RPSBLAST alignment for GI: 254780772 and conserved domain: pfam01103

>gnl|CDD|144626 pfam01103, Bac_surface_Ag, Surface antigen. This entry includes the following surface antigens; D15 antigen from H.influenzae, OMA87 from P.multocida, OMP85 from N.meningitidis and N.gonorrhoeae. The family also includes a number of eukaryotic proteins that are members of the UPF0140 family. There also appears to be a relationship to pfam03865 (personal obs: C Yeats). In eukaryotes, it appears that these proteins are not surface antigens; S. cerevisiae YNL026W (SAM50) is an essential component of the Sorting and Assembly Machinery (SAM) of the mitochondrial outer membrane. The protein was localized to the mitochondria. Length = 317
 Score =  178 bits (453), Expect = 5e-45
 Identities = 91/324 (28%), Positives = 155/324 (47%), Gaps = 15/324 (4%)

Query: 466 NFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDG---SLDIND 522
           N  G+G    ++  + ++  Q+++ S  DPYFLG  +S G+ L     ++    S D   
Sbjct: 1   NLLGRGQSLSVSLSYSQYE-QSFSLSFTDPYFLGDGLSLGYSLFYNTYDEDEYDSYDTKS 59

Query: 523 ESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSII 582
              ++ +  PI+E+ S S        +           +I     + GK    S+S  + 
Sbjct: 60  VGFSLSLGYPISENWSLSLGLSYSRDKIRDEDGS---DNIRNYASQTGKSLLSSLSFGLS 116

Query: 583 YNTLDNPIVPRKGMLISSSYDYAG--FGGDSQYHRIGSRASYFYLLSDDSDIVGSLR--F 638
           Y+T DN + P +G  +  + ++AG   GGD ++ ++   AS++Y L +D D V + R   
Sbjct: 117 YDTRDNGLFPTRGYYLRFNLEFAGPILGGDVKFLKLTGDASWYYPLGEDHDFVLAARVGL 176

Query: 639 GYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPM 698
           GY     +   L   ++F    +  +RG+ Y  IGPR +   A+GG+ Y +ASA + +P+
Sbjct: 177 GYLLGYGAKDKLPPSERFFAGGSNSVRGYGYGSIGPRDEDGDALGGRSYFTASAELRYPL 236

Query: 699 PLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYY 758
           P +P    LRGA FVD+  ++ +                R S GV + W+SP G +   Y
Sbjct: 237 PFIPN---LRGALFVDAGNVWNSGGDTPGGSDGVRSKNIRASVGVGLRWDSPFGPLRFDY 293

Query: 759 GIPLRHREGDKIQ-QFGFRIGNRM 781
            IPL+  +GD+ + +F F IG   
Sbjct: 294 AIPLKKPDGDRTEFRFYFGIGTEF 317