RPSBLAST alignment of GI: 254780772 and protein with PDBid: 3mc9

>3mc9_A ALR2269 protein; polypeptide transport associated, potra, outer bacterial MEM protein membrane transport, beta barrel biogenesis, membran; 2.20A {Nostoc SP} PDB: 3mc8_A Length = 316
 Score = 93.0 bits (230), Expect = 2e-19
 Identities = 28/252 (11%), Positives = 78/252 (30%), Gaps = 21/252 (8%)

Query: 47  IVRRIEIRGATNVG----KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +V  + +R  +       +  + + I    G++ + + L   +  I+  G+FSNV+    
Sbjct: 63  LVSEVLVRPQSGQLTPELETQVYNVIRTQPGRTTTRSQLQEDINAIFGTGFFSNVQASPE 122

Query: 103 DS----VLIIDLIERKIINHLFFSGNNNLKDD------QLKMIVRSRSAAAYDEDTVNAD 152
           D+     +   +    +++ +    N                I R++     +   +   
Sbjct: 123 DTPLGVRVSFIVQPNPVLSKVEIQANPGTNVPSVLPQATADEIFRAQYGKILNLRDLQEG 182

Query: 153 VHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARL 212
           +  + + Y   GY+   V           + +           +      G       + 
Sbjct: 183 IKELTKRYQDQGYVLANVVGAPQVSENGVVTLQVAEGVVENISVRFRNKEGQDVNEQGQP 242

Query: 213 ERVISIRT--SGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSG 270
            R  +     +         V+++  +   ++ ++  +    +  V VS     D  K  
Sbjct: 243 IRGRTQDYIITREVELKPGQVFNRNTV---QKDLQRVFGTGLFEDVNVSLDPGTDPTKV- 298

Query: 271 YVLIFQIDEGEI 282
             ++  + E  +
Sbjct: 299 -NVVVNVVERSL 309