RPSBLAST alignment of GI: 254780772 and MMDB domain: 2qdf_A_158-248

>2qdf_A (A:158-248) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 91
 Score = 49.0 bits (117), Expect = 2e-06
 Identities = 17/87 (19%), Positives = 31/87 (35%), Gaps = 11/87 (12%)

Query: 116 INHLFFSGNNNLKDDQLKMIVRSRSAAA---------YDEDTVNADVHNIKQAYASIGYL 166
           I  +   GN+    D+L    + R             Y +  +  D+  ++  Y   GY 
Sbjct: 4   IQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYA 63

Query: 167 NVMVKVQHHSISP--TTLNITYVIEEG 191
              +     S++P    + +T  I EG
Sbjct: 64  RFNIDSTQVSLTPDKKGIYVTVNITEG 90