HHsearch results for GI: 254780773 and protein with PDBid: 1d5g_A

>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A
Probab=98.31  E-value=4.6e-07  Score=66.94  Aligned_cols=57  Identities=21%  Similarity=0.411  Sum_probs=49.6

Q ss_pred             CCCCCCCCCCHHHHHH-CCCCCEEEEECCCCCCCC--HHHHHHCCCCCCCCCEEEEEECCC
Q ss_conf             2000245675565300-145662888878304540--011111014678863169996587
Q gi|254780773|r  120 PVVSNVSPASPAAIAG-VKKGDCIISLDGITVSAF--EEVAPYVRENPLHEISLVLYREHV  177 (349)
Q Consensus       120 p~I~~V~~~spA~~AG-L~~GD~Il~InG~~V~s~--~dl~~~i~~~~g~~v~i~v~R~~~  177 (349)
                      -+|..|.++|||+++| |++||+|++|||.++.++  ++..+.+++. ++.+++++.|+..
T Consensus        35 i~V~~v~~gs~A~~~g~l~~GD~Il~INg~~v~~~~~~e~v~~l~~~-~~~v~L~v~R~~~   94 (96)
T 1d5g_A           35 IYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNT-GQVVHLLLEKGQS   94 (96)
T ss_dssp             CEEEEECTTSHHHHTTCCCTTCEEEEETTEECTTCCHHHHHHHHHSC-CSEEEEEEECCSC
T ss_pred             EEEEEECCCCHHHHCCCCCCCCEEEEECCEECCCCCHHHHHHHHHCC-CCEEEEEEECCCC
T ss_conf             99999899998998399999999999999998899899999998779-9869999983898