RPSBLAST alignment of GI: 254780772 and MMDB domain: 2qdf_A_249-335

>2qdf_A (A:249-335) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 87
 Score = 55.2 bits (133), Expect = 3e-08
 Identities = 12/83 (14%), Positives = 32/83 (38%), Gaps = 1/83 (1%)

Query: 116 INHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQ-H 174
           ++ +  SGN      +++ + +      Y+   V     +IK+     GY    V+    
Sbjct: 4   LSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPE 63

Query: 175 HSISPTTLNITYVIEEGVKAKIN 197
            + +  T+ +   ++ G +  + 
Sbjct: 64  INDADKTVKLRVNVDAGNRFYVR 86