RPSBLAST alignment of GI: 254780772 and protein with PDBid: 3og5

>3og5_A Outer membrane protein assembly complex, YAET Pro; potra fold, insertion of outer membrane proteins, protein BI; 2.69A {Escherichia coli} Length = 166
 Score = 61.4 bits (148), Expect = 8e-10
 Identities = 30/170 (17%), Positives = 63/170 (37%), Gaps = 15/170 (8%)

Query: 195 KINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYA 254
           K++ +   GN     A +E++  I           ++Y+  +++  E+ I+      GYA
Sbjct: 7   KLSGVEVSGNLAGHSAEIEQLTKIE--------PGELYNGTKVTKMEDDIKKLLGRYGYA 58

Query: 255 AVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLY 314
             +V S    +       L   +D G  + V  I  +      +   L   +R   G   
Sbjct: 59  YPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGN-DTSKDAVLRREMRQMEGAWL 117

Query: 315 NPQEIKESSEKISKY-FFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGS 363
               + +  E++++  FF      V   T+       + VD+ Y + + +
Sbjct: 118 GSDLVDQGKERLNRLGFFE----TVDTDTQRVPGSPDQ-VDVVYKVKERN 162