RPSBLAST alignment of GI: 254780772 and protein with PDBid: 2qdf

>2qdf_A OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Length = 335
 Score =  127 bits (319), Expect = 9e-30
 Identities = 79/336 (23%), Positives = 150/336 (44%), Gaps = 6/336 (1%)

Query: 39  AVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVK 98
             + +   +V+ I   G   V     L  +PV  G +++D D+ + ++ ++A G F +V+
Sbjct: 1   GSHMAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVR 60

Query: 99  IKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHN 155
           +      L++ + ER  I  + FSGN ++KDD LK  + +         D  T+      
Sbjct: 61  VLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKG 120

Query: 156 IKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNK-NYSHARLER 214
           ++  Y S+G  +  VK     +    +++  V +EGV A+I  I  VGN    +   +  
Sbjct: 121 LEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISH 180

Query: 215 VISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVL-FDKQKSGYVL 273
                   +++      Y K++++ D E +R++Y DRGYA   + S  +     K G  +
Sbjct: 181 FQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYV 240

Query: 274 IFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSG 333
              I EG+ Y +  + +   L       +  L +I  G LYN  ++ +  + I K     
Sbjct: 241 TVNITEGDQYKLSGVEVSGNL-AGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRY 299

Query: 334 ERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKR 369
              + RV++    + A + V +   +D G+  YV++
Sbjct: 300 GYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRK 335