RPSBLAST alignment of GI: 254780772 and MMDB domain: 2qdz_A_46-209

>2qdz_A (A:46-209) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis}Length = 164
 Score = 46.8 bits (110), Expect = 1e-05
 Identities = 6/77 (7%), Positives = 21/77 (27%)

Query: 353 VDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGY 412
              +     G  + V  ++++   +         ++     P++   +    + + A  Y
Sbjct: 2   PARKPDATSGHTVTVHAVDLDFGVEGRLFDPAPLVQDYLNRPLDNEQLFLLVKALSAALY 61

Query: 413 FSEVNISQLPANDVSDY 429
                 S +        
Sbjct: 62  DRGYATSIVTFVPPGVV 78