HHsearch results for GI: 254780773 and protein with PDBid: 2iwn_A

>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens}
Probab=98.36  E-value=2.1e-07  Score=69.36  Aligned_cols=57  Identities=25%  Similarity=0.430  Sum_probs=50.1

Q ss_pred             CCCCCCCCCCHHHHHH-CCCCCEEEEECCCCCCCC--HHHHHHCCCCCCCCCEEEEEECCC
Q ss_conf             2000245675565300-145662888878304540--011111014678863169996587
Q gi|254780773|r  120 PVVSNVSPASPAAIAG-VKKGDCIISLDGITVSAF--EEVAPYVRENPLHEISLVLYREHV  177 (349)
Q Consensus       120 p~I~~V~~~spA~~AG-L~~GD~Il~InG~~V~s~--~dl~~~i~~~~g~~v~i~v~R~~~  177 (349)
                      .+|..|.|+|||+++| |++||+|++|||+++.+.  ++..+.+++. +.++++++.|.++
T Consensus        35 i~V~~v~~gg~A~~~G~L~~GD~I~~INg~~v~~~t~~~~~~~lr~~-~~~v~l~v~R~~~   94 (97)
T 2iwn_A           35 IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT-GQTVLLTLMRRGE   94 (97)
T ss_dssp             CEEEEECTTCHHHHHCCCCTTCEEEEETTEECTTSCHHHHHHHHHTC-CSEEEEEEEEEEE
T ss_pred             EEEEEECCCCHHHHCCCCCCCCEEEEECCEECCCCCHHHHHHHHHCC-CCEEEEEEEECCC
T ss_conf             89999889996897399999999999999997899899999998769-9869999993899