFSGNDTSRDAVLR 366

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           RE+   EG  +N   +++ K R+  TG+F  V    +P N  +D V +   VK+ + GS 
Sbjct: 367 REMRQMEGAWLNNEKVDQGKVRLDRTGFFENVEQQIVPVNGTADQVDVVYKVKERNTGSF 426

Query: 445 GIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFLGS 500
            +   +  D G+  +  +  +N+ G G           +                     
Sbjct: 427 NVGLGFGTDSGVSYQLGVTQDNWLGTGNSVSFNGTRNSYQSYLELGATNPWFTVDGISLG 486

Query: 501 PISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
                     +  + GS +         +  PI+E+ S +   D    +   ++ +    
Sbjct: 487 GKIFYNSYDASDADAGSYNQQSYGLGSTLGFPISENNSLNLGLDYVHNRLTNMNPELTTW 546

Query: 561 SI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
                                    + + +S    YN LD    PR G   S S      
Sbjct: 547 RYLSSRGIEPSVVTKDGDSGAKYSANDYFVSLGWGYNDLDRGFFPRAGNKSSLSGKVTLP 606

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G D+ Y+++    + +  LS++   V    LR GY   +   K++  +D F    +  +R
Sbjct: 607 GSDNSYYKLSFDTAQYLPLSENKRWVWMERLRAGYAGGL-DGKSVPFYDNFYAGGSSSVR 665

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           GF+   IGP+                       A+GG   +  ++    P P V ++   
Sbjct: 666 GFSSNTIGPKAAYYRCNGSESSYSACPLDTSSDAVGGNAMAVLNSEFIIPTPFVNDKYAD 725

Query: 706 GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            LR + FVD+ T+++      A  L       G+ S  R+S G+ + W SPLG +   + 
Sbjct: 726 SLRTSLFVDAGTVWSTSWHNTAQTLAAGIPDYGDPSHIRLSAGIAVQWMSPLGPLVFSWA 785

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P +  +GDK +QF F IG
Sbjct: 786 EPFKKYDGDKAEQFQFNIG 804


>gi|152972928|ref|YP_001338074.1| outer membrane protein assembly factor YaeT [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|150957777|gb|ABR79807.1| putative outer membrane antigen [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 807

 Score =  383 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 176/799 (22%), Positives = 318/799 (39%), Gaps = 50/799 (6%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           I+   +     +Y + +  V  I   G   V     L  +P+  G +++  D+  AV+ +
Sbjct: 7   IISGLLITPLTLYAATSYQVDDIRFEGLQRVTVGAALLSMPLHAGDAVTPEDVSEAVRAL 66

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYD 145
           YA G F NV+I      L++ + ER  I  + FSGN  +KDD LK  +      + +A D
Sbjct: 67  YASGNFENVQILRDGKTLVVQVKERPTIASVSFSGNKAVKDDALKENLTASGISAGSALD 126

Query: 146 EDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK 205
            ++++     ++  Y S G  +  V      +    +++T+V +EG+ AKI  I  +GN+
Sbjct: 127 RNSLSEIEKGLQDFYYSAGKYSAQVHAVVTPLPRNRVDLTFVFQEGISAKIAQINIIGNQ 186

Query: 206 NYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLF 264
            +    L   +       +++      Y K+++  D E +R+FY DRGYA   + S  + 
Sbjct: 187 AFREETLLDQLQLRDNVPWWNVVADKKYQKQKLEADLETLRSFYLDRGYARFAIESTQVS 246

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
                  + I            + +  +         + +L +  +G  Y+  ++     
Sbjct: 247 MTPDKKSLYITIALNEGERYRVDRTQVTGDLAQHGPEIEALAQPLAGAWYSGAQVTTVEN 306

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
           +I K+F      + +V +    D A   V +   ++ G    V++I   GND S D+V+R
Sbjct: 307 EIKKHFGKYGYAWPQVTSTPEIDDAHHRVVLHIQVNAGRRYSVRQIRFSGNDTSRDAVLR 366

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           RE+   EG  +N   +++ K R+  TG+F  V    +P N  +D V +   VK+ + GS 
Sbjct: 367 REMRQMEGAWLNNEKVDQGKVRLDRTGFFENVEQQIVPVNGTADQVDVVYKVKERNTGSF 426

Query: 445 GIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFLGS 500
            +   +  D G+  +  +  +N+ G G           +                     
Sbjct: 427 NVGLGFGTDSGVSYQLGVTQDNWLGTGNSVSFNGTRNSYQSYLELGATNPWFTVDGISLG 486

Query: 501 PISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
                     +  + GS +         +  PI+E+ S +   D    +   +  +    
Sbjct: 487 GKIFYNSYDASDADAGSYNQQSYGLGSTLGFPISENNSLNLGLDYVHNRLTNMDPELTTW 546

Query: 561 SI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
                                    + + +S    YN LD    PR G   S S      
Sbjct: 547 RYLSSRGIEPSVVTKDGDSGAKYSANDYFVSLGWGYNDLDRGFFPRAGNKSSLSGKVTLP 606

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G D+ Y+++    + +  LS++   V    LR GY   +   K++  +D F    +  +R
Sbjct: 607 GSDNSYYKLSFDTAQYLPLSENKRWVWMERLRAGYAGGL-DGKSVPFYDNFYAGGSSSVR 665

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           GF+   IGP+                       A+GG   +  ++    P P V ++   
Sbjct: 666 GFSSNTIGPKAAYYRCNGSESSYSACPLDASSDAVGGNAMAVLNSEFIIPTPFVNDKYAD 725

Query: 706 GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            LR + FVD+ T+++      A  L       G+ S  R+S G+ + W SPLG +   + 
Sbjct: 726 SLRTSLFVDAGTVWSTSWHNTAQTLAAGIPDYGDPSHIRLSAGIAVQWMSPLGPLVFSWA 785

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P +  +GDK +QF F IG
Sbjct: 786 EPFKKYDGDKAEQFQFNIG 804


>gi|121729979|ref|ZP_01682397.1| surface antigen [Vibrio cholerae V52]
 gi|121628283|gb|EAX60795.1| surface antigen [Vibrio cholerae V52]
          Length = 803

 Score =  383 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 188/804 (23%), Positives = 320/804 (39%), Gaps = 46/804 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+L   +    +  G+   +V+ I+I G   V     L ++PV VG S+   D+ 
Sbjct: 1   MAMKQILLATLLATSVSANGAEKFVVQDIQIDGLQRVALGAALLKMPVRVGDSVDSQDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
           + +K +Y+ G F +VK+    + L++ + ER  I  + FSGN  +K++QLK  +     R
Sbjct: 61  NIIKALYSSGNFEDVKVLRDGNTLMVQVKERPTIASVSFSGNKAIKEEQLKQNLEASSIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ +S   L    ++     +++F   D Y K+ ++ D EA+R +Y DRGY   +V
Sbjct: 181 NFIGNQVFSDEELLSRFNLNVDVAWWNFLADDKYKKQVLAGDIEALRTYYLDRGYLKFQV 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K G  +   ++EGE YTV  +  +  L   ++    SLI    G  YN  
Sbjct: 241 DSTQVAISPDKKGVYITLNLNEGEPYTVSKVQFRGELMG-KEAEFTSLIPFEIGETYNGS 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            +    E + K        + +V+T    D  K+ V +   ++ G  +YV+ I   GN+ 
Sbjct: 300 AVTRLEESVKKVLGESGYAYPQVRTIPEFDDEKQQVSLVVHVEAGKRVYVRDIRFVGNNS 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RRE+   EG  +N   IE  K R+   G+F  V +  +      D V L  SVK
Sbjct: 360 TRDEVLRREMRQMEGSWLNSKDIETGKTRLNRLGFFETVEVQTVRVPGSEDQVDLVYSVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
           + ++G+V     Y  + G+  +  +  +NF G G R  + A    +         +  + 
Sbjct: 420 EANSGNVNFGVGYGTESGVSFQVGLQQDNFLGSGNRVGVNAMINDYQKNLTLEYRDPYWN 479

Query: 498 LG----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
           L              + +              ++    P  E     F       + G +
Sbjct: 480 LDGVSLGGKVFYNQFEASEAGIVDYTNESYGTSLTWGFPFDELNRFEFGIGYTHNKIGNL 539

Query: 554 SEKEKIPSIYTTLIEHGK------FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
           +   ++ +       +             I+ S   N L+N   P  G    + Y     
Sbjct: 540 TPYLQVENFLAAQASNIDSGGNLLTDDFDINLSWTRNALNNSYFPTAGNHQRAFYKMTVP 599

Query: 608 GGDSQYHRIGSRASYFYLLSDDS--DIVGSLRFGYGCVIPSNKN----LQLFDQFSVSSN 661
           G D+QY ++      ++ L+      ++   R GYG               ++ F     
Sbjct: 600 GSDAQYFKLQYDVRQYFPLTKKHEFTLLLRGRLGYGNGYGQTDGKDNLFPFYENFYAGGF 659

Query: 662 YYLRGFAYKGIGPR--------------VDKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
             LRGF     GP+                   ++GG   + AS  +  P P   E    
Sbjct: 660 TSLRGFGSNSAGPKAVYRDYSGSNNGSDTATDDSVGGNAIALASVELIVPTPFASEEARN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVY 757
            +R + F D A+++            G        + + +R S GV + W SP+G +   
Sbjct: 720 QIRTSIFYDMASVWDTEFDYRGKADYGNQYYYDYSDPTNYRSSYGVALQWVSPMGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
              P++  EGD  + F F IG   
Sbjct: 780 LAKPIKKYEGDDEEFFTFTIGRTF 803


>gi|160900372|ref|YP_001565954.1| outer membrane protein assembly complex protein YaeT [Delftia
           acidovorans SPH-1]
 gi|160365956|gb|ABX37569.1| outer membrane protein assembly complex, YaeT protein [Delftia
           acidovorans SPH-1]
          Length = 765

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 163/749 (21%), Positives = 309/749 (41%), Gaps = 18/749 (2%)

Query: 41  YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIK 100
           +      V+ I I G   V    + + IP+ VG    D     A+++++A+G F +++++
Sbjct: 27  WALEPFRVQDIRIEGLQRVEPGTVFASIPLRVGDQYDDDKGAAAIRSLFALGLFKDIRLE 86

Query: 101 IVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIK 157
              +VL++ + ER  I  + F+G      + L+  +          +D+   +     +K
Sbjct: 87  ANGNVLVVVVEERPTIAEVNFAGTKEFDKETLQKAMRDVGLAEGRPFDKALADRAEQELK 146

Query: 158 QAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS 217
           + Y +       V      I    +N+T+ + EG  A+IN I  VGNK +S + L+ +  
Sbjct: 147 RQYINRSLYGAEVVTTVTPIERNRVNLTFTVTEGDPARINEIHIVGNKAFSESTLKDLFD 206

Query: 218 IRTSGYF-SFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQ 276
             T  +   + K+D Y++ +++ D E +R++Y  RGY   +V S  +        + +  
Sbjct: 207 QDTGNWMSWYTKSDRYARNKLNADLETLRSYYLQRGYLEFRVDSTQVAISPDKQTISLTL 266

Query: 277 IDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERP 336
                   V +          +     SL++I+ G  YN  ++  +++  ++YF +    
Sbjct: 267 NIHEGERFVVSGVKLEGNYLDRDDEFKSLVKIKPGEPYNADQVTATTKAFTEYFGNFGFA 326

Query: 337 FVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPIN 396
           F RV+   + D A   V +    +     YV+RI + GN+++ D VIRRE    E    +
Sbjct: 327 FARVEAVPDIDRATNRVALVLHAEPSRRAYVRRINVSGNNRTRDEVIRREFRQYEASWYD 386

Query: 397 YSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGM 456
              I  ++ R+   G+F+EVN+         D V L +SV +   GS+ +   +   + +
Sbjct: 387 GDKIRLSRDRVDRLGFFTEVNVETQEVAGSPDQVDLVISVAEKPTGSLQLGAGFSSAEKV 446

Query: 457 GVEGHIDDNNFFGQGYRARLAAGFGRHAVQNY---TFSVEDPYFLGSPISAGFDLQKTHL 513
            +   I   N FG G    +     ++        T        +       +   + + 
Sbjct: 447 SLSFGIKQENVFGSGNYLGVDVNTSKYRRTMVLSTTDPYFTDTGISRTYDLYYRTDRPYY 506

Query: 514 EDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFS 573
           +D +  I     +VR  VP +E  +  F   +   +    +   +    Y     +   +
Sbjct: 507 DDAAYKIVTSGGSVRFGVPFSEIDTVYFGGGVERSEIKPGTYLPQAYKDYADKYGYAN-T 565

Query: 574 SHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIV 633
              ++     ++ D+ + P  G+    +      GG+++Y R   +   +  LS    + 
Sbjct: 566 GIPLTLGWSRDSRDSALAPNSGLYQRLN-TEWSVGGEARYVRANYQIQQYIPLSKKYTLA 624

Query: 634 GSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKY-AIGGKIYSSASA 692
            +   GYG  + + +   LF  F       +RGF    +GPR   +  A+GG    + +A
Sbjct: 625 LNGELGYGKGL-NGRPFPLFKNFFSGGLGSVRGFEQGSLGPRDSAENIALGGSKKVTLNA 683

Query: 693 AVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLG 752
               P P       LR   F+D   +Y  +          +    R STG+ I W SPLG
Sbjct: 684 EFMVPFPGAGNDRTLRLFTFLDVGNVYGANQNF-------DLGELRASTGLGISWISPLG 736

Query: 753 MMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
            + + +  P+R + GDKIQ+  F+IG   
Sbjct: 737 PLRLAFAQPIRKQTGDKIQRLQFQIGTSF 765


>gi|153213792|ref|ZP_01949000.1| surface antigen [Vibrio cholerae 1587]
 gi|153825338|ref|ZP_01978005.1| surface antigen [Vibrio cholerae MZO-2]
 gi|153831003|ref|ZP_01983670.1| surface antigen [Vibrio cholerae 623-39]
 gi|229513894|ref|ZP_04403356.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae TMA 21]
 gi|229522198|ref|ZP_04411615.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae TM 11079-80]
 gi|297580895|ref|ZP_06942820.1| surface antigen [Vibrio cholerae RC385]
 gi|124115716|gb|EAY34536.1| surface antigen [Vibrio cholerae 1587]
 gi|148873511|gb|EDL71646.1| surface antigen [Vibrio cholerae 623-39]
 gi|149741022|gb|EDM55091.1| surface antigen [Vibrio cholerae MZO-2]
 gi|229341123|gb|EEO06128.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae TM 11079-80]
 gi|229349075|gb|EEO14032.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae TMA 21]
 gi|297534721|gb|EFH73557.1| surface antigen [Vibrio cholerae RC385]
 gi|327484768|gb|AEA79175.1| surface antigen [Vibrio cholerae LMA3894-4]
          Length = 803

 Score =  382 bits (981), Expect = e-103,   Method: Composition-based stats.
 Identities = 188/804 (23%), Positives = 320/804 (39%), Gaps = 46/804 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+L   +    +  G+   +V+ I+I G   V     L ++PV VG S+   D+ 
Sbjct: 1   MAMKQILLATLLATSVSANGAEKFVVQDIQIDGLQRVALGAALLKMPVRVGDSVDSQDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
           + +K +Y+ G F +VK+    + L++ + ER  I  + FSGN  +K++QLK  +     R
Sbjct: 61  NIIKALYSSGNFEDVKVLRDGNTLMVQVKERPTIASVSFSGNKAIKEEQLKQNLEASSIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ +S   L    ++     +++F   D Y K+ ++ D EA+R +Y DRGY   +V
Sbjct: 181 NFIGNQVFSDEELLSRFNLNVDVAWWNFLADDKYKKQVLAGDIEALRTYYLDRGYLKFQV 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K G  +   ++EGE YTV  +  +  L   ++    SLI    G  YN  
Sbjct: 241 DSTQVAISPDKKGVYITLNLNEGEPYTVSKVQFRGELMG-KEAEFTSLIPFEIGETYNGS 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            +    E + K        + +V+T    D  K+ V +   ++ G  +YV+ I   GN+ 
Sbjct: 300 AVTRLEESVKKVLGESGYAYPQVRTIPEFDDEKQQVSLVVHVEAGKRVYVRDIRFVGNNS 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RRE+   EG  +N   IE  K R+   G+F  V +  +      D V L  SVK
Sbjct: 360 TRDEVLRREMRQMEGSWLNSKDIETGKTRLNRLGFFETVEVQTVRVPGSEDQVDLVYSVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
           + ++G+V     Y  + G+  +  +  +NF G G R  + A    +         +  + 
Sbjct: 420 EANSGNVNFGVGYGTESGVSFQVGLQQDNFLGSGNRVGVNAMINDYQKNLTLEYRDPYWN 479

Query: 498 LG----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
           L              + +              ++    P  E     F       + G +
Sbjct: 480 LDGVSLGGKVFYNQFEASEAGIVDYTNESYGTSLTWGFPFDELNRFEFGIGYTHNKIGNL 539

Query: 554 SEKEKIPSIYTTLIEHGK------FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
           +   ++ +       +             I+ S   N L+N   P  G    + Y     
Sbjct: 540 TPYLQVENFLAAQASNIDSGGNLLTDDFDINLSWTRNNLNNGYFPTAGNHQRAFYKMTVP 599

Query: 608 GGDSQYHRIGSRASYFYLLSDDS--DIVGSLRFGYGCVIPSNKN----LQLFDQFSVSSN 661
           G D+QY ++      ++ L+      ++   R GYG               ++ F     
Sbjct: 600 GSDAQYFKLQYDVRQYFPLTKKHEFTLLLRGRLGYGNGYGQTDGKDNLFPFYENFYAGGF 659

Query: 662 YYLRGFAYKGIGPRV--------------DKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
             LRGF     GP+                   ++GG   + AS  +  P P   E    
Sbjct: 660 TSLRGFGSNSAGPKAVYRDYSGSNNGSDTATDDSVGGNAIALASVELIVPTPFASEEARN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVY 757
            +R + F D A+++            G        + + +R S GV + W SP+G +   
Sbjct: 720 QIRTSIFYDMASVWDTEFDYRGKADYGNQYYYDYSDPTNYRSSYGVALQWVSPMGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
              P++  EGD  + F F IG   
Sbjct: 780 LAKPIKKYEGDDEEFFTFTIGRTF 803


>gi|15642250|ref|NP_231883.1| outer membrane protein assembly factor YaeT [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|147675293|ref|YP_001217767.1| outer membrane protein assembly factor YaeT [Vibrio cholerae O395]
 gi|153820170|ref|ZP_01972837.1| surface antigen [Vibrio cholerae NCTC 8457]
 gi|153823578|ref|ZP_01976245.1| surface antigen [Vibrio cholerae B33]
 gi|227082376|ref|YP_002810927.1| surface antigen [Vibrio cholerae M66-2]
 gi|229507674|ref|ZP_04397179.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae BX 330286]
 gi|229512131|ref|ZP_04401610.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae B33]
 gi|229519266|ref|ZP_04408709.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae RC9]
 gi|229607178|ref|YP_002877826.1| outer membrane protein assembly factor YaeT [Vibrio cholerae
           MJ-1236]
 gi|254849382|ref|ZP_05238732.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255747051|ref|ZP_05420996.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholera CIRS 101]
 gi|262161404|ref|ZP_06030514.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae INDRE 91/1]
 gi|262167725|ref|ZP_06035427.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae RC27]
 gi|298500373|ref|ZP_07010178.1| outer membrane protein assembly complex, YaeT protein [Vibrio
           cholerae MAK 757]
 gi|9656813|gb|AAF95396.1| surface antigen [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|126509288|gb|EAZ71882.1| surface antigen [Vibrio cholerae NCTC 8457]
 gi|126518894|gb|EAZ76117.1| surface antigen [Vibrio cholerae B33]
 gi|146317176|gb|ABQ21715.1| surface antigen [Vibrio cholerae O395]
 gi|227010264|gb|ACP06476.1| surface antigen [Vibrio cholerae M66-2]
 gi|227014148|gb|ACP10358.1| surface antigen [Vibrio cholerae O395]
 gi|229343955|gb|EEO08930.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae RC9]
 gi|229352096|gb|EEO17037.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae B33]
 gi|229355179|gb|EEO20100.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae BX 330286]
 gi|229369833|gb|ACQ60256.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae MJ-1236]
 gi|254845087|gb|EET23501.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255735453|gb|EET90853.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholera CIRS 101]
 gi|262023790|gb|EEY42489.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae RC27]
 gi|262028715|gb|EEY47369.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae INDRE 91/1]
 gi|297541066|gb|EFH77120.1| outer membrane protein assembly complex, YaeT protein [Vibrio
           cholerae MAK 757]
          Length = 803

 Score =  382 bits (981), Expect = e-103,   Method: Composition-based stats.
 Identities = 188/804 (23%), Positives = 320/804 (39%), Gaps = 46/804 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+L   +    +  G+   +V+ I+I G   V     L ++PV VG S+   D+ 
Sbjct: 1   MAMKQILLATLLATSVSANGAEKFVVQDIQIDGLQRVALGAALLKMPVRVGDSVDSQDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
           + +K +Y+ G F +VK+    + L++ + ER  I  + FSGN  +K++QLK  +     R
Sbjct: 61  NIIKALYSSGNFEDVKVLRDGNTLMVQVKERPTIASVSFSGNKAIKEEQLKQNLEASSIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ +S   L    ++     +++F   D Y K+ ++ D EA+R +Y DRGY   +V
Sbjct: 181 NFIGNQVFSDEELLSRFNLNVDVAWWNFLADDKYKKQVLAGDIEALRTYYLDRGYLKFQV 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K G  +   ++EGE YTV  +  +  L   ++    SLI    G  YN  
Sbjct: 241 DSTQVAISPDKKGVYITLNLNEGEPYTVSKVQFRGELMG-KEAEFTSLIPFEIGETYNGS 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            +    E + K        + +V+T    D  K+ V +   ++ G  +YV+ I   GN+ 
Sbjct: 300 AVTRLEESVKKVLGESGYAYPQVRTIPEFDDEKQQVSLVVHVEAGKRVYVRDIRFVGNNS 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RRE+   EG  +N   IE  K R+   G+F  V +  +      D V L  SVK
Sbjct: 360 TRDEVLRREMRQMEGSWLNSKDIETGKTRLNRLGFFETVEVQTVRVPGSEDQVDLVYSVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
           + ++G+V     Y  + G+  +  +  +NF G G R  + A    +         +  + 
Sbjct: 420 EANSGNVNFGVGYGTESGVSFQVGLQQDNFLGSGNRVGVNAMINDYQKNLTLEYRDPYWN 479

Query: 498 LG----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
           L              + +              ++    P  E     F       + G +
Sbjct: 480 LDGVSLGGKVFYNQFEASEAGIVDYTNESYGTSLTWGFPFDELNRFEFGIGYTHNKIGNL 539

Query: 554 SEKEKIPSIYTTLIEHGK------FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
           +   ++ +       +             I+ S   N L+N   P  G    + Y     
Sbjct: 540 TPYLQVENFLAAQASNIDSGGNLLTDDFDINLSWTRNNLNNSYFPTAGNHQRAFYKMTVP 599

Query: 608 GGDSQYHRIGSRASYFYLLSDDS--DIVGSLRFGYGCVIPSNKN----LQLFDQFSVSSN 661
           G D+QY ++      ++ L+      ++   R GYG               ++ F     
Sbjct: 600 GSDAQYFKLQYDVRQYFPLTKKHEFTLLLRGRLGYGNGYGQTDGKDNLFPFYENFYAGGF 659

Query: 662 YYLRGFAYKGIGPRV--------------DKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
             LRGF     GP+                   ++GG   + AS  +  P P   E    
Sbjct: 660 TSLRGFGSNSAGPKAVYRDYSGSNNGSDTATDDSVGGNAIALASVELIVPTPFASEEARN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVY 757
            +R + F D A+++            G        + + +R S GV + W SP+G +   
Sbjct: 720 QIRTSIFYDMASVWDTEFDYRGKADYGNQYYYDYSDPTNYRSSYGVALQWVSPMGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
              P++  EGD  + F F IG   
Sbjct: 780 LAKPIKKYEGDDEEFFTFTIGRTF 803


>gi|325143196|gb|EGC65536.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis 961-5945]
          Length = 797

 Score =  382 bits (981), Expect = e-103,   Method: Composition-based stats.
 Identities = 184/798 (23%), Positives = 347/798 (43%), Gaps = 40/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG + +D    
Sbjct: 1   MKLKQIASALMVLGISPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +      
Sbjct: 60  AIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKITDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   ++
Sbjct: 180 EFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EGE +  G +SI+    E+ K  L  L+ ++ G  Y  Q
Sbjct: 240 LDTDIQTNEDKTKQTIKITVHEGERFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++     +I     S    +  +  +   +   + VD    I+ G  +YV  I I GN++
Sbjct: 300 QMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S+ 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQYG 551
              +                  S+     +   A +RM VP+TE    +F      L   
Sbjct: 480 ADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             ++  K  + +         +  S        +     N  D+ + P +G L   + + 
Sbjct: 540 TYNKAPKHYADFIKKYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G   QY+      ++F+ LS    ++     GY       K +  F+ F       +
Sbjct: 600 ALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWD 719

Query: 721 -----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                            N    G        +  R S G  + W SPLG M   Y  PL+
Sbjct: 720 GKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLK 779

Query: 764 HREGDKIQQFGFRIGNRM 781
            +  D+IQ+F F++G   
Sbjct: 780 KKPEDEIQRFQFQLGTTF 797


>gi|241204511|ref|YP_002975607.1| outer membrane protein assembly complex, YaeT protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858401|gb|ACS56068.1| outer membrane protein assembly complex, YaeT protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 780

 Score =  382 bits (981), Expect = e-103,   Method: Composition-based stats.
 Identities = 282/780 (36%), Positives = 455/780 (58%), Gaps = 7/780 (0%)

Query: 7   DFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILS 66
           + +   + L      +     +          +   +  ++++RI++RGA+ VG E + S
Sbjct: 3   EMKAGSKFLNAVSAVALSASVVASGAGALTFVSATAAEAAVIQRIDVRGASRVGAEAVRS 62

Query: 67  RIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNN 126
            + +  G+S S++D+D +VK +Y  GYFS+VKI +  S L++++ E +++N + F+GN  
Sbjct: 63  NLTIAPGKSFSNSDIDASVKQLYGTGYFSDVKISVSGSTLVVNVQEAQLVNQVVFNGNRK 122

Query: 127 LKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITY 186
           +KDD+L  IV++ +A  Y +  + AD+ +IK+AYA+ G   V V  Q   +    +N+ +
Sbjct: 123 IKDDKLATIVQTHAAGPYSDTQIQADIQSIKEAYAATGRSEVEVTTQVVPLGEGRVNLAF 182

Query: 187 VIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGY-FSFGKTDVYSKERMSFDEEAIR 245
           VI EG + KI+SI FVGN  YS  RL  VI+ + S +     + DVY+++++  DEEA+R
Sbjct: 183 VINEGDRTKIDSINFVGNNAYSAGRLAAVIATKRSNFLSFLTRKDVYNEDKLHADEEALR 242

Query: 246 AFYHDRGYAAVKVSSQVLFDKQ-KSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLS 304
            FY++RGYA +++ S         + Y L F I+EG+ Y  G +++QST++ +  + L  
Sbjct: 243 QFYYNRGYADMRIVSSDATFDDATNKYTLTFNIEEGQRYDFGPVTVQSTVEGVGSEQLQP 302

Query: 305 LIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSP 364
           L+R R G +YN +E+++S E IS    S   PF RV  R NRD     + +EYL+DQG  
Sbjct: 303 LVRTREGQVYNAKEVQKSIEAISDQVASAGYPFARVTPRGNRDLNNNTIGVEYLVDQGER 362

Query: 365 LYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAN 424
            YV+RIEI GN ++ D VIRRE ++SEGD  N  MI +AKRR+ A GYFS VNIS  P +
Sbjct: 363 AYVERIEIRGNSRTRDYVIRREFDMSEGDAFNQQMITKAKRRLEALGYFSSVNISTQPGS 422

Query: 425 DVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHA 484
                V++     Q +      A       G+ +E  I++ NF G+G   R++AG G+  
Sbjct: 423 SPDRVVVVVDVQDQSTGSFGVGAGYAAGGDGLLLEASIEEKNFLGRGQYIRISAGGGQEG 482

Query: 485 VQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYD 544
            + Y  S  +PYFLG  ++AGFD+ ++     + D + E  +V + V    +   +  + 
Sbjct: 483 SRAYGVSFTEPYFLGYRLAAGFDVNRSETS-SNDDYDYEETSVVLRVTAPITEDLATTFR 541

Query: 545 LRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDY 604
             + Q     +   + + Y  L++   ++  S+SQ++ YNTLD+ ++PR+G+  +++++ 
Sbjct: 542 YNYKQMKYDGDTSDLSATYANLVDESPWTRSSVSQTLTYNTLDDTVLPREGIYATATHEL 601

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           AG GGDSQ+++I  +A Y++LL+DD+DI+GS+    G V+P   +L +FDQF+++ N  +
Sbjct: 602 AGLGGDSQFYKIYGKARYYHLLADDADIIGSVSASAGYVVPLGDHLNVFDQFTLT-NGDI 660

Query: 665 RGFAYKGIGPRV--DKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANH 722
           RGF  KGIGPR+  D    +GG  Y +ASA  +FPMP  P    LRGA F D+ TL+ N 
Sbjct: 661 RGFENKGIGPRIRGDHDDPLGGTTYFTASAEATFPMPGFPRDFNLRGAVFADAGTLFGND 720

Query: 723 VA-LGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           V  LG+D+ +G  +  R S GV ++W SP G + + Y IP+   + DK Q F F I N+ 
Sbjct: 721 VELLGSDQADGTSASLRASVGVGVVWQSPFGALRLDYAIPVLKEDFDKTQNFKFGINNQF 780


>gi|260775277|ref|ZP_05884174.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608458|gb|EEX34623.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 801

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 172/801 (21%), Positives = 320/801 (39%), Gaps = 42/801 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+    +       G+   +V  I+I G   V     L ++PV +G ++ + D+ 
Sbjct: 1   MAMKKILFATLLATSVTANGAENFVVEDIQIDGLQRVALGAALLKMPVRIGDTVDNQDVS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K +YA G F ++K+    + L++ + ER  I ++ FSGN  +K++QL+  +     R
Sbjct: 61  EIIKALYASGNFEDIKVLRDGNQLLVQVKERPTIANISFSGNKAIKEEQLQQNLDASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVVTPLPRNRSDLKFVFSEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ ++   L    ++     +      D Y K+ ++ D EA++++Y DRGY   KV
Sbjct: 181 NFIGNEVFTDEELLSRFNLNVDVAWWNFLSDDKYQKQVLAGDIEALKSYYLDRGYLKFKV 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        V I       +               ++    +L+   SG++YN  +
Sbjct: 241 DSTQVAISPDKKGVYITLAVNEGLPYTVKDVKFRGELIGKEAEFEALVPFESGDVYNGSQ 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E + +        + +V+T    D   + V +   ++ G  +YV+ I   GN+ +
Sbjct: 301 VTSLEENVKRVLGEAGYAYPQVRTIPEFDDETQQVSLVVNVEAGKRIYVRDIRFVGNNAT 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +N   IE  K R+   GYF  V++  +      D V L  +VK+
Sbjct: 361 KDEVLRREMRQMEGSWLNSKSIETGKNRLNRLGYFETVDVQTVRVPGSEDQVDLVYNVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVEDP 495
            ++GSV     Y  + G+  +  +  +NF G G R  ++A    + ++   +Y     + 
Sbjct: 421 ANSGSVNFGIGYGTESGVSFQVGLQQDNFLGSGNRVGVSAMMNDYQKNVSLDYRDPYWNL 480

Query: 496 YFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMI-VPITESISTSFKYDLRFLQYGAIS 554
             +       ++  +          N+          P+ E  S  F       + G + 
Sbjct: 481 DGVSLGGKIFYNTFEASEAGIVDYTNESYGTSLTWGFPVNELNSLEFGIGYTHNKIGNVP 540

Query: 555 EKEKIPSIYTTLIEHGK---FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDS 611
             ++      ++ +       +   ++ S   N L+    P  G    +         D+
Sbjct: 541 TYDQAQLFAQSIGQPEGDIITNDFDLNISWTRNNLNRGFFPTAGNYQRAFAKATIPSSDA 600

Query: 612 QYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIP---SNKNL-QLFDQFSVSSNYYLR 665
           QY ++      +  ++   +       R GYG        N NL   ++ +       LR
Sbjct: 601 QYFKVQYDVRQYVPITKKHEFTLLMRGRLGYGNGYGQTDGNDNLFPFYENYYAGGFTSLR 660

Query: 666 GFAYKGIGPR----------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA--GL 707
           GF     GP+                     ++GG   + AS  +  P P   + A   +
Sbjct: 661 GFRSNSAGPKAVYTTNNGSCGNNGCVNATDDSVGGNAIALASMELIVPTPFASDEARSQI 720

Query: 708 RGAFFVDSATLYANHVALGAD-------KLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGI 760
           R + FVD+A+++    A  +        +   + + +R S G  + W SP+G +      
Sbjct: 721 RTSLFVDAASVWDTEFAYNSAYQGTQYYEDYSDPTNYRASYGAALQWMSPMGPLVFSIAK 780

Query: 761 PLRHREGDKIQQFGFRIGNRM 781
           P++  EGD  + F F IG   
Sbjct: 781 PIKIYEGDDEEFFTFTIGRTF 801


>gi|254805774|ref|YP_003083995.1| probable surface antigen [Neisseria meningitidis alpha14]
 gi|254669316|emb|CBA08329.1| probable surface antigen [Neisseria meningitidis alpha14]
 gi|325197469|gb|ADY92925.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis G2136]
          Length = 797

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 184/798 (23%), Positives = 347/798 (43%), Gaps = 40/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG + +D    
Sbjct: 1   MKLKQIASALMVLGISPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +      
Sbjct: 60  AIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKITDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   ++
Sbjct: 180 EFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EGE +  G +SI+    E+ K  L  L+ ++ G  Y  Q
Sbjct: 240 LDTDIQTNEDKTKQTIKITVHEGERFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++     +I     S    +  +  +   +   + VD    I+ G  +YV  I I GN++
Sbjct: 300 QMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S+ 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQYG 551
              +                  S+     +   A +RM VP+TE    +F      L   
Sbjct: 480 ADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             ++  K  + +         +  S        +     N  D+ + P +G L   + + 
Sbjct: 540 TYNKAPKHYADFIKQYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G   QY+      ++F+ LS    ++     GY       K +  F+ F       +
Sbjct: 600 ALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWD 719

Query: 721 -----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                            N    G        +  R S G  + W SPLG M   Y  PL+
Sbjct: 720 GKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLK 779

Query: 764 HREGDKIQQFGFRIGNRM 781
            +  D+IQ+F F++G   
Sbjct: 780 KKPEDEIQRFQFQLGTTF 797


>gi|28868748|ref|NP_791367.1| outer membrane protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213969126|ref|ZP_03397265.1| outer membrane protein [Pseudomonas syringae pv. tomato T1]
 gi|301383979|ref|ZP_07232397.1| outer membrane protein [Pseudomonas syringae pv. tomato Max13]
 gi|302064135|ref|ZP_07255676.1| outer membrane protein [Pseudomonas syringae pv. tomato K40]
 gi|302134062|ref|ZP_07260052.1| outer membrane protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28851987|gb|AAO55062.1| outer membrane protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213926124|gb|EEB59680.1| outer membrane protein [Pseudomonas syringae pv. tomato T1]
          Length = 795

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 172/796 (21%), Positives = 332/796 (41%), Gaps = 40/796 (5%)

Query: 25  MGFIILFYAIFGLSAV-YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDH 83
           M  ++L   +  L      + +  +  I + G   V    +   +P+ VG+   D  L  
Sbjct: 1   MKRLLLTAVLSALMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDGRLVD 60

Query: 84  AVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRS 140
           A ++++  G+F ++++    +VL+I+++ER  +  +   GN  +  + L   ++      
Sbjct: 61  ATRSLFKTGFFQDIQLGRDGNVLVINVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE 120

Query: 141 AAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIR 200
              +   T+    + +++ Y + G  +  V  +        + +   I EG  A I  I 
Sbjct: 121 GEIFQRATLEGVRNELQRQYVAQGRYSAEVDAEVVPQPRNRVGLKININEGTVASIQHIN 180

Query: 201 FVGNKNYSHARLERVISIRTSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVS 259
            VGN  +S   L  +  ++TS + SF K D  Y++E++S D E +R++Y DRGY  + ++
Sbjct: 181 VVGNTVFSDEDLTDLFELKTSNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA 240

Query: 260 SQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEI 319
           S  +        V I                 S   ++ +  + SL+ ++ G +++ + +
Sbjct: 241 STQVSITPDKKNVYITVNVNEGEKYSVKSVKLSGDLKVPEDQVKSLLLVQPGQVFSRKVM 300

Query: 320 KESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSY 379
             +SE I++   +    F  V      +     VDI +++D G   YV RI   GN +S 
Sbjct: 301 TTTSELITRRLGNEGYTFANVNGVPTPNNEDHTVDITFVVDPGKRAYVNRINYRGNTKSE 360

Query: 380 DSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQL 439
           D V+RRE+   EG   +  +I+++K R+   G+F EVN+   P     D V +  +V++ 
Sbjct: 361 DEVLRREMRQMEGGWASTYLIDQSKTRLDRLGFFKEVNVETPPVPGTDDQVDVNYAVEEQ 420

Query: 440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG 499
           ++GS+  +  +    G+ + G I  NNF G G +  +           Y FS  DPY+  
Sbjct: 421 ASGSITASVGFAQSAGLILGGSISQNNFLGTGNKVSIGL-TRSEYQSRYNFSYVDPYYTP 479

Query: 500 SPISAGFDLQKTHLEDGSLDINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAIS 554
             +S G+           LD++  S AV      + +    S ++   Y L   Q    +
Sbjct: 480 DGVSLGYSAFYRTTNYDDLDVDVASYAVDSLGAGINLGYPISETSRLTYGLTVQQDEIKT 539

Query: 555 EKEKIPSIYTTLIEHG-KFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQY 613
            +  +  I+  + + G K+ +   S     +TL+  ++  +G   S  ++    G D  +
Sbjct: 540 GRYTVDEIFDFVQKEGDKYLNFKGSIGWSESTLNKGVLATRGHSQSLVFESTLPGSDLSF 599

Query: 614 HRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIG 673
            ++  RA YF+ ++D+  +      GYG    S   L  ++ +       +RGF    +G
Sbjct: 600 FKLDYRAQYFHPITDNYTLRLHTELGYGDGYGSTSGLPFYENYYAGGFNSVRGFKDSTLG 659

Query: 674 PRVDKKYAI-------------------GGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
           PR      +                   GG         V FP+P + ++  LR + F D
Sbjct: 660 PRSTPSRGVAVTGNQGTDPDPDQDPLPFGGNALVQGGVEVMFPLPFIKDQRSLRTSVFWD 719

Query: 715 SATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHRE 766
              ++  +         G        + S    S G+ + W + LG +     +P++  +
Sbjct: 720 VGNVFDTNCDSTRTTASGKKVECNNIDLSGMASSVGIGVTWITALGPLSFALAMPIKKPD 779

Query: 767 GD-KIQQFGFRIGNRM 781
            + + Q F F +G   
Sbjct: 780 DEAETQVFQFSLGQTF 795


>gi|325129101|gb|EGC51950.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis N1568]
 gi|325203303|gb|ADY98756.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M01-240355]
 gi|325205275|gb|ADZ00728.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M04-240196]
          Length = 797

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 183/798 (22%), Positives = 346/798 (43%), Gaps = 40/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG + +D    
Sbjct: 1   MKLKQIASALMVLGISPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +      
Sbjct: 60  AIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKITDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   ++
Sbjct: 180 EFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EG  +  G +SI+    E+ K  L  L+ ++ G  Y  Q
Sbjct: 240 LDTDIQTNEDKTKQTIKITVHEGGRFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++     +I     S    +  +  +   +   + VD    I+ G  +YV  I I GN++
Sbjct: 300 QMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S+ 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQYG 551
              +                  S+     +   A +RM VP+TE    +F      L   
Sbjct: 480 ADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             ++  K  + +         +  S        +     N  D+ + P +G L   + + 
Sbjct: 540 TYNKAPKHYADFIKKYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G   QY+      ++F+ LS    ++     GY       K +  F+ F       +
Sbjct: 600 ALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWD 719

Query: 721 -----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                            N    G        +  R S G  + W SPLG M   Y  PL+
Sbjct: 720 GKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLK 779

Query: 764 HREGDKIQQFGFRIGNRM 781
            +  D+IQ+F F++G   
Sbjct: 780 KKPEDEIQRFQFQLGTTF 797


>gi|254225760|ref|ZP_04919365.1| surface antigen [Vibrio cholerae V51]
 gi|125621666|gb|EAZ49995.1| surface antigen [Vibrio cholerae V51]
          Length = 803

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 189/804 (23%), Positives = 323/804 (40%), Gaps = 46/804 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+L   +    +  G+   +V+ I+I G   V     L ++PV VG S+   D+ 
Sbjct: 1   MAMKQILLATLLATSVSANGAEKFVVQDIQIDGLQRVALGAALLKMPVRVGDSVDSQDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
           + +K +Y+ G F +VK+    + L++ + ER  I  + FSGN  +K++QLK  +     R
Sbjct: 61  NIIKALYSSGNFEDVKVLRDGNTLMVQVKERPTIASVSFSGNKAIKEEQLKQNLEASSIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ +S   L    ++     +++F   D Y K+ ++ D EA+R +Y DRGY   +V
Sbjct: 181 NFIGNQVFSDEELLSRFNLNVDVAWWNFLADDKYKKQVLAGDIEALRTYYLDRGYLKFQV 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K G  +   ++EGE YTV  +  +  L   ++    SLI    G  YN  
Sbjct: 241 DSTQVAISPDKKGVYITLNLNEGEPYTVSKVQFRGELMG-KEAEFTSLIPFEIGETYNGS 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            +    E + K        + +V+T    D  K+ V +   ++ G  +YV+ I   GN+ 
Sbjct: 300 AVTRLEESVKKVLGESGYAYPQVRTIPEFDDEKQQVSLVVHVEAGKRVYVRDIRFVGNNS 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RRE+   EG  +N   IE  K R+   G+F  V +  +      D V L  SVK
Sbjct: 360 TRDEVLRREMRQMEGSWLNSKDIETGKTRLNRLGFFETVEVQTVRVPGSEDQVDLVYSVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + ++G+V     Y  + G+  +  +  +NF G G R  + A    + ++    Y     +
Sbjct: 420 EANSGNVNFGVGYGTESGVSFQVGLQQDNFLGSGNRVGVNAMTNKYQKNLTLEYRDPYWN 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMI-VPITESISTSFKYDLRFLQYGAI 553
              +       ++  +          N+          P  E     F       + G +
Sbjct: 480 LDGVSLGGKVFYNQFEASEAGIVDYTNESYGTSLTWGFPFDELNRFEFGIGYTHNKIGNL 539

Query: 554 SEKEKIPSIYTTLIEHGK------FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
           +   ++ +       +             I+ S   N L+N   P  G    + Y     
Sbjct: 540 TPYLQVENFLAAQTSNIDSGGNLLTDDFDINLSWTRNNLNNGYFPTAGNHQRAFYKMTVP 599

Query: 608 GGDSQYHRIGSRASYFYLLSDDS--DIVGSLRFGYGCVIPSNKN----LQLFDQFSVSSN 661
           G D+QY ++      ++ L+      ++   R GYG               ++ F     
Sbjct: 600 GSDAQYFKLQYDVRQYFPLTKKHEFTLLLRGRLGYGNGYGQTDGKDNLFPFYENFYAGGF 659

Query: 662 YYLRGFAYKGIGPRV--------------DKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
             LRGF     GP+                   ++GG   + AS  +  P P   E    
Sbjct: 660 TSLRGFGSNSAGPKAVYRDYSGSNNGSDTATDDSVGGNAIALASVELIVPTPFASEEARN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVY 757
            +R + F D A+++            G        + + +R S GV + W SP+G +   
Sbjct: 720 QIRTSIFYDMASVWNTEFDYRGKADYGNQYYYDYSDPTNYRSSYGVALQWVSPMGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
              P++  EGD  + F F IG   
Sbjct: 780 LAKPIKKYEGDDEEFFTFTIGRTF 803


>gi|254286440|ref|ZP_04961397.1| surface antigen [Vibrio cholerae AM-19226]
 gi|150423389|gb|EDN15333.1| surface antigen [Vibrio cholerae AM-19226]
          Length = 803

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 188/804 (23%), Positives = 321/804 (39%), Gaps = 46/804 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+L   +    +  G+   +V+ I+I G   V     L ++PV VG S+   D+ 
Sbjct: 1   MAMKQILLATLLATSVSANGAEKFVVQDIQIDGLQRVALGAALLKMPVRVGDSVDSQDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
           + +K +Y+ G F +VK+    + L++ + ER  I  + FSGN  +K++QLK  +     R
Sbjct: 61  NIIKALYSSGNFEDVKVLRDGNTLMVQVKERPTIASVSFSGNKAIKEEQLKQNLEASSIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ +S   L    ++     +++F   D Y K+ ++ D EA+R +Y DRGY   +V
Sbjct: 181 NFIGNQVFSDEELLSRFNLNVDVAWWNFLADDKYKKQVLAGDIEALRTYYLDRGYLKFQV 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K G  +   ++EGE YTV  +  +  L   ++    SLI    G +YN  
Sbjct: 241 DSTQVAISPDKKGVYITLNLNEGEPYTVSKVQFRGELMG-KEAEFTSLIPFEIGEIYNGS 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            +    E + K        + +V+T    D  K+ V +   ++ G  +YV+ I   GN+ 
Sbjct: 300 AVTRLEESVKKVLGESGYAYPQVRTIPEFDDEKQQVSLVVHVEAGKRVYVRDIRFVGNNS 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RRE+   EG  +N   IE  K R+   G+F  V +  +      D V L  SVK
Sbjct: 360 TRDEVLRREMRQMEGSWLNSKDIETGKTRLNRLGFFETVEVQTVRVPGSEDQVDLVYSVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
           + ++G+V     Y  + G+  +  +  +NF G G R  + A    +         +  + 
Sbjct: 420 EANSGNVNFGVGYGTESGVSFQVGLQQDNFLGSGNRVGVNAMINDYQKNLTLEYRDPYWN 479

Query: 498 LG----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
           L              + +              ++    P  E     F       + G +
Sbjct: 480 LDGVSLGGKVFYNQFEASEAGIVDYTNESYGTSLTWGFPFDELNRFEFGIGYTHNKIGNL 539

Query: 554 SEKEKIPSIYTTLIEHGK------FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
           +   ++ +       +             I+ S   N L+N   P  G    + Y     
Sbjct: 540 TPYLQVENFLAAQASNIDSGGNLLTDDFDINLSWTRNNLNNGYFPTAGNHQRAFYKMTVP 599

Query: 608 GGDSQYHRIGSRASYFYLLSDDS--DIVGSLRFGYGCVIPSNKN----LQLFDQFSVSSN 661
           G D+QY ++      ++ L+      ++   R GYG               ++ F     
Sbjct: 600 GSDAQYFKLQYDVRQYFPLTKKHEFTLLLRGRLGYGNGYGQTDGKDNLFPFYENFYAGGF 659

Query: 662 YYLRGFAYKGIGPRV--------------DKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
             LRGF     GP+                   ++GG   + AS  +  P P   E    
Sbjct: 660 TSLRGFGSNSAGPKAVYRDYSGSNNGSDTATDDSVGGNAIALASVELIVPTPFASEEARN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVY 757
            +R + F D A+++            G        + + +R S GV + W SP+G +   
Sbjct: 720 QIRTSIFYDMASVWDTEFDYRGKADYGNQYYYDYSDPTNYRSSYGVALQWVSPMGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
              P++  EGD  + F F IG   
Sbjct: 780 LAKPIKKYEGDDEEFFTFTIGRTF 803


>gi|261391718|emb|CAX49167.1| outer-membrane protein assembly factor Omp85 [Neisseria
           meningitidis 8013]
 gi|325131039|gb|EGC53764.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis OX99.30304]
 gi|325135109|gb|EGC57736.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M13399]
 gi|325145379|gb|EGC67656.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M01-240013]
          Length = 797

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 183/798 (22%), Positives = 346/798 (43%), Gaps = 40/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG + +D    
Sbjct: 1   MKLKQIASALMVLGISPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +      
Sbjct: 60  AIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKITDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   ++
Sbjct: 180 EFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EG  +  G +SI+    E+ K  L  L+ ++ G  Y  Q
Sbjct: 240 LDTDIQTNEDKTKQTIKITVHEGGRFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++     +I     S    +  +  +   +   + VD    I+ G  +YV  I I GN++
Sbjct: 300 QMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S+ 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQYG 551
              +                  S+     +   A +RM VP+TE    +F      L   
Sbjct: 480 ADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             ++  K  + +         +  S        +     N  D+ + P +G L   + + 
Sbjct: 540 TYNKAPKHYADFIKQYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G   QY+      ++F+ LS    ++     GY       K +  F+ F       +
Sbjct: 600 ALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWD 719

Query: 721 -----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                            N    G        +  R S G  + W SPLG M   Y  PL+
Sbjct: 720 GKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLK 779

Query: 764 HREGDKIQQFGFRIGNRM 781
            +  D+IQ+F F++G   
Sbjct: 780 KKPEDEIQRFQFQLGTTF 797


>gi|229528745|ref|ZP_04418135.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae 12129(1)]
 gi|229332519|gb|EEN98005.1| outer membrane protein assembly factor YaeT precursor [Vibrio
           cholerae 12129(1)]
          Length = 803

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 189/804 (23%), Positives = 320/804 (39%), Gaps = 46/804 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+L   +    +  G+   +V+ I+I G   V     L +IPV VG S+   D+ 
Sbjct: 1   MAMKQILLATLLATSVSANGAEKFVVQDIQIDGLQRVALGAALLKIPVRVGDSVDSQDVA 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SR 139
           + +K +Y+ G F +VK+    + L++ + ER  I  + FSGN  +K++QLK  +     R
Sbjct: 61  NIIKALYSSGNFEDVKVLRDGNTLMVQVKERPTIASVSFSGNKAIKEEQLKQNLEASSIR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T++     ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLSNIEKGLEDFYYSVGKYNATVKAVVTPLPRNRADLKFVFTEGVSAKIQQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN+ +S   L    ++     +++F   D Y K+ ++ D EA+R +Y DRGY   +V
Sbjct: 181 NFIGNQVFSDEELLSRFNLNVDVAWWNFLADDKYKKQVLAGDIEALRTYYLDRGYLKFQV 240

Query: 259 SSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
            S        K G  +   ++EGE YTV  +  +  L   ++    SLI    G  YN  
Sbjct: 241 DSTQVAISPDKKGVYITLNLNEGEPYTVSKVQFRGELMG-KEAEFTSLIPFEIGETYNGS 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
            +    E + K        + +V+T    D  K+ V +   ++ G  +YV+ I   GN+ 
Sbjct: 300 AVTRLEESVKKVLGESGYAYPQVRTIPEFDDEKQQVSLVVHVEAGKRVYVRDIRFVGNNS 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RRE+   EG  +N   IE  K R+   G+F  V +  +      D V L  SVK
Sbjct: 360 TRDEVLRREMRQMEGSWLNSKDIETGKTRLNRLGFFETVEVQTVRVPGSEDQVDLVYSVK 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYF 497
           + ++G+V     Y  + G+  +  +  +NF G G R  + A    +         +  + 
Sbjct: 420 EANSGNVNFGVGYGTESGVSFQVGLQQDNFLGSGNRVGVNAMINDYQKNLTLEYRDPYWN 479

Query: 498 LG----SPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAI 553
           L              + +              ++    P  E     F       + G +
Sbjct: 480 LDGVSLGGKVFYNQFEASEAGIVDYTNESYGTSLTWGFPFDELNRFEFGIGYTHNKIGNL 539

Query: 554 SEKEKIPSIYTTLIEHGK------FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
           +   ++ +       +             I+ S   N L+N   P  G    + Y     
Sbjct: 540 TPYLQVENFLAAQASNIDSGGNLLTDDFDINLSWTRNNLNNGYFPTAGNHQRAFYKMTVP 599

Query: 608 GGDSQYHRIGSRASYFYLLSDDS--DIVGSLRFGYGCVIPSNKN----LQLFDQFSVSSN 661
           G D+QY ++      ++ L+      ++   R GYG               ++ F     
Sbjct: 600 GSDAQYFKLQYDVRQYFPLTKKHEFTLLLRGRLGYGNGYGQTDGKDNLFPFYENFYAGGF 659

Query: 662 YYLRGFAYKGIGPRV--------------DKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
             LRGF     GP+                   ++GG   + AS  +  P P   E    
Sbjct: 660 TSLRGFGSNSAGPKAVYRDYSGSNNGSDTATDDSVGGNAIALASVELIVPTPFASEEARN 719

Query: 706 GLRGAFFVDSATLYANHVALGADKLEG--------NDSFWRVSTGVEIMWNSPLGMMGVY 757
            +R + F D A+++            G        + + +R S GV + W SP+G +   
Sbjct: 720 QIRTSIFYDMASVWDTEFDYRGKADYGNQYYYDYSDPTNYRSSYGVALQWVSPMGPLVFS 779

Query: 758 YGIPLRHREGDKIQQFGFRIGNRM 781
              P++  EGD  + F F IG   
Sbjct: 780 LAKPIKKYEGDDEEFFTFTIGRTF 803


>gi|149374429|ref|ZP_01892203.1| Outer membrane protein/protective antigen OMA87 [Marinobacter
           algicola DG893]
 gi|149361132|gb|EDM49582.1| Outer membrane protein/protective antigen OMA87 [Marinobacter
           algicola DG893]
          Length = 772

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 168/755 (22%), Positives = 297/755 (39%), Gaps = 22/755 (2%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           ++   V  IE+ G   V    + S  PV +G+ + + +L  A+K+++  G F+++K    
Sbjct: 24  ADEFTVSDIEVEGLQRVSAGTVFSAFPVSIGEPVDEVELSDAIKDLFRTGLFTDIKASRD 83

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQA 159
             VLI+ + ER  I  +   GN N++   L   +     +    +   T+      I ++
Sbjct: 84  GGVLILTVQERPSITSIDIEGNKNIETPMLMDALSGAGLQEGQVFRRATLERLELEILRS 143

Query: 160 YASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-I 218
           Y S G  N  VK     +    + I   I EG  A I  I  VGN  +    L  +    
Sbjct: 144 YISQGRYNARVKATAEELPRNRVAIKLDINEGTVAAIQHINIVGNDAFDDETLLDLFELQ 203

Query: 219 RTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQID 278
            TS + S    D Y++ER+S D E++R+FY DRGY    V S  +        V I    
Sbjct: 204 TTSWWNSITSADKYARERLSGDLESLRSFYLDRGYIDFTVESSQVSISPDKKQVFIAISL 263

Query: 279 EGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFV 338
                   +         + ++ L  LI I  G++++   +   SE +S+        F 
Sbjct: 264 NEGPQYTVSDVNLRGELIVPEEELRELIPIEEGDVFSRSRMTAISEALSRRLGREGYAFA 323

Query: 339 RVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYS 398
            V              + + ++ G   YV+RI  +GN  + D V+R+E+   EG   +  
Sbjct: 324 NVNAVPEPADDN-TASVTFFVEPGKRAYVRRINFDGNVSTRDDVLRQEMTQMEGGVASTD 382

Query: 399 MIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGV 458
            IE +K ++   G+F  V++  +P     D V +  SV + + GS+  +  +    G+ +
Sbjct: 383 RIEFSKTKLERLGFFETVDVETVPVPGTDDLVDVNYSVAEQATGSLSASVGFSQASGVIL 442

Query: 459 EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLG--SPISAGFDLQKTHLEDG 516
             ++ +NNFFG G R                   +  Y +   S   + F  +    E  
Sbjct: 443 GANVSENNFFGSGKRVSFGVNVSDSIKSANFSYQDPYYTVDGVSRGFSVFARETDFEEQD 502

Query: 517 SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGK-FSSH 575
                 +    R+         T   + L +      +       + T + E G  F+++
Sbjct: 503 ISSYLLDEYGGRLTFGYPTDNITRLNFGLGYTLSKVKAGAFTSEEVKTFIDEEGNDFNNY 562

Query: 576 SISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGS 635
            +  S   +TL+  ++P  G  +S S D A  G D  ++++  +  ++  L+++   V  
Sbjct: 563 FLFGSWRRSTLNRGVLPTDGYSLSLSADVAVPGSDLTFYKLNQKTEFYQPLNENQTWVFR 622

Query: 636 LR--FGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV-------DKKYAIGGKI 686
            R   GYG        +  ++ F       +RG+    +GP               GG +
Sbjct: 623 ARSEIGYGDGYSGRSVMPFYEHFYAGGYGSVRGYEANSLGPLATNAPNDFSDPDPFGGSL 682

Query: 687 YSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIM 746
            +  S  + FP P   +   +R AFFVD+  ++                  R+S GV   
Sbjct: 683 LTEGSLELIFPTPFAGDTRSMRTAFFVDAGQVFDADRNFDPA-----LDEIRLSAGVGFQ 737

Query: 747 WNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
           W + +G +      PL  + GD  Q F F +G   
Sbjct: 738 WITAVGPLAFSLAKPLNDKSGDDTQVFQFSLGQTF 772



 Score = 66.3 bits (159), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 39/317 (12%), Positives = 94/317 (29%), Gaps = 17/317 (5%)

Query: 34  IFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDAD---LDHAV-KNIY 89
           +F   ++       V  + +RG   V +E +   IP+  G   S +    +  A+ + + 
Sbjct: 257 VFIAISLNEGPQYTVSDVNLRGELIVPEEELRELIPIEEGDVFSRSRMTAISEALSRRLG 316

Query: 90  AMGY-FSNVKIKIV---DSV--LIIDLIE--RKIINHLFFSGNNNLKDDQLKMIVRSRSA 141
             GY F+NV        D+   +   +    R  +  + F GN + +DD L+  +     
Sbjct: 317 REGYAFANVNAVPEPADDNTASVTFFVEPGKRAYVRRINFDGNVSTRDDVLRQEMTQMEG 376

Query: 142 AAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRF 201
                D +      +++     G+    V V+   +  T   +        +A  +    
Sbjct: 377 GVASTDRIEFSKTKLERL----GFFE-TVDVETVPVPGTDDLVDVNYSVAEQATGSLSAS 431

Query: 202 VGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQ 261
           VG    S   L   +S           +   +               +       +  S 
Sbjct: 432 VGFSQASGVILGANVSENNFFGSGKRVSFGVNVSDSIKSANFSYQDPYYTVDGVSRGFSV 491

Query: 262 VLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKE 321
              +       +   + +     +        +  +      +L ++++G   + +    
Sbjct: 492 FARETDFEEQDISSYLLDEYGGRLTFGYPTDNITRLNFGLGYTLSKVKAGAFTSEEVKTF 551

Query: 322 SSEKISKYFFSGERPFV 338
             E+ + +         
Sbjct: 552 IDEEGNDFNNYFLFGSW 568


>gi|328543719|ref|YP_004303828.1| Outer membrane protein assembly complex, YaeT protein [polymorphum
           gilvum SL003B-26A1]
 gi|326413463|gb|ADZ70526.1| Outer membrane protein assembly complex, YaeT protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 792

 Score =  382 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 196/766 (25%), Positives = 350/766 (45%), Gaps = 20/766 (2%)

Query: 35  FGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYF 94
           FG  AV  +  ++   I +RG   +  E ++S + +  G+S S AD+D ++K ++A G F
Sbjct: 28  FGPLAVSTAEAAVASAIVVRGNARIEDETVISYLTISRGRSYSAADVDESLKALFATGLF 87

Query: 95  SNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVH 154
            +V+I      L++ + E  +I+ + F GN  + D+ LK +VR+   +      V  DV 
Sbjct: 88  EDVRITTQGGTLVVTVTENPVISRISFEGNKRVSDETLKGVVRTTERSMLTRSKVETDVQ 147

Query: 155 NIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLER 214
           NI +AY   G     V  +        +++ + I EG K  +  I F+GN N+S  RL  
Sbjct: 148 NILEAYRRTGRYRASVDPKIIDRGNNRVDLVFEINEGDKTGVERITFIGNNNFSDRRLRE 207

Query: 215 VISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYV 272
           VI  R SG       TD Y  +R++ D+E +R FY+  GYA  ++ +     D++++ + 
Sbjct: 208 VIRTRQSGLLSWLRTTDTYDPDRLNADQELLRQFYYQHGYADFRIVAVSADLDREQNVFY 267

Query: 273 LIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFS 332
           + F +DEGE Y +G++ +Q++L  +  + L   +R +SG+ YN + ++++ E ++     
Sbjct: 268 VTFTLDEGEKYKIGDVEVQTSLSTVDPEALRRYLRTKSGDTYNSKRVEQTLEDLTLQVSE 327

Query: 333 GERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEG 392
               F  V+ R  RD+  R + + Y I++G   YV+RI + GND++ + VIRRE +L+EG
Sbjct: 328 EGYAFAEVRPRALRDYENRTISLVYNIEEGPRAYVERINVRGNDRTREYVIRREFDLAEG 387

Query: 393 DPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEV 452
           D  N  ++++A+RR+   G+F EV ++    +     +I     +Q +            
Sbjct: 388 DAFNRVLLDKAERRLRNLGFFKEVRVTTERGSAPDRVIINVTVEEQPTGEISFGVGYSTT 447

Query: 453 DKGMGVE--GHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQK 510
           D  +G       +                  +     +         +   +     +  
Sbjct: 448 DGIIGDVSLSEKNFLGRGQYVKIGAGGGTDTQSYEFVFREPFFMGRRIALDLEVYRRVYD 507

Query: 511 THLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYG-------AISEKEKIPSIY 563
            +      +          +    + ++    Y++   +          ++         
Sbjct: 508 ANDYRSYDEETTGGGIGFTLPLREDELALKVFYNIYETKISDPKGIAKNLATCPGSGLSN 567

Query: 564 TTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYF 623
                 G   +     ++ YNTLDN I P +G+      ++AG GGD+Q+ R  + A  +
Sbjct: 568 AVCDSLGSSLTSLAGYALFYNTLDNNIDPSEGIFAKFQQEFAGLGGDAQFIRTTAEARAY 627

Query: 624 YLLSDDSDIVGSLRFGYGCVIP-SNKNLQLFDQFSVSSNYYLRGFAYKGIGPRV---DKK 679
             +  D  +VGS+    G +    +K L++ DQF    +  +RGF  +GIGPR      +
Sbjct: 628 REVLPDMGLVGSVALRGGHIQAIGSKRLRVSDQFMFGGD-LVRGFENQGIGPRDMSTTNR 686

Query: 680 YAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVA----LGADKLEGNDS 735
            A+GG+ Y + S   +FP P++PE  GL GA F D+ +L+         +GA+ +  N  
Sbjct: 687 DALGGRFYVAGSVETTFPFPVIPEEFGLSGALFADAGSLWDADKDLVNIVGANNVASNGF 746

Query: 736 FWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
             R S G  I W SP G + V +  P+   + DK Q F    G + 
Sbjct: 747 ELRASVGAGIRWRSPFGPLRVDFAWPVMKEDSDKTQWFRLSGGTKF 792


>gi|254508665|ref|ZP_05120780.1| outer membrane protein assembly complex, YaeT protein [Vibrio
           parahaemolyticus 16]
 gi|219548422|gb|EED25432.1| outer membrane protein assembly complex, YaeT protein [Vibrio
           parahaemolyticus 16]
          Length = 802

 Score =  382 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 176/802 (21%), Positives = 321/802 (40%), Gaps = 43/802 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
             M  I+L  A+    +  G+ + +V+ I++ G   V     L ++PV +G ++ + D+ 
Sbjct: 1   MAMKKILLATALATSMSANGAESFVVQDIQVEGLQRVTLGAALLKMPVRIGDAVDNEDIS 60

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             ++ +YA G F ++K+   D+VL++ + ER  ++ + FSGN  +K++QL+  +     R
Sbjct: 61  QIIRALYASGNFEDIKVLRQDNVLVVQVKERPTVSSISFSGNKAIKEEQLQQNLDASGVR 120

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
              A D  T+      ++  Y S+G  N  VK     +     ++ +V  EGV AKI  I
Sbjct: 121 VGEALDRTTLANIEKGLEDFYYSVGKYNANVKAVVTPLPRNRADLKFVFSEGVSAKIKQI 180

Query: 200 RFVGNKNYSHARLERVISIRTSG-YFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F+GN  +S   L     +     +++F   D Y K+ ++ D EA++++Y DRGY   KV
Sbjct: 181 NFIGNDVFSDDELLGRFELNVDVAWWNFLSDDKYQKQVLAGDIEALKSYYLDRGYLKFKV 240

Query: 259 SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQE 318
            S  +        V I    E               + + +  L  LI    G LYN   
Sbjct: 241 DSTQVSISPDKKGVYITLGLEEGQPYSVKDVKFRGDRVVGEDELNDLISFEMGELYNGSA 300

Query: 319 IKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQS 378
           +    E + +        + +V+T    D   + V +   I+ G  +YV+ I   GN+ +
Sbjct: 301 VTSLEENVKRLLGEAGYAYPQVRTISEFDDETQEVSLVVNIEAGKRIYVRDIRFVGNNST 360

Query: 379 YDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438
            D V+RRE+   EG  +N   I+  K R+   G+F  V++  +      D V L  SVK+
Sbjct: 361 KDEVLRREMRQMEGSWLNSKAIDTGKSRLNRLGFFETVDVQTVRVPGSEDQVDLVYSVKE 420

Query: 439 LSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVEDP 495
            ++GSV     Y  + G+  +  +  +NF G G R  + A    + ++   +Y     + 
Sbjct: 421 ANSGSVNFGIGYGTESGVSFQVGLQQDNFIGTGNRVGINAMMNDYQKNVSLDYRDPYWNL 480

Query: 496 YFLGSPISAGFDLQKTHLE-DGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAIS 554
             +       ++  +               A++    P  E     F       + G + 
Sbjct: 481 DGVSLGGKIFYNQFEAKEAGIVDYTNESYGASLTWGFPFDELNRFEFGVGYTHNKIGNVP 540

Query: 555 EKEKIPSIYTTLIEHGK---FSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDS 611
             ++      ++ +       +   ++ S   N L+    P  G    +         D+
Sbjct: 541 TYDQAQLFAQSINQPDGDIITNDFDLNASWTRNNLNRGYFPTAGNYQRAFAKATVPSSDA 600

Query: 612 QYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIP---SNKNL-QLFDQFSVSSNYYLR 665
           QY ++     ++  L+   +       R GYG        N NL   ++ +       LR
Sbjct: 601 QYFKLQYDVRHYIPLTKKHEFTLLMRGRLGYGNGYGQTDGNDNLFPFYENYYAGGFTSLR 660

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPER--A 705
           GF     GP+                       ++GG   + AS  +  P P   +    
Sbjct: 661 GFRSNTAGPKAVYTINSNPSFCSSSSCVNSTDDSVGGNAVALASLELIVPTPFASDEVRN 720

Query: 706 GLRGAFFVDSATLYANHVALGADKLE------GNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            +R + F+D+A+++           +       + + +R S GV + W SP+G +     
Sbjct: 721 QIRTSMFLDAASVWDTEFVYDETITDRYYMDYSDPTNYRASYGVALQWMSPMGPLVFSVA 780

Query: 760 IPLRHREGDKIQQFGFRIGNRM 781
            P+   EGD  + F F IG   
Sbjct: 781 KPITIYEGDDEEFFTFTIGRTF 802


>gi|206576560|ref|YP_002240991.1| outer membrane protein, OMP85 family [Klebsiella pneumoniae 342]
 gi|206565618|gb|ACI07394.1| outer membrane protein, OMP85 family [Klebsiella pneumoniae 342]
          Length = 807

 Score =  382 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 176/799 (22%), Positives = 319/799 (39%), Gaps = 50/799 (6%)

Query: 29  ILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNI 88
           I+   +     +Y + +  V  I   G   V     L  +P+  G +++  D+  AV+ +
Sbjct: 7   IISGLLIAPLTLYAATSYQVDDIRFEGLQRVTVGAALLSMPLHAGDAVTPEDVSEAVRAL 66

Query: 89  YAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYD 145
           YA G F NV+I   +  L++ + ER  I  + FSGN ++KDD LK  +      + +A D
Sbjct: 67  YASGNFENVQILRDEKTLVVQVKERPTIASVSFSGNKSVKDDALKENLTASGISAGSALD 126

Query: 146 EDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK 205
            ++++     ++  Y S G  +  V      +    +++T+V +EG+ AKI  I  +GN+
Sbjct: 127 RNSLSEIEKGLQDFYYSAGKYSAQVHAVVTPLPRNRVDLTFVFQEGISAKIAQINIIGNQ 186

Query: 206 NYSHARLERVIS-IRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLF 264
            +    L   +       +++      Y K+++  D E +R+FY DRGYA   + S ++ 
Sbjct: 187 AFREETLLDQLQLRDNVPWWNVVADKKYQKQKLEADLETLRSFYLDRGYARFAIESTLVS 246

Query: 265 DKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSE 324
                  + I            + +  +         + +L +  +G  Y+  ++     
Sbjct: 247 MTPDKKSLYITIALNEGERYRVDRTQVTGDLAQHGPEIEALAQPLAGAWYSGAQVTTVEN 306

Query: 325 KISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIR 384
           +I K F      + +V T    D A   V +   ++ G    V++I   GND S D+V+R
Sbjct: 307 EIKKRFGKYGYAWPQVTTTPEIDDAHHRVALHIQVNAGRRYSVRQIRFSGNDTSRDAVLR 366

Query: 385 RELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSV 444
           RE+   EG  +N   +E+ K R+  TG+F  V    +P +  +D V +   VK+ + GS 
Sbjct: 367 REMRQMEGAWLNNEKVEQGKVRLDRTGFFENVEQQIVPVSGTADQVDVVYKVKERNTGSF 426

Query: 445 GIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQ----NYTFSVEDPYFLGS 500
            +   +  D G+  +  +  +N+ G G           +                     
Sbjct: 427 NVGLGFGTDSGVSYQLGVTQDNWLGTGNSVSFNGTRNSYQSYLELGATNPWFTVDGISLG 486

Query: 501 PISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIP 560
                     +  + GS +         +  PI+E+ S +   D    +   +  +    
Sbjct: 487 GKIFYNSYDASDADAGSYNQQSYGLGSTLGFPISENNSLNLGLDYVHNRLTNMDPELTTW 546

Query: 561 SI-------------YTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGF 607
                                    + + +S    YN LD    PR G   S S      
Sbjct: 547 RYLSSRGIEPSVVTKDGDSGAKYSANDYFVSLGWGYNDLDRGFFPRAGNKSSLSGKVTLP 606

Query: 608 GGDSQYHRIGSRASYFYLLSDDSDIVG--SLRFGYGCVIPSNKNLQLFDQFSVSSNYYLR 665
           G D+ Y+++    + +  LS++   V    LR GY   +   K++  +D F    +  +R
Sbjct: 607 GSDNSYYKLSFDTAQYLPLSENKRWVWMERLRAGYAGGL-DGKSVPFYDNFYAGGSSSVR 665

Query: 666 GFAYKGIGPR------------------VDKKYAIGGKIYSSASAAVSFPMPLVPERA-- 705
           GF+   IGP+                       A+GG   +  ++    P P V ++   
Sbjct: 666 GFSSNTIGPKAAYYRCNGSESSYSACPLDASSDAVGGNAMAVLNSEFIIPTPFVNDKYAD 725

Query: 706 GLRGAFFVDSATLYANHVALGADKL------EGNDSFWRVSTGVEIMWNSPLGMMGVYYG 759
            LR + FVD+ T+++      A  L       G+    R+S G+ + W SPLG +   + 
Sbjct: 726 SLRTSLFVDAGTVWSTSWQNTAQTLAAGIPDYGDPGHIRLSAGIAVQWMSPLGPLVFSWA 785

Query: 760 IPLRHREGDKIQQFGFRIG 778
            P +  +GDK +QF F IG
Sbjct: 786 EPFKKYDGDKAEQFQFNIG 804


>gi|304388986|ref|ZP_07371033.1| outer membrane protein assembly complex [Neisseria meningitidis
           ATCC 13091]
 gi|304337120|gb|EFM03307.1| outer membrane protein assembly complex [Neisseria meningitidis
           ATCC 13091]
          Length = 797

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 183/798 (22%), Positives = 347/798 (43%), Gaps = 40/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV +G + +D    
Sbjct: 1   MKLKQIASALMMLGISPLAFAD-FTIQDIRVEGLQRTEPSTVFNYLPVKIGDTYNDTHGS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +      
Sbjct: 60  AIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKITDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   ++
Sbjct: 180 EFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EGE +  G +SI+    E+ K  L  L+ ++ G  Y  Q
Sbjct: 240 LDTDIQTNEDKTKQTIKITVHEGERFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++     +I     S    +  +  +   +   + VD    I+ G  +YV  I I GN++
Sbjct: 300 QMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S+ 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQYG 551
              +                  S+     +   A +RM VP+TE    +F      L   
Sbjct: 480 ADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             ++  K  + +         +  S        +     N  D+ + P +G L   + + 
Sbjct: 540 TYNKAPKHYADFIKKYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G   QY+      ++F+ LS    ++     GY       K +  F+ F       +
Sbjct: 600 ALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWD 719

Query: 721 -----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                            N    G        +  R S G  + W SPLG M   Y  PL+
Sbjct: 720 GKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLK 779

Query: 764 HREGDKIQQFGFRIGNRM 781
            +  D+IQ+F F++G   
Sbjct: 780 KKPEDEIQRFQFQLGTTF 797


>gi|325133096|gb|EGC55768.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis M6190]
 gi|325139074|gb|EGC61620.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis ES14902]
          Length = 797

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 183/798 (22%), Positives = 346/798 (43%), Gaps = 40/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG + +D    
Sbjct: 1   MKLKQIASALMVLGISPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +      
Sbjct: 60  AIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKITDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   ++
Sbjct: 180 EFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EG  +  G +SI+    E+ K  L  L+ ++ G  Y  Q
Sbjct: 240 LDTDIQTNEDKTKQTIKITVHEGGRFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++     +I     S    +  +  +   +   + VD    I+ G  +YV  I I GN++
Sbjct: 300 QMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S+ 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQYG 551
              +                  S+     +   A +RM VP+TE    +F      L   
Sbjct: 480 ADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             ++  K  + +         +  S        +     N  D+ + P +G L   + + 
Sbjct: 540 TYNKAPKHYADFIKKYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G   QY+      ++F+ LS    ++     GY       K +  F+ F       +
Sbjct: 600 ALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEIGYANGYGKTKEIPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDVRTVRLSLFADAGSVWD 719

Query: 721 -----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                            N    G        +  R S G  + W SPLG M   Y  PL+
Sbjct: 720 GKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLK 779

Query: 764 HREGDKIQQFGFRIGNRM 781
            +  D+IQ+F F++G   
Sbjct: 780 KKPEDEIQRFQFQLGTTF 797


>gi|325141196|gb|EGC63696.1| outer membrane protein assembly complex, YaeT protein [Neisseria
           meningitidis CU385]
          Length = 797

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 183/798 (22%), Positives = 346/798 (43%), Gaps = 40/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG + +D    
Sbjct: 1   MKLKQIASALMVLGISPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +      
Sbjct: 60  AIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKITDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   ++
Sbjct: 180 EFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EGE +  G +SI+    E+ K  L  L+ ++ G  Y  Q
Sbjct: 240 LDTDIQTNEDKTKQTIKITVHEGERFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++     +I     S    +  +  +   +   + VD    I+ G  +YV  I I GN++
Sbjct: 300 QMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S+ 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQYG 551
              +                  S+     +   A +RM VP+TE    +F      L   
Sbjct: 480 ADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             ++  K  + +         +  S        +     N  D+ + P +G L   + + 
Sbjct: 540 TYNKAPKHYADFIKKYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G   QY+      ++F+ LS    ++     G        K +  F+ F       +
Sbjct: 600 ALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEVGIAGGYGKTKEIPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWD 719

Query: 721 -----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                            N    G        +  R S G  + W SPLG M   Y  PL+
Sbjct: 720 GKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLK 779

Query: 764 HREGDKIQQFGFRIGNRM 781
            +  D+IQ+F F++G   
Sbjct: 780 KKPEDEIQRFQFQLGTTF 797


>gi|307942150|ref|ZP_07657501.1| outer membrane protein assembly complex, YaeT protein [Roseibium
           sp. TrichSKD4]
 gi|307774436|gb|EFO33646.1| outer membrane protein assembly complex, YaeT protein [Roseibium
           sp. TrichSKD4]
          Length = 792

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 201/793 (25%), Positives = 350/793 (44%), Gaps = 20/793 (2%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +R+ +L       +  +    L  A     +   +  ++ R I +RG T + +E +LS 
Sbjct: 1   MQRLHKLKNTSLLAAALLCTTALMPAEIAPFSATVAEAAVARNIVVRGNTRIEEETVLSY 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           +    G+S S AD+D ++K ++A G F+ V IK     +++++ E  IIN + F GN  L
Sbjct: 61  LTFSRGRSYSAADVDESLKALFATGLFATVDIKQQGGTVVVEVTENPIINQVSFEGNKKL 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
            D  L+  VRS+         V +DV NI + Y   G  +  V+ +        +++ + 
Sbjct: 121 NDSSLETAVRSQPRTMLTRARVESDVQNILEGYRRSGRYDASVEPKIIDRGNNRVDLVFE 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTS-GYFSFGKTDVYSKERMSFDEEAIRA 246
           I EG K  +  I F+GNK++S  RL  VI  R S        TD Y  +R++ D+E +R 
Sbjct: 181 INEGDKTGVERISFIGNKSFSDGRLRDVIRTRESGFLSWLRSTDTYDPDRLAADQELLRQ 240

Query: 247 FYHDRGYAAVKVSSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           +Y+ +GYA  ++ S     D++++ + + F ++EGE Y  G++ I S++ ++    L S 
Sbjct: 241 YYNRKGYADFRIVSATADLDREQNIFYVTFTVEEGERYEFGDVEIVSSVPDVDANELYST 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           +R + G  ++   +++S E ++         F +++ R  RD+    + + Y I++G   
Sbjct: 301 LRTKPGKRFDSLRVEQSIEDLTLRVSEKGYAFAQIRPRALRDYENNTISLIYYIEEGPRA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           YV+RI + GND++ + VIRRE +L+EGD  N  +I++A+RR+   G+F  VNI+    + 
Sbjct: 361 YVERINVIGNDRTREYVIRREFDLAEGDAFNRVLIDKAERRLRNLGFFERVNITTSQGSA 420

Query: 426 VSDYVI---LRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGR 482
               ++   +        +  +G +T   V   + V                        
Sbjct: 421 SDRVIVNVEVMEKATGEVSFGLGYSTTDGVIGDISVSERNFLGRGQYVKLGVGRGESSQT 480

Query: 483 HAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFK 542
           +                   +               +         + +   E     F 
Sbjct: 481 YEFAFAEPFFMGRRIAFDVDAYRRVRDSNDYRSFDQETTGGGFGFTLPLREEELRLRLFY 540

Query: 543 YDLRFLQYGAISEKEKIPS------IYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGM 596
              +       +    + +              G++ +       IYNTL+  + P  G 
Sbjct: 541 KIFQEKNTDPNNTSTGVTNCNTADLSLAVCDSLGEYITSLAGYRFIYNTLNRNLNPTDGF 600

Query: 597 LISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQLFDQ 655
             +   ++AG GGDS Y +  + A  +  L  D  IVGS +   G +     + L++ +Q
Sbjct: 601 YAAFGQEFAGIGGDSTYIKSTAEARAYTELLPDWGIVGSAKIEGGHIYGIGDDRLRVSEQ 660

Query: 656 FSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVD 714
           F V     +RGF  +GIGPR      A+GG++Y + S   +FP P++PE  GL GA F D
Sbjct: 661 FMVGG-NIIRGFENQGIGPRDSKTGDALGGRMYIAGSLETTFPFPVIPEEFGLSGAVFAD 719

Query: 715 SATLYANHVAL------GADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGD 768
           + TL+     L      G +K+  ND   R S G  I W SP G + V +  P+   + D
Sbjct: 720 AGTLWDADDDLVKIVENGGNKVNSNDFDIRASVGAGIRWQSPFGPLRVDFAWPVMKNDKD 779

Query: 769 KIQQFGFRIGNRM 781
           + Q F    G R 
Sbjct: 780 ETQVFRLSGGTRF 792


>gi|77457336|ref|YP_346841.1| surface antigen (D15) [Pseudomonas fluorescens Pf0-1]
 gi|77381339|gb|ABA72852.1| putative surface exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 796

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 169/778 (21%), Positives = 320/778 (41%), Gaps = 40/778 (5%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           + +  +  I + G   V    +   +P+ VG+   D  L  + + ++  G+F ++++   
Sbjct: 20  AESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDRRLVESTRALFKTGFFQDIQLGRE 79

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVR---SRSAAAYDEDTVNADVHNIKQA 159
            +VL+I ++ER  +  +   GN  +  + L   ++         +   T+    + +++ 
Sbjct: 80  GNVLVITVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAEGEIFQRATLEGVRNELQRQ 139

Query: 160 YASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIR 219
           Y + G  +  V  +  S     + +   I EG  A I  I  VGN  +    L  +  ++
Sbjct: 140 YVAQGRYSATVDTEVVSQPRNRVGLKVKINEGTVAAIQHINVVGNTVFPEEDLTDLFELK 199

Query: 220 TSGYFSFGKTDV-YSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQID 278
           T+ + SF K D  Y++E++S D E +R++Y DRGY  + ++S  +       +V I    
Sbjct: 200 TTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIASTQVSITPDKKHVYITVNV 259

Query: 279 EGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFV 338
                        S   ++ +  + SL+ ++ G +++ + +  +SE I++   +    F 
Sbjct: 260 NEGEKYTVRDVKLSGDLKVPEDQVKSLLLVQKGQVFSRKLMTTTSELITRRLGNEGYTFA 319

Query: 339 RVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYS 398
            V            VDI + +D G   YV RI   GN +S D V+RRE+   EG   +  
Sbjct: 320 NVNGVPQPHDEDHTVDILFAVDPGKRAYVNRINFRGNTKSEDEVLRREMRQMEGGWASTY 379

Query: 399 MIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGV 458
           +I+++K R+   G+F EVN+       V D V +  SV++ ++GS+  +  +    G+ +
Sbjct: 380 LIDQSKTRLERLGFFKEVNVETPAVPGVDDQVDVNYSVEEQASGSITASVGFAQSAGLIL 439

Query: 459 EGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSL 518
            G I  NNF G G R  +           Y F   DPY+    +S G++      +   L
Sbjct: 440 GGSITQNNFLGTGNRVSVGL-TRSEYQSRYNFGYVDPYWTADGVSLGYNAFYRTTDYKDL 498

Query: 519 DINDESAAVR-----MIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHG-KF 572
           D++  S AV      + V    S ++   + L   Q    + +  +  I+  +   G  +
Sbjct: 499 DVDVASYAVDSLGAGVNVGYPISETSRLTFGLSAQQDKIKTGQYTVDEIFDFVKREGDNY 558

Query: 573 SSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDI 632
            +   S     +TL+  ++P +G   S + +    G D  + ++  R   F  LS++  +
Sbjct: 559 LNFKASAGWSESTLNKGVLPTRGRSQSLTLETTIPGSDLSFFKLDYRGQLFQPLSENYTM 618

Query: 633 VGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPR----------------- 675
                 GYG    S   L  ++ +       +RGF    +GPR                 
Sbjct: 619 RLHTELGYGDGYGSTDGLPFYENYYAGGFNSVRGFKDSTLGPRSTPSRGADVTGNAGTLR 678

Query: 676 --VDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGN 733
                    GG +       V FP+P V ++  LR + F D   ++ +      +   G+
Sbjct: 679 DPDQDPLPFGGNVLIQGGVEVLFPLPFVKDQRSLRTSVFWDVGNVFDSKCEKTTNATVGS 738

Query: 734 D----------SFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM 781
                      S    S GV + W + LG +     +P++  +  + Q F F +G   
Sbjct: 739 TSATQCNDISLSNMASSVGVGVTWVTALGPLSFALAMPIKKPDDAETQVFQFSLGQTF 796


>gi|319411332|emb|CBY91743.1| Outer-membrane protein assembly factor Omp85 [Neisseria
           meningitidis WUE 2594]
          Length = 811

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 183/800 (22%), Positives = 346/800 (43%), Gaps = 40/800 (5%)

Query: 21  RSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDAD 80
            + ++  I     + G+S +  ++   ++ I + G        + + +PV VG + +D  
Sbjct: 13  LTMKLKQIASALMMLGISPLAFAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTH 71

Query: 81  LDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---R 137
               +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +    
Sbjct: 72  GSAIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFG 131

Query: 138 SRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKIN 197
              +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI 
Sbjct: 132 LAQSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKIT 191

Query: 198 SIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAV 256
            I F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   
Sbjct: 192 DIEFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDF 251

Query: 257 KV-SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYN 315
           ++  + +  ++ K+   +   + EG  +  G +SI+    E+ K  L  L+ ++ G  Y 
Sbjct: 252 RILDTDIQTNEDKTKQTIKITVHEGGRFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYE 311

Query: 316 PQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGN 375
            Q++ E    I     S    +  +  +   +   + VD    I+ G  +YV  I I GN
Sbjct: 312 RQQMTEVLGAIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGN 371

Query: 376 DQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVS 435
           +++ D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S
Sbjct: 372 NKTRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMS 431

Query: 436 VKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSV 492
           + + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T   
Sbjct: 432 LTERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPY 491

Query: 493 EDPYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQ 549
                +                  S+     +   A +RM VP+TE    +F      L 
Sbjct: 492 FTADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLT 551

Query: 550 YGAISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSY 602
               ++  K  + +         +  S        +     N  D+ + P +G L   + 
Sbjct: 552 VNTYNKAPKHYADFIKKYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNA 611

Query: 603 DYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNY 662
           + A  G   QY+      ++F+ LS    ++     G        K +  F+ F      
Sbjct: 612 EIALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEVGIAGGYGRTKEIPFFENFYGGGLG 671

Query: 663 YLRGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATL 718
            +RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ ++
Sbjct: 672 SVRGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSV 731

Query: 719 YA-----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIP 761
           +                  N    G        +  R S G  + W SPLG M   Y  P
Sbjct: 732 WDGKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYP 791

Query: 762 LRHREGDKIQQFGFRIGNRM 781
           L+ +  D+IQ+F F++G   
Sbjct: 792 LKKKPEDEIQRFQFQLGTTF 811


>gi|319783664|ref|YP_004143140.1| outer membrane protein assembly complex, YaeT protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169552|gb|ADV13090.1| outer membrane protein assembly complex, YaeT protein
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 788

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 250/791 (31%), Positives = 414/791 (52%), Gaps = 20/791 (2%)

Query: 8   FRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSR 67
            +   + L      +     ++         A   +  ++V R+E+ G   +  E I + 
Sbjct: 1   MKAASKFLSAASAVTLSAAMVVPGALAVQFVATSAAEAAVVSRVEVSGNQRIDAETIRNY 60

Query: 68  IPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNL 127
           I +  G++ S +D+D AVK ++  G FS+V+I  V S L++ + E +++N + F  N  L
Sbjct: 61  ITIKPGKAFSSSDIDGAVKALFGTGLFSDVQINQVGSTLVVKVAEYQVVNQVLFQNNKKL 120

Query: 128 KDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYV 187
           KD+ L   V+ +    + + T++ADV ++K AY  IG  +V V  Q   +    +N+ + 
Sbjct: 121 KDNALAAAVQLKPRGTFSQATLDADVESVKAAYKRIGRDDVTVTTQVMQLGDNRVNVVFN 180

Query: 188 IEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFG-KTDVYSKERMSFDEEAIRA 246
           I EG + +I +I FVGN  YS  RL  +I+ + S + SF  + DVY  +++  D+E +R 
Sbjct: 181 IAEGDRTQIAAINFVGNSAYSSRRLSDIINTKRSSWVSFILRDDVYDDDKLRADQELLRR 240

Query: 247 FYHDRGYAAVKVSSQV-LFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSL 305
           FY++ GYA  +V S V   D   + Y +   + EG+ YT G++S++ST+ E+  K+L S+
Sbjct: 241 FYYNHGYADFQVVSAVGELDSATNKYTVTITVQEGDRYTFGDVSVESTIPEVDGKSLESV 300

Query: 306 IRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPL 365
           I    G++YN + +++S   +++        F +V  R +R+F    + + Y IDQG+  
Sbjct: 301 IETHKGDVYNAKNVEDSIIALTEKVAGSGYAFAQVTPRGDRNFENHTISVVYTIDQGTKA 360

Query: 366 YVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPAND 425
           Y++RIEI GND++ D VIRRE ++SEGD  N  +I+RAK+R+    YF +V+IS +P + 
Sbjct: 361 YIERIEIRGNDRTRDYVIRREFDVSEGDAFNQVLIQRAKKRLENLNYFEKVDISTVPGSQ 420

Query: 426 VSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF-GRHA 484
               V++   V++ +      A         G             G    +     G   
Sbjct: 421 PDQVVLVVDVVEKSTGEFSVGAGYSTGGDTAGPSVEGSVTERNFLGRGQFIKLSAGGGKN 480

Query: 485 VQNYTFSVEDPYFLGSPISAGFDLQK-THLEDGSLDINDESAAVRMIVPITESISTSFKY 543
            ++Y+ S  +PYFLG  I+AGFD+ K T   + + D +   A +R  +PIT+SI+T   Y
Sbjct: 481 SRDYSLSFTEPYFLGRRIAAGFDIYKSTREYNNNYDSDTTGATIRFGLPITDSITTQLAY 540

Query: 544 DLRFLQYGAIS-----------EKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVP 592
           ++   +Y                   I +     I+   +   S+S  ++YNT+D+   P
Sbjct: 541 NISQEKYKVDDGCLTDGVYIPGSPCNISTAILDGIDQSPWIKSSVSLGLVYNTIDDMKNP 600

Query: 593 RKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKN-LQ 651
            +G+  +++ + AG GGD+++ +I  R S +  LS+  D+VG +  G G V     + L+
Sbjct: 601 HEGIYANTTVEVAGLGGDAKFVKITGRGSVYQTLSESLDLVGLISGGAGHVEGYGSDGLR 660

Query: 652 LFDQFSVSSNYYLRGFAYKGIGPRVD-KKYAIGGKIYSSASAAVSFPMPLVPERAGLRGA 710
           +FDQF  + +  +RGFAY GIGP        +GG  Y +ASA   FP+P+VPE  GLRGA
Sbjct: 661 IFDQFQST-DRMIRGFAYGGIGPVDPLTGDHLGGTTYFNASAEAQFPLPVVPESFGLRGA 719

Query: 711 FFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKI 770
            F D+ATLY +   + +   E  D   R S GV +MW SP G + + Y IP++    D +
Sbjct: 720 VFADAATLYGS--KVTSVAQESTDMQLRASVGVGLMWASPFGPIRIDYAIPVKKEARDDV 777

Query: 771 QQFGFRIGNRM 781
           Q+F F I  R 
Sbjct: 778 QEFNFGISTRF 788


>gi|254670402|emb|CBA05945.1| probable surface antigen [Neisseria meningitidis alpha153]
 gi|254672758|emb|CBA06785.1| probable surface antigen [Neisseria meningitidis alpha275]
          Length = 797

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 182/798 (22%), Positives = 345/798 (43%), Gaps = 40/798 (5%)

Query: 23  FQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLD 82
            ++  I     + G+S +  ++   ++ I + G        + + +PV VG + +D    
Sbjct: 1   MKLKQIASALMVLGISPLALAD-FTIQDIRVEGLQRTEPSTVFNYLPVKVGDTYNDTHGS 59

Query: 83  HAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSR 139
             +K++YA G+F +V+++  D  L++ +IER  I  L  +G   L++D +K  +      
Sbjct: 60  AIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKMLQNDAIKKNLESFGLA 119

Query: 140 SAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSI 199
            +  +++ T+N  V  +K+ Y   G LN+ +  +   ++   ++I   I+EG  AKI  I
Sbjct: 120 QSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVDIDITIDEGKSAKITDI 179

Query: 200 RFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKV 258
            F GN+ YS  +L R +S+   G +++  +++ +++++ + D E +  FY + GY   ++
Sbjct: 180 EFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDMEKVTDFYQNNGYFDFRI 239

Query: 259 -SSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQ 317
             + +  ++ K+   +   + EG  +  G +SI+    E+ K  L  L+ ++ G  Y  Q
Sbjct: 240 LDTDIQTNEDKTKQTIKITVHEGGRFRWGKVSIEGDTNEVPKAELEKLLTMKPGKWYERQ 299

Query: 318 EIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQ 377
           ++     +I     S    +  +  +   +   + VD    I+ G  +YV  I I GN++
Sbjct: 300 QMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLHIEPGRKIYVNEIHITGNNK 359

Query: 378 SYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVK 437
           + D V+RREL   E  P + S ++R+K R+   GYF  V    +P     D V L +S+ 
Sbjct: 360 TRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQFDAVPLAGTPDKVDLNMSLT 419

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAG---FGRHAVQNYTFSVED 494
           + S GS+ ++  +  D G+ +   +  +N FG G  A L A       +   ++T     
Sbjct: 420 ERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAALRASRSKTTLNGSLSFTDPYFT 479

Query: 495 PYFLGSPISAGFDLQKTHLEDGSLDINDES---AAVRMIVPITESISTSFKYDLRFLQYG 551
              +                  S+     +   A +RM VP+TE    +F      L   
Sbjct: 480 ADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRMSVPVTEYDRVNFGLVAEHLTVN 539

Query: 552 AISEKEKIPSIYTTLIEHGKFSSHSI-------SQSIIYNTLDNPIVPRKGMLISSSYDY 604
             ++  K  + +         +  S        +     N  D+ + P +G L   + + 
Sbjct: 540 TYNKAPKHYADFIKKYGKTDGTDGSFKGWLYKGTVGWGRNKTDSALWPTRGYLTGVNAEI 599

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
           A  G   QY+      ++F+ LS    ++     G        K +  F+ F       +
Sbjct: 600 ALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEVGIAGGYGKTKEIPFFENFYGGGLGSV 659

Query: 665 RGFAYKGIGPRVDKKY----AIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           RG+    +GP+V  +Y    + GG   ++ SA + FPMP   +   +R + F D+ +++ 
Sbjct: 660 RGYESGTLGPKVYDEYGEKISYGGNKKANVSAELLFPMPGAKDARTVRLSLFADAGSVWD 719

Query: 721 -----------------NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLR 763
                            N    G        +  R S G  + W SPLG M   Y  PL+
Sbjct: 720 GKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNELRYSAGGAVTWLSPLGPMKFSYAYPLK 779

Query: 764 HREGDKIQQFGFRIGNRM 781
            +  D+IQ+F F++G   
Sbjct: 780 KKPEDEIQRFQFQLGTTF 797


>gi|319762183|ref|YP_004126120.1| outer membrane protein assembly complex, yaet protein
           [Alicycliphilus denitrificans BC]
 gi|330826005|ref|YP_004389308.1| outer membrane protein assembly complex, YaeT protein
           [Alicycliphilus denitrificans K601]
 gi|317116744|gb|ADU99232.1| outer membrane protein assembly complex, YaeT protein
           [Alicycliphilus denitrificans BC]
 gi|329311377|gb|AEB85792.1| outer membrane protein assembly complex, YaeT protein
           [Alicycliphilus denitrificans K601]
          Length = 765

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 159/745 (21%), Positives = 298/745 (40%), Gaps = 18/745 (2%)

Query: 45  TSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDS 104
              V+ I + G   V    I + +P+ VG   +D     A++ ++A+G F +V+++   +
Sbjct: 31  PFKVQDIRVEGLQRVEPGTIFASLPLRVGDEYNDEKGAAAIRALFALGLFKDVRLEASGN 90

Query: 105 VLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQAYA 161
           VL++ + ER  I  + F+G      D LK  +          +D+   +     +K+ Y 
Sbjct: 91  VLVVVVEERPTIADVEFAGTKEFDKDTLKKAMRDVGLTEGRPFDKALADRAEQELKRQYI 150

Query: 162 SIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTS 221
           +       V      I    +N+T+ + EG  AKI  IR VGN+ +  + L+ +    T 
Sbjct: 151 NRSLYGAEVVTTVTPIERNRVNLTFTVTEGEPAKIKEIRIVGNQAFGESTLKGLFDQDTG 210

Query: 222 GYF-SFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEG 280
           G+   + K++ YS+ +++ D E +R++Y  RGY   ++ S  +        + I      
Sbjct: 211 GWMSWYTKSNRYSRAKLNADLETLRSYYLARGYLEFRIDSTQVAISPDKQDISITINVTE 270

Query: 281 EIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRV 340
               V +          +     SL+ IR G  YN   + E+++  + +F +    F RV
Sbjct: 271 GQRYVVSGVKLEGNYLDRDDEFKSLVTIRPGEPYNADRVAETTKAFTDHFGNFGFAFARV 330

Query: 341 KTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMI 400
           +     D     V +    +     YV+RI++ GN+++ D VIRRE    E    +   I
Sbjct: 331 EAVPEIDRENNRVALVLRAEPSRRAYVRRIQVSGNNRTRDEVIRREFRQYEASWYDGDKI 390

Query: 401 ERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEG 460
           + ++ R+   G+F+EVN+         D V L ++V +   GS+ +   +   + + +  
Sbjct: 391 KLSRDRVDRLGFFTEVNVETQEVPGAPDQVDLVINVAEKPTGSLQLGAGFSSAEKVALSF 450

Query: 461 HIDDNNFFGQGYRARLAAGFGRHAVQNYT----FSVEDPYFLGSPISAGFDLQKTHLEDG 516
            I   N FG G    +     ++                    +        +    + G
Sbjct: 451 AIKQENVFGSGNYLGVDVNTSKYRRTLVFSTTDPYFTQDGISRTLDVYYRTAKPYENQGG 510

Query: 517 SLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHS 576
           + ++     ++R  VP +E+ +  F   L   Q    +       +Y          S  
Sbjct: 511 NYELVTAGTSIRFGVPFSETDTVFFGGGLEQTQIKVGTNIPAAYLVYAEKF-GDTSWSLP 569

Query: 577 ISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSL 636
           ++     +  D+ + P  G     +       GD++Y R   +   +  L+    +  + 
Sbjct: 570 LTIGWSRDDRDSALAPNSGRYQRLN-TEWSVAGDARYVRGNYQIQQYIPLNKQYTLAFNG 628

Query: 637 RFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSF 696