BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780773|ref|YP_003065186.1| zinc metallopeptidase
[Candidatus Liberibacter asiaticus str. psy62]
         (349 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780773|ref|YP_003065186.1| zinc metallopeptidase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040450|gb|ACT57246.1| zinc metallopeptidase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 349

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/349 (100%), Positives = 349/349 (100%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV
Sbjct: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60

Query: 61  SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
           SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP
Sbjct: 61  SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL
Sbjct: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240
           HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG
Sbjct: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
           VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG
Sbjct: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
Sbjct: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349


>gi|140063939|gb|ABO82465.1| zinc metalloprotease [Candidatus Liberibacter asiaticus]
          Length = 349

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/349 (99%), Positives = 348/349 (99%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           MFWLDCFLLYTVSLIIIVVI +FGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV
Sbjct: 1   MFWLDCFLLYTVSLIIIVVIGQFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60

Query: 61  SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
           SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP
Sbjct: 61  SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL
Sbjct: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240
           HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG
Sbjct: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
           VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG
Sbjct: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
Sbjct: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349


>gi|315121990|ref|YP_004062479.1| zinc metallopeptidase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495392|gb|ADR51991.1| zinc metallopeptidase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 348

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 274/337 (81%), Gaps = 1/337 (0%)

Query: 13  SLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS 72
           S+ IIV IHEFGHY+VARLCN+RV+SFS+GFG ELIG TSRSG RWKVS +PLGGYV FS
Sbjct: 13  SIFIIVFIHEFGHYIVARLCNVRVISFSIGFGAELIGFTSRSGTRWKVSAVPLGGYVRFS 72

Query: 73  EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           ED++D+RSF CAA WKKIL +LAGP ANC+MAIL  TFFFY TG+++ V+ +V P SPAA
Sbjct: 73  EDDQDVRSFVCAASWKKILIILAGPFANCIMAILISTFFFYKTGMIESVIFDVYPNSPAA 132

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
           I+GVK GD I+SLD + VS F+++APY+REN   EI + ++RE+VG+L LKV+P   D V
Sbjct: 133 ISGVKAGDRIVSLDEMPVSTFDDIAPYIRENVSKEIVVGVHREYVGILKLKVVPSFLDFV 192

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
           DRFG+KR++PS+GISF+YD+T+L  RTV QSF RGL E+  IT+  L VLS+ F +D + 
Sbjct: 193 DRFGVKRRIPSIGISFNYDKTRLQYRTVSQSFLRGLKEMGLITQRTLSVLSNIFSRDIKY 252

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
            QISGP+GIA+ AK+F D GF++YI F++ FSW  GFMNLLPIPILDGG+++ F+LEMIR
Sbjct: 253 -QISGPIGIAKAAKDFSDQGFDSYIGFISFFSWMAGFMNLLPIPILDGGNVVIFILEMIR 311

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
            K L V+V RVIT +G+CIIL LF LGIRNDIYGL++
Sbjct: 312 RKPLEVAVARVITGIGICIILVLFMLGIRNDIYGLIK 348


>gi|55380590|gb|AAV50033.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
          Length = 148

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%)

Query: 205 GISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARI 264
           G  + YDETKLHSRTVLQSFSRGLDE+SSITRGFL VLSSAFGKDTRLNQ+SGPVGIARI
Sbjct: 4   GPGWCYDETKLHSRTVLQSFSRGLDEVSSITRGFLCVLSSAFGKDTRLNQVSGPVGIARI 63

Query: 265 AKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVI 324
           AKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVI
Sbjct: 64  AKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVI 123

Query: 325 TRMGLCIILFLFFLGIRNDIYGLMQ 349
           TRMGLCIILFLFFLGIRNDIYGLMQ
Sbjct: 124 TRMGLCIILFLFFLGIRNDIYGLMQ 148


>gi|55380586|gb|AAV50030.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           africanus]
          Length = 265

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/241 (57%), Positives = 173/241 (71%), Gaps = 2/241 (0%)

Query: 108 FTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE 167
           F  FFYNT V+ PVV  V P +PA+I G+K  D I+SLDG  VS  E+VA Y+R+N L E
Sbjct: 26  FCVFFYNTAVIDPVVFKVFPGTPASIFGIKVKDRIVSLDGTAVSTSEDVAFYIRKNQLRE 85

Query: 168 ISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRG 227
           +  VL REHVG++ LKV PRLQD +D+F +K ++P++GI F  D   LH RTVLQSFSR 
Sbjct: 86  VEFVLQREHVGIITLKVTPRLQDFIDQFNVKHKIPTIGILF--DSGNLHYRTVLQSFSRS 143

Query: 228 LDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
           L+E+ SIT      L   F  D +++ I GPVGIA++AK F ++GFN+YI FLA+FSW  
Sbjct: 144 LNEVISITIKSFSGLIHIFSGDVKVHSIHGPVGIAKVAKKFAEYGFNSYIEFLAIFSWVT 203

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           GFMNLLPIPILDGG+ + FL EMIRGK L VS  R IT++G   ILFL FLGI NDIYGL
Sbjct: 204 GFMNLLPIPILDGGNFMIFLFEMIRGKPLKVSTVRFITKIGCSFILFLLFLGISNDIYGL 263

Query: 348 M 348
           +
Sbjct: 264 L 264


>gi|222148856|ref|YP_002549813.1| zinc metallopeptidase [Agrobacterium vitis S4]
 gi|221735842|gb|ACM36805.1| zinc metallopeptidase [Agrobacterium vitis S4]
          Length = 373

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 136/360 (37%), Positives = 202/360 (56%), Gaps = 22/360 (6%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + + L +IV +HE GHY+V R   I++L+FS+GFGPEL+G   R G RWK+S IPLGGYV
Sbjct: 14  FVLVLSLIVFVHEMGHYLVGRWSGIKILAFSLGFGPELVGFNDRHGTRWKLSAIPLGGYV 73

Query: 70  SFSED-----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFF--TF 110
            F  D                 E   R+   A  WK+  TV AGP+AN ++AIL F  TF
Sbjct: 74  RFFGDADASSKTDTAEFEALSPEDRARTLNGAKLWKRAATVAAGPIANFLLAILIFSVTF 133

Query: 111 FFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
             Y   V  PVV+ V PAS AA AGV+ GD +++LDG +V  F++V  YV   PL  I +
Sbjct: 134 SLYGKPVSDPVVAEVKPASAAAEAGVQPGDILVALDGSSVKTFDDVVRYVSVRPLVPIVV 193

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGI--SFSYDETKLHSRTVLQSFSRGL 228
            + R     + L + PR  +T+DRFG K +V  +GI  + +    ++    +++S S G+
Sbjct: 194 TVKRGE-SQMDLSMTPRRTETIDRFGNKMEVGQIGIMTTAARGNFRVEKLGLIESVSAGV 252

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           D+  +I  G    L++ F      +Q+ GP+ +A+ +      G  A +   A+ S +IG
Sbjct: 253 DQTWNIVTGTYDYLANLFAGRMNADQLGGPIRVAQASGQVATLGVVALLQLAAVLSVSIG 312

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            +NL+P+P+LDGGHLI + LE +RGK +      +  ++G+ +IL L      NDI  L+
Sbjct: 313 LLNLMPVPVLDGGHLILYALEAVRGKPVSAGAQEIAFKVGMVMILSLMVFATWNDISRLI 372


>gi|218682882|ref|ZP_03530483.1| putative transmembrane protease [Rhizobium etli CIAT 894]
          Length = 377

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 199/364 (54%), Gaps = 22/364 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F +   + + + L ++V +HE GHY+V R   IR+L+FSVGFGPEL G T R G RWK+S
Sbjct: 10  FLMGNIVTFILVLSLLVFVHEMGHYLVGRWSGIRILAFSVGFGPELFGFTDRHGTRWKIS 69

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
           ++PLGGYV F   ED               E   RSF  A  WK+  TV AGP+AN ++A
Sbjct: 70  VVPLGGYVRFFGDEDASSKPDNEGIAAMSEEDRARSFAGAKLWKRAATVAAGPIANFLLA 129

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  FT  F  Y   +  PVV+ V+P   AA AGV  GD ++++DG  V  F++V  YV  
Sbjct: 130 IAIFTILFSVYGRTIADPVVAEVTPEGAAAAAGVLPGDLLVAIDGNKVETFDDVRRYVGI 189

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET--KLHSRTV 220
            P   I + + R     L L ++P+  D  D+FG K ++  +GI  +      +L + T 
Sbjct: 190 RPSQNIVVTIERAGQ-KLDLPMVPKRVDQTDQFGNKIEMGQIGIITNQQAGNFRLQTYTP 248

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           LQ+   G+ +   I  G    + + F    R +Q+ GP+ +A+ +      G  A +   
Sbjct: 249 LQALREGVIQTRDIVTGTFKYIGNIFAGTMRADQLGGPIRVAQASGQMATLGIGAVLQLA 308

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           AM S +IG +NL+P+P+LDGGHL+ + +E +RGK LG +   +  R+GL +IL L     
Sbjct: 309 AMLSVSIGLLNLMPVPVLDGGHLMFYAVEAVRGKPLGSAAQEIAFRIGLAMILTLMVFTT 368

Query: 341 RNDI 344
            NDI
Sbjct: 369 WNDI 372


>gi|209549188|ref|YP_002281105.1| membrane-associated zinc metalloprotease [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209534944|gb|ACI54879.1| membrane-associated zinc metalloprotease [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 375

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 198/364 (54%), Gaps = 22/364 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F +   + + + L ++V +HE GHY+V R   IR+L+FSVGFGPE+ G   R G RWK+S
Sbjct: 8   FLMGNIVTFILVLSLLVFVHEMGHYLVGRWSGIRILAFSVGFGPEIFGFNDRHGTRWKIS 67

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
           +IPLGGYV F   ED               E   RSF  A  WK+  TV AGP+AN ++A
Sbjct: 68  VIPLGGYVRFFGDEDASSKPDSDKLAAMSEEDRARSFAGAKLWKRAATVAAGPIANFLLA 127

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  FT  F  Y   V  PVVS V+P   AA AG+  GD ++++DG  V  F++V  YV  
Sbjct: 128 IAIFTLLFSIYGRSVADPVVSEVTPDGVAAAAGILPGDLLVAIDGGKVETFDDVRRYVAI 187

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTV 220
            P  +I + + R     L L ++P+  D  D+FG K +V  +GI  S +    +L + T 
Sbjct: 188 RPSQQIVVTIERGGQK-LDLPMVPQRVDRTDQFGNKIEVGQIGIVTSKEVGNFRLQTYTP 246

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           LQ+    + E   I  G    + + F    R +Q+ GP+ +A+ +      G  A +   
Sbjct: 247 LQALRESVIETRDIVTGTFKYIGNIFRGTMRADQLGGPIRVAQASGQMASLGIGAVLQLA 306

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           AM S +IG +NL+P+P+LDGGHL+ + +E +RGK LG     +  R+GL +IL L     
Sbjct: 307 AMLSVSIGLLNLMPVPVLDGGHLMFYAVEAVRGKPLGAKAQEIAFRIGLAMILTLMVFTT 366

Query: 341 RNDI 344
            ND+
Sbjct: 367 WNDV 370


>gi|86357540|ref|YP_469432.1| zinc metallopeptidase protein [Rhizobium etli CFN 42]
 gi|86281642|gb|ABC90705.1| probable zinc metallopeptidase protein [Rhizobium etli CFN 42]
          Length = 375

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 197/364 (54%), Gaps = 22/364 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F +   + + + L ++V +HE GHY+V R   IR+L+FSVGFGPEL G T R G RWK+S
Sbjct: 10  FVMGNIVTFILVLSLLVFVHEMGHYLVGRWSGIRILAFSVGFGPELFGFTDRHGTRWKIS 69

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
           +IPLGGYV F   ED               E+  RSF  A  WK+  TV AGP+AN ++A
Sbjct: 70  VIPLGGYVRFFGDEDASSKPDSDKLAAMSEEERARSFAGAKLWKRAATVAAGPIANFLLA 129

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  FT  F  Y   +  PVV+ V P S AA AG+  GD ++++DG  V  FE+V  YV  
Sbjct: 130 IAIFTVLFTVYGRMIADPVVAEVKPESSAAAAGILPGDLLVAIDGGKVETFEDVRRYVGM 189

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET--KLHSRTV 220
            P   I + + R     L + ++P+  D  D+FG K +V  +GI+   +    +L + T 
Sbjct: 190 RPGQRIVVTVERGGQK-LDVPMVPQRVDQTDQFGNKMEVGQIGIATDKNAGNFRLQTYTP 248

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           LQ+   G+     I       + + F    R +Q+ GP+ +A+        G  A +   
Sbjct: 249 LQALREGVIASGQIVTDTFKYIGNIFSGSMRADQLGGPIRVAQATGQMAKLGLGAVLQLA 308

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           A+ S +IG +NL+P+P+LDGGHL+ + +E +RGK LG     +  R+GL +IL L     
Sbjct: 309 AVLSVSIGLLNLMPVPVLDGGHLMFYAVEAVRGKPLGAKAQEIAFRIGLAMILTLMVFTT 368

Query: 341 RNDI 344
            NDI
Sbjct: 369 WNDI 372


>gi|116251983|ref|YP_767821.1| transmembrane protease [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256631|emb|CAK07719.1| putative transmembrane protease [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 377

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 136/367 (37%), Positives = 200/367 (54%), Gaps = 22/367 (5%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F +   + + + L ++V +HE GHY+V R   IR+L+FSVGFGPE+ G T R G RWK+S
Sbjct: 10  FLMGNIVTFILVLSLLVFVHEMGHYLVGRWSGIRILAFSVGFGPEIFGFTDRHGTRWKIS 69

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
           +IPLGGYV F   ED               E   RSF  A  WK+  TV AGP+AN ++A
Sbjct: 70  VIPLGGYVRFFGDEDASSKPDTDKIAAMSEEDRARSFAGAKLWKRAATVAAGPIANFLLA 129

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  FT  F  Y   +  PVV+ V P   AA AG+  GD ++++DG  V  F++V  YV  
Sbjct: 130 IAIFTILFSVYGRTIADPVVAEVKPDGAAAAAGILPGDLLVAIDGGKVETFDDVRRYVGI 189

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET--KLHSRTV 220
            P  +I + + R     L + ++P+  D  D+FG K ++  +GI  S +    +L + T 
Sbjct: 190 RPSQKIVVTIERAGQK-LDVPMVPQRVDQTDQFGNKVELGQIGIVTSREAGNFRLKTYTP 248

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           L+S    + E   I  G    + + F    R +Q+ GP+ +A+ +      G  A +   
Sbjct: 249 LESLREAVIETRDIVTGTFKYIGNIFSGTMRADQLGGPIRVAQASGQMASLGIGAVLQLA 308

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           A+ S +IG +NL+P+P+LDGGHL+ + +E +RGK LG S   +  R+GL +IL L     
Sbjct: 309 AVLSVSIGLLNLMPVPVLDGGHLMFYAVEAVRGKPLGSSAQEIAFRIGLAMILTLMVFTT 368

Query: 341 RNDIYGL 347
            NDI  L
Sbjct: 369 WNDIGSL 375


>gi|241204510|ref|YP_002975606.1| membrane-associated zinc metalloprotease [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240858400|gb|ACS56067.1| membrane-associated zinc metalloprotease [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 377

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 135/367 (36%), Positives = 200/367 (54%), Gaps = 22/367 (5%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F +   + + + L ++V +HE GHY+V R   IR+L+FSVGFGPE+ G T R G RWK++
Sbjct: 10  FLMGNIVTFILVLSLLVFVHEMGHYLVGRWSGIRILAFSVGFGPEIFGFTDRHGTRWKIA 69

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
           +IPLGGYV F   ED               E   RSF  A  WK+  TV AGP+AN ++A
Sbjct: 70  VIPLGGYVRFFGDEDASSKPDTDKIAAMSEEDRARSFAGAKLWKRAATVAAGPIANFLLA 129

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  FT  F  Y   +  PVV+ V P   AA AG+  GD ++++DG  V  F++V  YV  
Sbjct: 130 IAIFTILFSVYGRTIADPVVAEVKPDGAAAAAGILPGDLLVAIDGGKVETFDDVRRYVGI 189

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET--KLHSRTV 220
            P  +I + + R     L + ++P+  D  D+FG K ++  +GI  S +    +L + T 
Sbjct: 190 RPSQKIVVTIERAGQK-LDVPMVPQRVDQTDQFGNKVELGQIGIVTSREAGNFRLKTYTP 248

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           L+S    + E   I  G    + + F    R +Q+ GP+ +A+ +      G  A +   
Sbjct: 249 LESLREAVIETRDIVTGTFKYIGNIFSGTMRADQLGGPIRVAQASGQMASLGIGAVLQLA 308

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           A+ S +IG +NL+P+P+LDGGHL+ + +E +RGK LG S   +  R+GL +IL L     
Sbjct: 309 AVLSISIGLLNLMPVPVLDGGHLMFYAVEAVRGKPLGSSAQEIAFRIGLAMILTLMVFTT 368

Query: 341 RNDIYGL 347
            NDI  L
Sbjct: 369 WNDIGSL 375


>gi|190891613|ref|YP_001978155.1| metallopeptidase [Rhizobium etli CIAT 652]
 gi|190696892|gb|ACE90977.1| metallopeptidase protein [Rhizobium etli CIAT 652]
          Length = 374

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/364 (35%), Positives = 196/364 (53%), Gaps = 22/364 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F +   + + + L ++V +HE GHY+V R   IR+L+FSVGFGPE+ G   R G RWK+S
Sbjct: 7   FLMGNVVTFILVLSLLVFVHEMGHYLVGRWSGIRILAFSVGFGPEIFGFNDRHGTRWKIS 66

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
            IPLGGYV F   ED               E   RSF  A  WK+  TV AGP+AN ++A
Sbjct: 67  AIPLGGYVRFFGDEDASSKPDSEKVAAMSEEDRARSFAGAKLWKRAATVAAGPIANFLLA 126

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  F   F  Y   +  PVV+ V+P   AA AG+  GD ++++DG  V  F++V  YV  
Sbjct: 127 IAIFAVLFSVYGRMIADPVVAEVTPDGAAAAAGILPGDLLVAIDGSKVETFDDVRRYVAI 186

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV-- 220
            P  +I + + R     L + ++P+  D  D+FG K ++  +GI  + +      RT   
Sbjct: 187 RPSQKIVVTVERGGQ-KLDVPMVPQRTDRTDQFGNKIELGQIGIVTNKEAGNFRPRTYTP 245

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           L++   G+ E + I  G    +++ F    R +Q+ GP+ +A+ +      G  A +   
Sbjct: 246 LEAVREGVIESAGIVTGTFKYIANIFAGSMRADQLGGPIRVAQASGQMASLGIGAVLQLA 305

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           A  S +IG +NL+P+P+LDGGHL+ + +E +RG+ LG     +  R+GL +IL L     
Sbjct: 306 ATLSVSIGLLNLMPVPVLDGGHLMFYAVEAVRGRPLGAKAQEIAFRIGLAMILTLMVFTT 365

Query: 341 RNDI 344
            NDI
Sbjct: 366 WNDI 369


>gi|159184739|ref|NP_354387.2| zinc metallopeptidase [Agrobacterium tumefaciens str. C58]
 gi|20978808|sp|Q8UFL7|Y1380_AGRT5 RecName: Full=Putative zinc metalloprotease Atu1380
 gi|159140027|gb|AAK87172.2| zinc metallopeptidase [Agrobacterium tumefaciens str. C58]
          Length = 377

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 195/358 (54%), Gaps = 26/358 (7%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF-- 71
           L ++V +HE GHY+V R C IR  +FS+GFGPELIG T + G RWK+S IPLGGYV F  
Sbjct: 22  LSLLVFVHEMGHYLVGRWCGIRSTAFSIGFGPELIGFTDKRGTRWKLSAIPLGGYVKFFG 81

Query: 72  SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YN 114
            ED               E+  ++   A  WK+  TV AGP+AN ++AIL F   F  Y 
Sbjct: 82  DEDAASKSDSSGLSHMSLEERAQTLSGAKLWKRAATVAAGPIANFILAILIFAVLFGIYG 141

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             +  PVV+ V   S AA AGVK GD ++++DG  V  FE+V  YV   P   I++ + R
Sbjct: 142 RMIADPVVAEVRENSAAATAGVKPGDRLVAIDGEKVMTFEDVRRYVGIRPGTPITVTVER 201

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVL----QSFSRGLDE 230
                L L ++P   +T D+FG K ++  +GI    D+T  + R +     ++ + G+ E
Sbjct: 202 AGE-ELKLPMVPTRTETTDQFGNKLEMGIIGI--VTDQTSGNFRHIEYSPSEAVAEGVRE 258

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
              +  G    + +        +Q+ GPV +A+ +      G +A I   A+ S +IG +
Sbjct: 259 TGHVITGTFNYIGNLVTGRMNADQLGGPVRVAQASGQMATLGISAVIQLAAVLSVSIGLL 318

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NL+P+P+LDGGHL+ + +E IRG+ LG     V  R+G+ +IL L      NDI  L+
Sbjct: 319 NLMPVPVLDGGHLVFYAIEAIRGRPLGAGAQEVAFRIGMMMILGLMVFATWNDISSLI 376


>gi|327189228|gb|EGE56407.1| metallopeptidase protein [Rhizobium etli CNPAF512]
          Length = 374

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 130/364 (35%), Positives = 198/364 (54%), Gaps = 22/364 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F +   + + + L ++V +HE GHY+V R   IR+L+FSVGFGPE+ G   R G RWK+S
Sbjct: 7   FLMGNVVTFILVLSLLVFVHEMGHYLVGRWSGIRILAFSVGFGPEIFGFNDRHGTRWKIS 66

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
            IPLGGYV F   ED               E   RSF  A  WK+  TV AGP+AN ++A
Sbjct: 67  AIPLGGYVRFFGDEDASSKPDSEKVAAMSEEDRARSFAGAKLWKRAATVAAGPIANFLLA 126

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  F   F  Y   +  PVV+ V+P   AA AG+  GD ++++DG  V  F++V  YV  
Sbjct: 127 IAIFAILFSVYGRMIADPVVAEVTPGGAAAAAGILPGDLLVAIDGSKVETFDDVRRYVAI 186

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET--KLHSRTV 220
            P  +I + + R     L + ++P+  D  D+FG K ++  +GI  + +    +L + T 
Sbjct: 187 RPSQKIVVTVERGGQK-LDVPMVPQRTDRTDQFGNKIELGQIGIVTNKEAGNFRLRNYTP 245

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           L++   G+ E + I  G    +++ F    R +Q+ GP+ +A+ +      G  A +   
Sbjct: 246 LEAVREGVIESAGIVTGTFKYIANIFAGSMRADQLGGPIRVAQASGQMASLGIGAVLQLA 305

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           A  S +IG +NL+P+P+LDGGHL+ + +E +RG+ LG     +  R+GL +IL L     
Sbjct: 306 ATLSVSIGLLNLMPVPVLDGGHLMFYAVEAVRGRPLGAKAQEIAFRIGLAMILTLMVFTT 365

Query: 341 RNDI 344
            NDI
Sbjct: 366 WNDI 369


>gi|254502474|ref|ZP_05114625.1| RIP metalloprotease RseP [Labrenzia alexandrii DFL-11]
 gi|222438545|gb|EEE45224.1| RIP metalloprotease RseP [Labrenzia alexandrii DFL-11]
          Length = 378

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 133/356 (37%), Positives = 191/356 (53%), Gaps = 22/356 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH+ VAR CN++V +FSVGFG EL G   + G RWKVSLIPLGGYV F+ 
Sbjct: 22  LTIVVFFHELGHFAVARWCNVKVDAFSVGFGRELFGWYDKHGTRWKVSLIPLGGYVKFAG 81

Query: 74  D----------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFT--FFFYN 114
           D                E++ R+ F A P W++   V AGP+AN ++A++ F   F  Y 
Sbjct: 82  DENAASVPDREYIASMSEEERRTAFIAKPVWQRAAIVAAGPIANFILAVIIFAGIFMAYG 141

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
              + PVVS V   S A  AG++ GD I+S++   +S FE++   VR NP   + L + R
Sbjct: 142 KPQLLPVVSTVIEGSAAETAGIQTGDRILSINDKPLSYFEDLKWTVRHNPDQPLVLGIER 201

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETK--LHSRTVLQSFSRGLDEIS 232
           +    L   V+P     V++FG++ + P +G++ + DE    L    V  +   G+    
Sbjct: 202 DG-AELTATVVPVYVTDVNQFGVEYREPRIGVAIASDENTRILKQLGVGGALWEGVLRTY 260

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            I    +  +   F  +    Q+ GP+ IA+++      G    I+     S +IGF+NL
Sbjct: 261 KIIYDTINFIGEMFAGEQSPQQLGGPIQIAQVSGTVAQFGLIELISLAGFLSVSIGFINL 320

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIPILDGGHL+ +  E IRGK L   V  V  R+GL ++L L      NDI+ LM
Sbjct: 321 LPIPILDGGHLVFYAAEAIRGKPLNEKVQEVGFRIGLGLVLMLMVFATWNDIWRLM 376


>gi|15965254|ref|NP_385607.1| hypothetical protein SMc02095 [Sinorhizobium meliloti 1021]
 gi|307317019|ref|ZP_07596460.1| membrane-associated zinc metalloprotease [Sinorhizobium meliloti
           AK83]
 gi|20978826|sp|Q92Q49|Y1501_RHIME RecName: Full=Putative zinc metalloprotease R01501
 gi|15074434|emb|CAC46080.1| Zinc metalloprotease [Sinorhizobium meliloti 1021]
 gi|306897107|gb|EFN27852.1| membrane-associated zinc metalloprotease [Sinorhizobium meliloti
           AK83]
          Length = 374

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 187/345 (54%), Gaps = 22/345 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED---- 74
           HE GHY+V R   IR+L+FSVGFGPEL G T R G RWK   +PLGGYV F   ED    
Sbjct: 26  HEMGHYLVGRWSGIRILAFSVGFGPELFGWTDRHGTRWKFCAVPLGGYVKFFGDEDAAST 85

Query: 75  -----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                      E+  R+F  A  WK+  TV AGP+AN ++AI  F   F  Y   V  PV
Sbjct: 86  PDYRRLETIAPEERGRTFLGAKLWKRAATVAAGPIANFLLAIAIFAVLFSIYGRAVADPV 145

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V+ V+P S A  AGV  GD ++S+DG  ++ F++V  YV   P   I++ + RE   +  
Sbjct: 146 VAFVAPDSAAEKAGVLPGDRLLSIDGKPIATFDDVRRYVSVRPELPITVRIEREGAAI-D 204

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEISSITRGFL 239
           L ++P+  ++VD  G K +   +GI  + +       T   L++  +G  +   I  G L
Sbjct: 205 LPMVPQRTESVDPLGNKMEEGKIGIGTNQEAGNFRVETYGPLEAVGQGALQSWRIVTGTL 264

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
             LS+ F      +Q+ GP+ IA+++      G    + F A+ S +IG +NL+P+P+LD
Sbjct: 265 DYLSNLFVGRMSADQVGGPIRIAQMSGQMAKLGIAEVLNFAAVLSVSIGLLNLMPVPVLD 324

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GGHL+ + +E +RG+ +G +   +  R+G  ++L L      NDI
Sbjct: 325 GGHLMFYAVEALRGRPVGPAAQDLAFRIGFAMVLMLTVFAAWNDI 369


>gi|307309277|ref|ZP_07588945.1| membrane-associated zinc metalloprotease [Sinorhizobium meliloti
           BL225C]
 gi|306900278|gb|EFN30895.1| membrane-associated zinc metalloprotease [Sinorhizobium meliloti
           BL225C]
          Length = 374

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 187/345 (54%), Gaps = 22/345 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED---- 74
           HE GHY+V R   IR+L+FSVGFGPEL G T R G RWK   +PLGGYV F   ED    
Sbjct: 26  HEMGHYLVGRWSGIRILAFSVGFGPELFGWTDRHGTRWKFCAVPLGGYVKFFGDEDAAST 85

Query: 75  -----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                      E+  R+F  A  WK+  TV AGP+AN ++AI  F   F  Y   V  PV
Sbjct: 86  PDYRRLEAIAPEERGRTFLGAKLWKRAATVAAGPIANFLLAIAIFAVLFSIYGRAVADPV 145

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V+ V+P S A  AGV  GD ++S+DG  ++ F++V  YV   P   I++ + RE   +  
Sbjct: 146 VAFVAPDSAAEKAGVLPGDRLLSIDGKPIATFDDVRRYVSVRPELPITVRIEREGAAI-D 204

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEISSITRGFL 239
           L ++P+  ++VD  G K +   +GI  + +       T   L++  +G  +   I  G L
Sbjct: 205 LPMVPQRTESVDPLGNKMEEGKIGIGTNQEAGNFRVETYGPLEAVGQGALQSWRIVTGTL 264

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
             LS+ F      +Q+ GP+ IA+++      G    + F A+ S +IG +NL+P+P+LD
Sbjct: 265 DYLSNLFVGRMSADQVGGPIRIAQMSGQMAKLGIAEVLNFAAVLSVSIGLLNLMPVPVLD 324

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GGHL+ + +E +RG+ +G +   +  R+G  ++L L      NDI
Sbjct: 325 GGHLMFYAVEALRGRPVGPAAQDLAFRIGFAMVLMLTVFAAWNDI 369


>gi|114704869|ref|ZP_01437777.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Fulvimarina pelagi HTCC2506]
 gi|114539654|gb|EAU42774.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Fulvimarina pelagi HTCC2506]
          Length = 379

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 136/368 (36%), Positives = 200/368 (54%), Gaps = 26/368 (7%)

Query: 5   DCFLLYTVS----LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           D  L+Y +     L +IV  HE GHY+V R C IR L+FSVGFGPEL+G+T + G RWK+
Sbjct: 12  DGGLMYIIPFLFVLTVIVFFHELGHYLVGRWCGIRSLAFSVGFGPELLGVTDKRGTRWKL 71

Query: 61  SLIPLGGYVSFSEDEK---------------DMR--SFFCAAPWKKILTVLAGPLANCVM 103
           S IPLGGYV F  DE                D R  +F  A+  ++  TV AGP+AN ++
Sbjct: 72  SAIPLGGYVKFFGDESAASTPDREAVSAMNADERREAFPTASVGRRAATVAAGPIANFIL 131

Query: 104 AILFFTFFFYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR 161
           AI+ F    +  G  V  P+V++V   SPA  AG + GD I ++DG  ++ F ++  YV 
Sbjct: 132 AIVIFAAVAFVNGRTVADPIVADVVAGSPAEAAGFEAGDRIDAVDGNPITYFSDLQNYVS 191

Query: 162 ENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV- 220
            +    I + + R     L L V PR+++  D FG    VP +GI  S D +   +  + 
Sbjct: 192 GHGEQPIVVTVDRGGR-TLDLDVTPRIEERDDGFGKTYNVPVIGIIASGDASSFRTEELG 250

Query: 221 -LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAF 279
            LQ+F  G+++   +T   +  +          +QI GP+ IA+++    + G  A +  
Sbjct: 251 PLQAFGYGVEQTWFVTTRTVDFIGQVITGRQNADQIGGPIRIAQVSGEVSNLGLGALLNL 310

Query: 280 LAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLG 339
            A+ S +IG +NLLPIP+LDGGHL+ +  E IRGK L  +V  V  R+GL +++ L    
Sbjct: 311 AALLSVSIGLLNLLPIPMLDGGHLLFYAFEAIRGKPLSENVQEVGFRIGLALVMMLMVFA 370

Query: 340 IRNDIYGL 347
             ND+ GL
Sbjct: 371 FWNDLSGL 378


>gi|325292743|ref|YP_004278607.1| hypothetical zinc metalloprotease [Agrobacterium sp. H13-3]
 gi|325060596|gb|ADY64287.1| hypothetical zinc metalloprotease [Agrobacterium sp. H13-3]
          Length = 377

 Score =  216 bits (550), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 185/351 (52%), Gaps = 26/351 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED---- 74
           HE GHY+V R   IR  +FS+GFGPELIG T R G RWK+S IPLGGYV F   ED    
Sbjct: 29  HEMGHYLVGRWSGIRSTAFSIGFGPELIGFTDRHGTRWKISAIPLGGYVKFFGDEDASSK 88

Query: 75  -----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                      E+  ++   A  WK+  TV AGP+AN ++AI  F   F  Y   +  PV
Sbjct: 89  PDSSGLSHMSLEERAQTLSGAKLWKRAATVAAGPIANFILAIFIFAVLFGVYGRMIADPV 148

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V+ V   S AA AGV  GD ++++DG  V  FE+V  YV   P   I++ + R     L 
Sbjct: 149 VAEVRENSAAAAAGVHPGDRLVAIDGEKVKTFEDVRRYVGIRPGTPITVTVERAGE-ELK 207

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFS----RGLDEISSITRG 237
           L ++P   +T D+FG K ++  +GI    D+   + R +  S S     G+ E   +  G
Sbjct: 208 LPMVPTRTETTDQFGNKLEMGIIGI--VTDQNSGNFRHIEYSPSEALLEGVRETGHVITG 265

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
               + +        +Q+ GPV +A+ +      G +A I   A+ S +IG +NL+P+P+
Sbjct: 266 TFNYIGNLVTGRMNADQLGGPVRVAQASGQMATLGISAVIQLAAVLSVSIGLLNLMPVPV 325

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LDGGHL+ + +E IRG+ LG     V  R+G+ +IL L      NDI  L+
Sbjct: 326 LDGGHLVFYAIEAIRGRPLGAGAQEVAFRIGMAMILGLMVFATWNDISSLI 376


>gi|150396356|ref|YP_001326823.1| putative membrane-associated zinc metalloprotease [Sinorhizobium
           medicae WSM419]
 gi|150027871|gb|ABR59988.1| putative membrane-associated zinc metalloprotease [Sinorhizobium
           medicae WSM419]
          Length = 374

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 187/345 (54%), Gaps = 22/345 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED---- 74
           HE GHY+V R   IR+L+FSVGFGPEL G T R G RWK   IPLGGYV F   ED    
Sbjct: 26  HEMGHYLVGRWSGIRILAFSVGFGPELFGWTDRHGTRWKFCAIPLGGYVKFFGDEDAAST 85

Query: 75  -----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                      E+  R+F  A  WK+  TV AGP+AN ++AI  F   F  Y   V  PV
Sbjct: 86  PDYRRLETIAPEERGRTFLGAKLWKRAATVAAGPIANFLLAIAIFAVLFSIYGRAVADPV 145

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V+ V+P S A  AGV  GD ++S+DG  ++ F++V  YV   P   I++ + RE   +  
Sbjct: 146 VAFVAPGSAAEKAGVLPGDRLLSIDGEPIATFDDVRRYVSVRPELPITVRIEREGAAI-D 204

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEISSITRGFL 239
           + ++P+  ++VD  G K +   +GI  + +       T   +++  +G  +   I  G L
Sbjct: 205 VPMVPQRTESVDPLGNKMEEGKIGIGTNQEAGNFRVETYGPVEAVGQGALQSWRIVTGTL 264

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
             LS+ F      +Q+ GP+ IA+++      G    + F A+ S +IG +NL+P+P+LD
Sbjct: 265 DYLSNLFVGRMSADQVGGPIRIAQMSGQMAKLGIAEVLNFAAVLSVSIGLLNLMPVPVLD 324

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GGHL+ + +E +RG+ +G +   +  R+G  ++L L      NDI
Sbjct: 325 GGHLMFYAVEALRGRPVGPAAQDLAFRIGFAMVLMLTVFAAWNDI 369


>gi|227821903|ref|YP_002825873.1| zinc metallopeptidase [Sinorhizobium fredii NGR234]
 gi|227340902|gb|ACP25120.1| zinc metallopeptidase [Sinorhizobium fredii NGR234]
          Length = 374

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 184/345 (53%), Gaps = 22/345 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED---- 74
           HE GHY+V R   IR+++FSVGFGPEL G T R G RWK   IPLGGYV F   ED    
Sbjct: 26  HEMGHYLVGRWSGIRIVAFSVGFGPELFGWTDRHGTRWKFCAIPLGGYVKFFGDEDAAST 85

Query: 75  -----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                      E+  R+F  A  WK+  TV AGP+AN ++AI  F   F  Y   V  PV
Sbjct: 86  PDYRRLETIRPEERARTFLGAKLWKRAATVAAGPIANFLLAIAIFAVLFSIYGRAVADPV 145

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V+ V+P S A  AGV  GD +IS+DG  ++ F++V  YV   P   I + + R    V  
Sbjct: 146 VAFVAPGSAAEKAGVLPGDRLISIDGKRIATFDDVRRYVSVRPDLPIKVRIDRAGAEV-D 204

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEISSITRGFL 239
           L ++P+  ++VD  G K +   +GI  + +       T   L++  +G  +   I  G  
Sbjct: 205 LDMVPQRTESVDPLGNKVEEGKIGIGTNQEAGNFRVETYGPLEAVGQGALQSWRIVTGTF 264

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
             LS+ F      +Q+ GP+ IA+++      G    + F A+ S +IG +NL+P+P+LD
Sbjct: 265 DYLSNLFVGRMNADQVGGPIRIAQMSGQMAKLGIAEVLNFAAVLSVSIGLLNLMPVPVLD 324

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GGHL+ + +E +RGK +G +   +  R+G  ++L L      NDI
Sbjct: 325 GGHLMFYAVEALRGKPVGPAAQELAFRIGFAMVLMLTVFAAWNDI 369


>gi|254469847|ref|ZP_05083252.1| RIP metalloprotease RseP [Pseudovibrio sp. JE062]
 gi|211961682|gb|EEA96877.1| RIP metalloprotease RseP [Pseudovibrio sp. JE062]
          Length = 378

 Score =  212 bits (539), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 192/362 (53%), Gaps = 22/362 (6%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   + +   L ++V  HE GH++VAR C +RVL+FSVGFGPEL G   + G RWKV  I
Sbjct: 12  LGVIIPFLAVLTVVVFFHELGHFLVARWCGVRVLAFSVGFGPELFGRDDKHGTRWKVCAI 71

Query: 64  PLGGYVSFSEDE-------KDMR----------SFFCAAPWKKILTVLAGPLANCVMAIL 106
           PLGGYV FS DE       +D +          +FF   PW++   V AGP+AN ++AIL
Sbjct: 72  PLGGYVKFSGDENAASVPDRDEQARMDEETRRTAFFAKNPWQRSAIVAAGPIANFILAIL 131

Query: 107 FFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
            F   F   G  +  P V  V P S A +AG+  GD I+++DG  V +F +V   V  + 
Sbjct: 132 IFAAMFGFLGKYETLPRVDQVRPGSAAEMAGMMPGDLIVAIDGSPVESFSDVQRLVTASA 191

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGI--SFSYDETKLHSRTVLQ 222
              + + + R    +  L   P LQ+  D FG  ++V  +GI  + S ++  +     ++
Sbjct: 192 GVPMEIDVERGDA-IERLTATPELQEISDGFGNTQKVGILGIQRNTSQEDIIVKRFGPVE 250

Query: 223 SFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
           +   G+ E   I    LG +   F      +Q+ GP+ +A+I+     HG    I   A+
Sbjct: 251 AVGEGVKETWYILDRTLGYIGGLFLGKEDPDQLGGPIRVAQISGQVATHGILPLINLTAV 310

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S +IG +NL+P+P+LDGGHL+ +++E++RGK L   +     R+G+ ++L L      N
Sbjct: 311 LSISIGLLNLMPVPMLDGGHLLYYIIEIVRGKPLSEKLQDFGFRIGITLVLLLMVFATWN 370

Query: 343 DI 344
           D+
Sbjct: 371 DL 372


>gi|218461644|ref|ZP_03501735.1| metallopeptidase protein [Rhizobium etli Kim 5]
          Length = 348

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 188/343 (54%), Gaps = 22/343 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F +   + + + L ++V +HE GHY+V R   IR+L+FSVGFGPE+ G T R G RWK+S
Sbjct: 7   FLMGNVVTFILVLSLLVFVHEMGHYLVGRWSGIRILAFSVGFGPEIFGFTDRHGTRWKIS 66

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
            IPLGGYV F   ED               E   RSF  A  WK+  TV AGP+AN ++A
Sbjct: 67  AIPLGGYVRFFGDEDVSSKPDNDGIAAMSEEDRARSFAGAKLWKRAATVAAGPIANFLLA 126

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  F   F  Y   +  PVV+ V+P   AA AG+  GD ++++DG  V  F++V  YV  
Sbjct: 127 IAIFAVLFSVYGRMIADPVVAEVAPDGAAAAAGILPGDLLVAIDGNKVETFDDVRRYVAI 186

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET--KLHSRTV 220
            P  +I + + R     L + ++P+  D  D+FG K ++  +GI  + +    +L + T 
Sbjct: 187 RPSQKIIVTVERGGQK-LDVPMVPQRTDRTDQFGNKIELGQIGIITNKEAGNFRLRTYTP 245

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           L++   G+ E + I  G    +++ F    R +Q+ GP+ +A+ +      G  A +   
Sbjct: 246 LEAVREGVIESAGIVTGTFKYIANIFAGSMRADQLGGPIRVAQASGQMASLGIGAVLQLA 305

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRV 323
           A  S +IG +NL+P+P+LDGGHL+ + +E +RG+ LG     +
Sbjct: 306 AALSVSIGLLNLMPVPVLDGGHLMFYAVEAVRGRPLGSKAQEI 348


>gi|328543718|ref|YP_004303827.1| RIP metalloprotease RseP [polymorphum gilvum SL003B-26A1]
 gi|326413462|gb|ADZ70525.1| RIP metalloprotease RseP [Polymorphum gilvum SL003B-26A1]
          Length = 378

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 122/356 (34%), Positives = 193/356 (54%), Gaps = 24/356 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L ++V  HE GH++VAR C ++V +FSVGFG EL G T R G RW++S IPLGGYV F+ 
Sbjct: 22  LTVVVFFHELGHFLVARWCGVKVDAFSVGFGTELAGFTDRKGTRWRLSAIPLGGYVKFAG 81

Query: 74  DE----------------KDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           DE                ++ RS F A P W++   V AGP+AN ++AI+ F F F   G
Sbjct: 82  DENASSMPDRERIAAMSAEERRSAFVAKPVWQRAAVVAAGPIANFLLAIVIFAFVFAAFG 141

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V  P++  V P S A  A ++ GD ++++DG  ++ F E+   V  +    + L + R
Sbjct: 142 RVVTSPLIEKVQPESAAEQANLQPGDLVLAVDGKPITTFSELQRIVTVSADVPLQLDIDR 201

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFS---YDETKLHSRTVLQSFSRGLDEI 231
           +   VL ++V P+ ++  D FG  +++  +G++ S    D T +H    L++ + G  E 
Sbjct: 202 KG-EVLRIEVTPQHREVTDSFGNTQRIGLLGVTRSPKPEDLTVIHYGP-LEALAEGARET 259

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
             +    LG L          +Q+ GP+ +A+++      GF   ++  A+ S +IG +N
Sbjct: 260 YFVVERTLGYLGGVLTGRESADQLGGPIRVAQVSGQVATLGFVPLLSLAAVLSVSIGLLN 319

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           L+PIP+LDGGHL+ +  E +RGK L   V     R+G+ ++L L      ND+  L
Sbjct: 320 LMPIPMLDGGHLVYYFAEAVRGKPLSERVQDFGFRIGIALVLMLMIFATWNDVLRL 375


>gi|307942149|ref|ZP_07657500.1| RIP metalloprotease RseP [Roseibium sp. TrichSKD4]
 gi|307774435|gb|EFO33645.1| RIP metalloprotease RseP [Roseibium sp. TrichSKD4]
          Length = 378

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 120/357 (33%), Positives = 194/357 (54%), Gaps = 22/357 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH+ VAR C ++V +FSVGFG EL G   + G RWK+SLIPLGGYV F+ 
Sbjct: 22  LTIVVFFHELGHFSVARWCKVKVDAFSVGFGRELFGFNDKHGTRWKLSLIPLGGYVKFAG 81

Query: 74  D-----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D                 E+   +F     W++   V AGP+AN +++I+ F F F + G
Sbjct: 82  DENAASIPDRDRIAAMSEEERATAFVAKTVWQRAAIVAAGPVANFLLSIVIFAFLFMSFG 141

Query: 117 VMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
            M   PVV +V   S A +AG+  GD I+++DG+ V  F ++   V  +    + L + R
Sbjct: 142 KMVTLPVVDSVRDGSAAQVAGIMPGDQILAVDGVPVETFNDLQRIVSTSADIPLQLDVGR 201

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEIS 232
               ++ L V P+L++  D FG  +++  +GI+ S ++  + +++   L++ S G+ E  
Sbjct: 202 GS-EMVTLTVTPQLKEITDNFGNTQRIGLLGITRSIEQGTIINKSFGPLEAVSEGVSETL 260

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            I +  LG L          +Q+ GP+ +A+++      G    ++  A+ S +IG +NL
Sbjct: 261 YIAQRTLGYLGGVITGREPADQLGGPIRVAQVSGQVATQGIVPLLSLAAVLSISIGLLNL 320

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           +P+P+LDGGHL+ +  E +RGK L   V  +  R+GL ++L L      ND+  L +
Sbjct: 321 MPVPMLDGGHLVYYAAEAVRGKPLSERVQDIGFRVGLALVLMLMVFATWNDVLHLSK 377


>gi|163760889|ref|ZP_02167968.1| zinc metallopeptidase [Hoeflea phototrophica DFL-43]
 gi|162281933|gb|EDQ32225.1| zinc metallopeptidase [Hoeflea phototrophica DFL-43]
          Length = 377

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 180/352 (51%), Gaps = 22/352 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GHY+V R C IR   FSVGFG ELIG T R G RWK+SL+PLGGYV F  
Sbjct: 22  LTIVVFFHELGHYLVGRWCGIRAEVFSVGFGRELIGFTDRHGTRWKLSLVPLGGYVKFLG 81

Query: 74  DE-----------------KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           DE                 +  ++F  AA W++  TV AGP+AN ++AI  F   F   G
Sbjct: 82  DENATSLPTGGEGPALSEAERAQAFPNAALWRRAATVAAGPIANFILAIAIFAVMFGLNG 141

Query: 117 VM--KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
            M   PVV+ V   S A  AG+  GD  +++D   V  F++V  YV   P   I++ + R
Sbjct: 142 RMIADPVVAEVQAESAAQAAGILPGDRFVAIDDTPVETFDDVQRYVSVRPGVAITITMDR 201

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEIS 232
               V  L + P   +  D FG K +V  +G+  + D      R    L++   G+ +  
Sbjct: 202 NGSPV-DLTLTPVRTEIADNFGNKMEVGRIGVITNTDAGNFRVREYGPLEAVGEGVAQSW 260

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            I    +  + +      + +Q+ GP+ +A+ +K+    G  A I   A+ S +IG +NL
Sbjct: 261 YIVTRTVDYIGNIIIGREKPDQLGGPIRVAKYSKDMSTLGIAALIQLAAVLSVSIGLLNL 320

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +PIP+LDGGHL+ +  E +RG+  G  V     R GL ++L L      ND+
Sbjct: 321 MPIPMLDGGHLVFYAFEAVRGRPPGEVVQEWAYRFGLTVVLALMLFATWNDV 372


>gi|90419598|ref|ZP_01227508.1| membrane-associated zinc metalloprotease [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336535|gb|EAS50276.1| membrane-associated zinc metalloprotease [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 379

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 187/356 (52%), Gaps = 22/356 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L IIV  HE GH++V R C I+ L FSVGFGPELIG   R G RWK++ +PLGGYV F  
Sbjct: 25  LTIIVFFHELGHFLVGRWCGIKALVFSVGFGPELIGFNDRRGTRWKLAAVPLGGYVKFLG 84

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           DE                     +F   +  ++  TV AGP+AN ++AI+ F    Y  G
Sbjct: 85  DENAASVPDRAAMDAMSDAERSGAFPAKSVGRRAATVAAGPIANFILAIVIFAGVAYVEG 144

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V  PVV+ V   SPAA AG K GD ++S DG T+  F ++  YV       I + + R
Sbjct: 145 RVVGDPVVAEVRDGSPAAAAGFKAGDKVLSADGETIRYFSDLQRYVSSRADTPIRMTVER 204

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET--KLHSRTVLQSFSRGLDEIS 232
               V  L V PR +   D FG +  VP VG+  + D +  ++ S + +++ + G+ +  
Sbjct: 205 NGSPV-ELTVTPRSEVQTDGFGNEFNVPVVGLVANNDGSSFRVESLSPVEAVAYGVSQTW 263

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +T   +  +          +QI GP+ IA+++      G  A +   A+ S +IG +NL
Sbjct: 264 FVTTRTVDFMGEVITGRQNADQIGGPIRIAQVSSQVSTIGLGALLNLAALLSVSIGLLNL 323

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIP+LDGGHL+ +  E IRG+ L   V  V  R+GL +++ L      NDI GL+
Sbjct: 324 LPIPMLDGGHLLFYAFEAIRGRPLSEQVQEVGFRIGLALVMLLMVFAFWNDISGLV 379


>gi|88658328|ref|YP_507855.1| putative membrane-associated zinc metalloprotease [Ehrlichia
           chaffeensis str. Arkansas]
 gi|88599785|gb|ABD45254.1| putative membrane-associated zinc metalloprotease [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 380

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 194/369 (52%), Gaps = 26/369 (7%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+L  FL   + + IIV +HE+GHY+VA+LCN++V  FS+GFGPEL GI  +SG RWK S
Sbjct: 17  FYLLSFL---IIMSIIVFVHEYGHYIVAKLCNVKVEVFSIGFGPELFGINDKSGTRWKFS 73

Query: 62  LIPLGGYVSF--SED------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAIL 106
           +IP+GGYV     ED            E+D    FC  P ++K L V AGP AN V AI+
Sbjct: 74  VIPIGGYVKMLGDEDPASVEANPNRLSEEDKLLAFCEKPLYQKFLIVFAGPFANLVFAIV 133

Query: 107 FFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
               FF   G+MK   V+  V   S A  AG+  GD I+ ++   V  FEE+  Y+ +  
Sbjct: 134 VLMMFFTTKGMMKHNSVIGGVVQDSAAQHAGLASGDTILKINDYQVKWFEEIKQYIEKYA 193

Query: 165 LHEISLVLYREHVGVLH-LKVMPRLQDTVDRFGIKRQVPSVGISFS--YDETKLHSRTVL 221
                L +     G +H +KV P +++    FG  ++ P +G++ S      +    ++ 
Sbjct: 194 KDNQELTIEYARDGHIHVVKVKPSIKEEKGLFGSIKKSPFLGVTMSNVLSNYEFQRLSIT 253

Query: 222 QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLA 281
            +F + ++    +++    VL         ++++ GP+ IA+ +     H  N  +  +A
Sbjct: 254 SAFVQSINYTYLLSKSIFQVLGQMLVGKRSISELGGPIRIAQYSGESVKH--NEVLLCMA 311

Query: 282 MFSWAIGFMNLLPIPILDGGHLITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           M S  +G MNLLPIP+LDGGH+  + ++ I R K L     R I+ +GL ++L L     
Sbjct: 312 MISINLGVMNLLPIPMLDGGHIFQYFVQAILRRKQLNPKYQRYISTIGLMLLLSLMIFVT 371

Query: 341 RNDIYGLMQ 349
            NDI  + +
Sbjct: 372 FNDIKSMFK 380


>gi|68171449|ref|ZP_00544837.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999130|gb|EAM85792.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Ehrlichia chaffeensis str. Sapulpa]
          Length = 387

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 194/369 (52%), Gaps = 26/369 (7%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+L  FL   + + IIV +HE+GHY+VA+LCN++V  FS+GFGPEL GI  +SG RWK S
Sbjct: 24  FYLLSFL---IIMSIIVFVHEYGHYIVAKLCNVKVEVFSIGFGPELFGINDKSGTRWKFS 80

Query: 62  LIPLGGYVSF--SED------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAIL 106
           +IP+GGYV     ED            E+D    FC  P ++K L V AGP AN V AI+
Sbjct: 81  VIPIGGYVKMLGDEDPASVEANPNRLSEEDKLLAFCEKPLYQKFLIVFAGPFANLVFAIV 140

Query: 107 FFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
               FF   G+MK   V+  V   S A  AG+  GD I+ ++   V  FEE+  Y+ +  
Sbjct: 141 VLMMFFTTKGMMKHNSVIGGVVQDSAAQHAGLASGDTILKINDYQVKWFEEIKQYIEKYA 200

Query: 165 LHEISLVLYREHVGVLH-LKVMPRLQDTVDRFGIKRQVPSVGISFS--YDETKLHSRTVL 221
                L +     G +H +KV P +++    FG  ++ P +G++ S      +    ++ 
Sbjct: 201 KDNQELTIEYARDGHIHVVKVKPSIKEEKGLFGSIKKSPFLGVTMSNVLSNYEFQRLSIT 260

Query: 222 QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLA 281
            +F + ++    +++    VL         ++++ GP+ IA+ +     H  N  +  +A
Sbjct: 261 SAFVQSINYTYLLSKSIFQVLGQMLVGKRSISELGGPIRIAQYSGESVKH--NEVLLCMA 318

Query: 282 MFSWAIGFMNLLPIPILDGGHLITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           M S  +G MNLLPIP+LDGGH+  + ++ I R K L     R I+ +GL ++L L     
Sbjct: 319 MISINLGVMNLLPIPMLDGGHIFQYFVQAILRRKQLNPKYQRYISTIGLMLLLSLMIFVT 378

Query: 341 RNDIYGLMQ 349
            NDI  + +
Sbjct: 379 FNDIKSMFK 387


>gi|146341062|ref|YP_001206110.1| putative Zinc metalloprotease [Bradyrhizobium sp. ORS278]
 gi|146193868|emb|CAL77885.1| putative Zinc metalloprotease [Bradyrhizobium sp. ORS278]
          Length = 383

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/355 (33%), Positives = 181/355 (50%), Gaps = 22/355 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH+++AR   ++VL+FS+GFGPELIG   R   RWK+S IPLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLIARWAGVKVLTFSLGFGPELIGFNDRHNTRWKISAIPLGGYVKFFG 86

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYN 114
           DE +                   SF      ++   V AGP+AN ++A++ F     ++ 
Sbjct: 87  DESEASTPSTEALAKMTEQERADSFHHKTVGQRAAIVAAGPIANFILAVVIFAGMALYFG 146

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
                P V  V P S AA AG K GD I ++DG  +  F ++   V  N   E+S ++ R
Sbjct: 147 KPNTTPRVDAVQPDSVAAAAGFKTGDVIAAIDGRAIETFADMQRVVSVNAGSELSFLIKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSY--DETKLHSRTVLQSFSRGLDEIS 232
           +    L LK  P L++  D FG   ++  +GI ++   DE++      L+S   G +++ 
Sbjct: 207 DGT-ELTLKATPALKEVKDTFGNSHRIGVLGIQYNAKPDESRAIPVGFLESIKFGFEQVW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            I       + S F        + GP+ IA+++      GF   + + AM S +IG +NL
Sbjct: 266 FIITTTFKFIGSLFAGSGNAGDLGGPIRIAQLSGQAASLGFQVLVNWCAMISVSIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            P+P+LDGGHL+ + +E +RG+ L      +  R+GL ++L L      NDI  L
Sbjct: 326 FPVPLLDGGHLLFYGVEAVRGRPLSERAQEMGFRIGLGLVLMLMVFATYNDILHL 380


>gi|86749938|ref|YP_486434.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Rhodopseudomonas palustris HaA2]
 gi|86572966|gb|ABD07523.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Rhodopseudomonas palustris HaA2]
          Length = 383

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/355 (33%), Positives = 180/355 (50%), Gaps = 22/355 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH++VAR   +RVL+FS+GFGPE+ G   R G RWK+S IPLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVARWNGVRVLTFSLGFGPEIAGFNDRHGTRWKLSAIPLGGYVKFFG 86

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           DE +                   SF       +   V+AGPLAN ++AI+ FTF F   G
Sbjct: 87  DESEASTPSTDSLSKMSAEERSVSFHHKKVGPRAAIVVAGPLANFILAIVLFTFLFSVFG 146

Query: 117 V--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
           V      V N+ P S A   G K GD ++++DG  +  F+E+   V      ++   + R
Sbjct: 147 VPSTSARVDNIQPGSAAEAGGFKPGDIVVAIDGSPIQNFQEMQRTVSREAGRQLDFTVKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR--GLDEIS 232
                + LK  P L++  DRFG  +++  +GIS S    ++ +  +  + +   G+ E  
Sbjct: 207 -GTETVDLKATPELREIKDRFGNAQRLGILGISRSTSANEVTTERLNPAAAAWMGVKETW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +       +   F      +Q+ GP+ IA+I+      GF   +   A+ S +IG +NL
Sbjct: 266 FVVDRTFAYIGGLFAGREAADQLGGPLRIAQISGQVATIGFTPLLHLAAVLSISIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            P+P+LDGGHL+ + +E +RG+ L      +  R+GL ++L L      NDI  L
Sbjct: 326 FPVPLLDGGHLMFYAIEAVRGRPLSERAQEMGFRIGLGLVLMLMVFATYNDILHL 380


>gi|49475415|ref|YP_033456.1| membrane-associated zinc metalloprotease [Bartonella henselae str.
           Houston-1]
 gi|49238221|emb|CAF27431.1| Membrane-associated zinc metalloprotease [Bartonella henselae str.
           Houston-1]
          Length = 382

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 122/359 (33%), Positives = 187/359 (52%), Gaps = 31/359 (8%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           ++II+ +HE GHY++ R C I+   FS+GFGP+++G T + G +W+++LIPLGGYV F  
Sbjct: 24  IMIIIFVHEAGHYLIGRWCGIKASVFSLGFGPQIVGYTDKRGTQWRLALIPLGGYVKFIG 83

Query: 74  DEKDMR------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMK 119
           DE+ +             SF  A  WKK  TV AGPL N +  ++  TFFF+  G   ++
Sbjct: 84  DEEGLHGTSSQSLPIVDGSFGSAHAWKKAATVFAGPLFNVLFTVVILTFFFFTYGRVAIE 143

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
           PVV +    SPA  AG++ GD  I +DG  V +FE++  YV  +    I   + R    V
Sbjct: 144 PVVGSFVKDSPAVQAGLQLGDRFIEMDGQQVESFEDLMNYVTFHGGDPIEFKMERSGQ-V 202

Query: 180 LHLKVMPRLQDTVDRFG--IKRQVPSVGISFSYDE----TKLHSRTVLQSFSRGLDEIS- 232
               + P++ +  D FG  ++  +  VG+    D        + + +  SF R L E S 
Sbjct: 203 FTTVITPKVVERDDGFGNRVRSGLMGVGVPVDPDNPARLDPAYVKHIRYSFGRALREASK 262

Query: 233 ------SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
                 + T  F+G L        RL   SGP    +IA    + GF + + F A  S  
Sbjct: 263 RATFIVTQTVFFMGRLLGGKEDHCRL---SGPSKTVKIAWQVSETGFLSLLNFTAFLSIG 319

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           +G +NL PIP LDGG+L+  ++E+I G+ +   +  +I R+GLC +L   F  + ND +
Sbjct: 320 VGLINLFPIPPLDGGYLLFHVVEIITGRPISAKIREIIFRLGLCFVLLFMFFALFNDYF 378


>gi|18252648|gb|AAL66373.1|AF461795_1 unknown [Bartonella henselae]
          Length = 358

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 122/358 (34%), Positives = 189/358 (52%), Gaps = 31/358 (8%)

Query: 15  IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED 74
           +II+ +HE GHY++ R C I+   FS+GFGP+++G T + G +W+++LIPLGGYV F  D
Sbjct: 1   MIIIFVHEAGHYLIGRWCGIKASVFSLGFGPQIVGYTDKRGTQWRLALIPLGGYVKFIGD 60

Query: 75  EKDMR------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKP 120
           E+ +             SF  A  WKK  TV AGPL N +  ++  TFFF+  G   ++P
Sbjct: 61  EEGLHGTSSQSLPIVDGSFGSAHAWKKAATVFAGPLFNVLFTVVILTFFFFTYGRVAIEP 120

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           VV +    SPA  AG++ GD  I +DG  V +FE++  YV  +    I   + R    V 
Sbjct: 121 VVGSFVKDSPAVQAGLQLGDRFIEMDGQQVESFEDLMNYVTFHGGDPIEFKMERSGQ-VF 179

Query: 181 HLKVMPRLQDTVDRFG--IKRQVPSVGISFSYDE----TKLHSRTVLQSFSRGLDEIS-- 232
              + P++ +  D FG  ++  +  VG+    D        + + +  SF R L E S  
Sbjct: 180 TTVITPKVVERDDGFGNRVRSGLMGVGVPVDPDNPARLDPAYVKHIRYSFGRALREASKR 239

Query: 233 -----SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
                + T  F+G L    GK+    ++SGP    +IA    + GF + + F A  S  +
Sbjct: 240 ATFIVTQTVFFMGRLLG--GKEDHC-RLSGPSKTVKIAWQVSETGFLSLLNFTAFLSIGV 296

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           G +NL PIP LDGG+L+  ++E+I G+ +   +  +I R+GLC +L   F  + ND +
Sbjct: 297 GLINLFPIPPLDGGYLLFHVVEIISGRPISAKIREIIFRLGLCFVLLFMFFALFNDYF 354


>gi|51704328|sp|Q8VQ25|Y627_BARHE RecName: Full=Putative zinc metalloprotease BH06270
          Length = 358

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 122/358 (34%), Positives = 189/358 (52%), Gaps = 31/358 (8%)

Query: 15  IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED 74
           +II+ +HE GHY++ R C I+   FS+GFGP+++G T + G +W+++LIPLGGYV F  D
Sbjct: 1   MIIIFVHEAGHYLIGRWCGIKASVFSLGFGPQIVGYTDKRGTQWRLALIPLGGYVKFIGD 60

Query: 75  EKDMR------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKP 120
           E+ +             SF  A  WKK  TV AGPL N +  ++  TFFF+  G   ++P
Sbjct: 61  EEGLHGTSSQSLPIVDGSFGSAHAWKKAATVFAGPLFNVLFTVVILTFFFFTYGRVAIEP 120

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           VV +    SPA  AG++ GD  I +DG  V +FE++  YV  +    I   + R    V 
Sbjct: 121 VVGSFVKDSPAVQAGLQLGDRFIEMDGQQVESFEDLMNYVTFHGGDPIEFKMERSGQ-VF 179

Query: 181 HLKVMPRLQDTVDRFG--IKRQVPSVGISFSYDE----TKLHSRTVLQSFSRGLDEIS-- 232
              + P++ +  D FG  ++  +  VG+    D        + + +  SF R L E S  
Sbjct: 180 TTVITPKVVERDDGFGNRVRSGLMGVGVPVDPDNPARLDPAYVKHIRYSFGRALREASKR 239

Query: 233 -----SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
                + T  F+G L    GK+    ++SGP    +IA    + GF + + F A  S  +
Sbjct: 240 ATFIVTQTVFFMGRLLG--GKEDHC-RLSGPSKTVKIAWQVSETGFLSLLNFTAFLSIGV 296

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           G +NL PIP LDGG+L+  ++E+I G+ +   +  +I R+GLC +L   F  + ND +
Sbjct: 297 GLINLFPIPPLDGGYLLFHVVEIITGRPISAKIREIIFRLGLCFVLLFMFFALFNDYF 354


>gi|73667475|ref|YP_303491.1| peptidase RseP [Ehrlichia canis str. Jake]
 gi|72394616|gb|AAZ68893.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Ehrlichia
           canis str. Jake]
          Length = 380

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 191/369 (51%), Gaps = 26/369 (7%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+L  FL     + +IV +HE+GHY+VA+LCN+++  FS+GFGPEL GI  +SG RWK S
Sbjct: 17  FYLLSFL---TIMSVIVFVHEYGHYIVAKLCNVKIEVFSIGFGPELFGINDKSGTRWKFS 73

Query: 62  LIPLGGYVSFSEDEKDMRS--------------FFCAAP-WKKILTVLAGPLANCVMAIL 106
           +IP+GGYV    DE    S               FC  P ++K L V AGPLAN + AI+
Sbjct: 74  IIPIGGYVKMLGDEDPSSSQGGSSHLSEGEKSRAFCEKPLYQKFLIVFAGPLANLIFAII 133

Query: 107 FFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
               FF   G+MK   V+  V   S A  AG+  GD I+ ++   V  FEE+  Y+ +  
Sbjct: 134 VLMMFFTTKGIMKHNSVIGGVLQDSVAEHAGLASGDIILKINDHNVKWFEEIKYYIEKYA 193

Query: 165 LHEISLVLYREHVGVLH-LKVMPRLQDTVDRFGIKRQVPSVGISFS--YDETKLHSRTVL 221
                L++     G +H + + P +++    FG  ++   +GI+ S      +L   +V 
Sbjct: 194 KDTQELIIEYSRNGHIHTVTIKPSIKEEKGSFGQIKKRAFLGITMSNVLSNYELQRLSVT 253

Query: 222 QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLA 281
            +F + +     +++    VL         ++++ GP+ IA+ +     H  N  +  +A
Sbjct: 254 SAFVQSISYTYLLSKSIFQVLGQMLTGKRSISELGGPIRIAQYSGESVKH--NEVLLCMA 311

Query: 282 MFSWAIGFMNLLPIPILDGGHLITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           M S  +G MNLLPIP+LDGGH+  + ++ I R K L     R ++ +GL ++L L     
Sbjct: 312 MISINLGVMNLLPIPMLDGGHIFQYFVQAILRRKQLNPKYQRYVSTIGLMLLLSLMIFVT 371

Query: 341 RNDIYGLMQ 349
            NDI  + +
Sbjct: 372 FNDIKSMFK 380


>gi|49474291|ref|YP_032333.1| membrane-associated zinc metalloprotease [Bartonella quintana str.
           Toulouse]
 gi|49239795|emb|CAF26185.1| Membrane-associated zinc metalloprotease [Bartonella quintana str.
           Toulouse]
          Length = 382

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 187/343 (54%), Gaps = 33/343 (9%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           ++II+ +HE GHY+V R C I+   FS+GFGP+++G T R G +W+++LIPLGGYV F  
Sbjct: 24  VMIIIFVHEAGHYLVGRWCGIKASVFSLGFGPQIVGYTDRHGTQWRLALIPLGGYVKFIG 83

Query: 74  DEKDMR------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMK 119
           DE+++             SF  A  WKK +TV AGPL N +  +   TFFF+  G  V++
Sbjct: 84  DEEEVNVPSSQSLPVVDGSFASAHAWKKAITVFAGPLFNALFTVFILTFFFFMYGRVVIE 143

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG- 178
           PV+ ++   SPA  AG+  GD  I +DG  V +FE++  YV+ +    I   +  E +G 
Sbjct: 144 PVIGSLVKDSPAVQAGLGLGDRFIEMDGRRVESFEDLRNYVKFHGGDPIEFKM--ERMGQ 201

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET------KLHSRTVLQSFSRGLDE-- 230
           V    + P++ +  D FG + Q   +G+    D        + + + V  SFS+ + E  
Sbjct: 202 VFTTVITPKVSERDDGFGNRVQSGVIGVGVPVDRENPQRLDQAYLKHVHYSFSKAVREAS 261

Query: 231 -----ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSW 285
                I+S T  F+  L    GK+    Q+SGP    +IA    + GF + + F A  S 
Sbjct: 262 DRAAFIASQTIFFISRLIR--GKEDHC-QLSGPSKTVKIAWQVSETGFTSLLNFTAFLSI 318

Query: 286 AIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMG 328
            +G +NL PIP LDGGHL+  ++E+I GK +   +  +I R+G
Sbjct: 319 GVGLINLFPIPPLDGGHLLFHVIEIIAGKPISAKIREIIFRLG 361


>gi|254797069|ref|YP_003081907.1| RIP metalloprotease RseP [Neorickettsia risticii str. Illinois]
 gi|254590315|gb|ACT69677.1| RIP metalloprotease RseP [Neorickettsia risticii str. Illinois]
          Length = 366

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 115/360 (31%), Positives = 191/360 (53%), Gaps = 26/360 (7%)

Query: 8   LLYTVSLIIIVVI----HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           LLY  S +++V +    HEFGHY+ A++  ++V  FS+GFG EL G   +SG RWK+S+I
Sbjct: 5   LLYLASFVLVVSVIVFAHEFGHYIFAKMFGVKVEEFSIGFGKELFGFNDKSGTRWKLSMI 64

Query: 64  PLGGYV--------SFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAIL 106
           P GGYV        S + D + +R         +  C   ++K L +  GP AN V A L
Sbjct: 65  PAGGYVKMFGDLDESSATDFEKIRMMDDCMRAQTLNCKPLYQKALVIFGGPFANFVFAFL 124

Query: 107 FFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
             +F +  +    ++PVV++V   SPAA AG + GD I++++   + +F+E+  ++  N 
Sbjct: 125 ILSFLYGCFGKVTVEPVVASVIRDSPAAHAGFRVGDRILTMNNKPIVSFDEIRKFIYLNR 184

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSF 224
              +S  + R     + + V PR++   D FG + ++P +GI  S  + +     VL + 
Sbjct: 185 DSAVSFTVSRNG-DEISISVTPRIEVGEDIFGNREELPKLGIEAS--KIQRSEIGVLDAM 241

Query: 225 SRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFS 284
              L EI ++    L +L        + + I GP+ IA+ +      GF  ++ F+AM S
Sbjct: 242 RFSLIEIGNVVHSTLKLLGQTIAGKAKTDAIGGPIKIAKYSGQSMRMGFTMFLWFMAMLS 301

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             +G  NL PIP+LDGGHL+ +L+E I+G  + V   +   R G+ +++ +    + NDI
Sbjct: 302 INLGLFNLFPIPMLDGGHLLFYLIEWIKGDRVAVGFQQWAGRAGMLLLIAILVFAVFNDI 361


>gi|170738977|ref|YP_001767632.1| membrane-associated zinc metalloprotease [Methylobacterium sp.
           4-46]
 gi|168193251|gb|ACA15198.1| membrane-associated zinc metalloprotease [Methylobacterium sp.
           4-46]
          Length = 386

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 186/364 (51%), Gaps = 29/364 (7%)

Query: 8   LLYTVS-----LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           LLY V      L ++V IHE GH++V R C + V SFS+GFGPE+ G T R G RWK+S 
Sbjct: 14  LLYIVPSFLFVLTVVVFIHELGHFLVGRWCGVGVTSFSIGFGPEIAGFTDRRGTRWKLSA 73

Query: 63  IPLGGYVSFSEDEK---------------DMR--SFFCAAPWKKILTVLAGPLANCVMAI 105
           IPLGGYV F  D+                D R  SF     WK+I  V AGP AN ++A+
Sbjct: 74  IPLGGYVKFVGDQNGASVPDPDSLARMSADERAISFHTQPVWKRIAIVAAGPAANFLLAV 133

Query: 106 LFFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN 163
           L F    Y  G M+  P+VS + P S AA AG + GD + +++G  V+ F ++   V  +
Sbjct: 134 LVFAGSIYALGRMEVTPLVSGIQPGSAAARAGFQVGDVVQAINGRPVTHFADMQRIVSGS 193

Query: 164 PLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVL 221
               + + + R  V    L+ +P        FG  R +  +GI    D  + KL    ++
Sbjct: 194 GGETLRVTVERGGVRTT-LEAVPDTVQEKTPFGTHR-LGRLGIQGPRDAADVKLARYGLV 251

Query: 222 QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDH-GFNAYIAFL 280
            S   G+ E   +       +          +Q+SGP+GIAR++       G +A I  +
Sbjct: 252 DSLRIGVSETYYVVERTFDYMGKLITGRESADQLSGPMGIARVSGQAAKAGGLSAVIGLI 311

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           A+ S +IG +NL P+P+LDGGHL+ + +E++RG+ L      +  R+GL ++L L     
Sbjct: 312 AVLSVSIGLINLFPVPLLDGGHLMFYAVEVLRGRPLSERAQEIGFRIGLALVLMLMLFAT 371

Query: 341 RNDI 344
            NDI
Sbjct: 372 WNDI 375


>gi|157826706|ref|YP_001495770.1| putative membrane-associated zinc metalloprotease [Rickettsia
           bellii OSU 85-389]
 gi|157802010|gb|ABV78733.1| Putative membrane-associated zinc metalloprotease [Rickettsia
           bellii OSU 85-389]
          Length = 352

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 193/351 (54%), Gaps = 20/351 (5%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + +++ I+V IHE GHY VAR  N+++  FS+GFG ELIGIT   GVRWK+ L+PLGGYV
Sbjct: 7   FIITISILVFIHELGHYAVARFFNVKIEEFSIGFGKELIGITDSKGVRWKICLLPLGGYV 66

Query: 70  SF----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV-- 117
                       +++  +  +F+  + +++ L V AGPL N  +AI+ F  F++  G   
Sbjct: 67  KIYGYDRNIMDKTQEINEKVAFYAKSCFERFLIVAAGPLINYFLAIIIFAGFYFCLGKVE 126

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           ++PV+  V   SPA  A +++GD I+ ++   V  F +V   +  N L+  +L++ R+  
Sbjct: 127 IQPVIGEVIAESPAEKANLREGDRIVKVNNKLVKDFSDVQKEILINGLNSSTLLIERKGE 186

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITR 236
               + +MP  +  V++    R++  +GI    +   +H++  +L S S  +     ++ 
Sbjct: 187 E-FTVSIMPE-EVVVEK---ARKILRIGIMAKNE--PVHTKIGILSSLSEAICNTIDVSV 239

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L   S        +++I GPV IA+ +    +H    Y+ F+AM S  +G +NLLPIP
Sbjct: 240 VTLKAASQMIVGKRSVSEIGGPVAIAKESGRTLEHSIEMYLLFIAMLSVNLGLLNLLPIP 299

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +LDGGHL+  L E + GK   +    ++ ++G+ II+FL  +   NDI  L
Sbjct: 300 VLDGGHLLFILYEAVTGKLPNIKARNILLQIGIMIIIFLTVISFSNDIKNL 350


>gi|296446139|ref|ZP_06888087.1| membrane-associated zinc metalloprotease [Methylosinus
           trichosporium OB3b]
 gi|296256333|gb|EFH03412.1| membrane-associated zinc metalloprotease [Methylosinus
           trichosporium OB3b]
          Length = 380

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 189/365 (51%), Gaps = 35/365 (9%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L ++V  HE GH++V R C +++ +FS+GFGPEL G   R G RW+V+ IPLGGYV F  
Sbjct: 14  LTVVVFFHELGHFLVGRWCGVKIDAFSIGFGPELWGREDRRGTRWRVAAIPLGGYVKFHG 73

Query: 74  D----------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D                E++ +  F A P WK++  VLAGP+AN V+A+  FT  F   G
Sbjct: 74  DANGASVPDPERIAAMPEEERKVAFAAQPVWKRMAIVLAGPVANFVLALAIFTVLFATVG 133

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+ P V+ V+PAS AA AG + GD ++S+D   + +F  +   V  +    +++V+ R
Sbjct: 134 RNVLTPRVATVTPASAAAEAGFQPGDLVLSIDDQPIDSFARMQEIVATSTGKPLTIVVRR 193

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHS------RTVLQSFSRGL 228
                  L   P+L++     G K +V  +G+  S +   L        R+VL +     
Sbjct: 194 AEREE-TLTATPQLREIETALG-KTRVGMLGLQASNNPADLREERFGLGRSVLLAAGETW 251

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARI----AKNFFDHGFNAYIAFLAMFS 284
             +        G+++   G D    Q+SGP+GIA++    AK     G       +A+ S
Sbjct: 252 MIVERTGAYLGGLIAGREGAD----QLSGPIGIAQVSGQMAKAIDKVGLTPLFNLIAILS 307

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +IG +NL+P+P+LDGGHL+ + +E  RG++L         R+GL ++  L      ND+
Sbjct: 308 ISIGLLNLMPVPLLDGGHLMFYAIEAARGRALAERTQEYAFRLGLAMVTTLMVFSTYNDV 367

Query: 345 YGLMQ 349
             L++
Sbjct: 368 ARLLR 372


>gi|91205933|ref|YP_538288.1| putative membrane-associated zinc metalloprotease [Rickettsia
           bellii RML369-C]
 gi|91069477|gb|ABE05199.1| Putative membrane-associated zinc metalloprotease [Rickettsia
           bellii RML369-C]
          Length = 352

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 195/352 (55%), Gaps = 22/352 (6%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + +++ I+V IHE GHY VAR  N+++  FS+GFG ELIGIT   GVRWK+ L+PLGGYV
Sbjct: 7   FIITISILVFIHELGHYAVARFFNVKIEEFSIGFGKELIGITDSKGVRWKICLLPLGGYV 66

Query: 70  SF----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV-- 117
                       +++  +  +F+  + +++ L V AGPL N  +AI+ F  F++  G   
Sbjct: 67  KIYGYDRNIMDKTQEINEKVAFYAKSCFERFLIVAAGPLINYFLAIIIFAGFYFCLGKVE 126

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           ++PV+  V   SPA  A +++GD I+ ++   V  F +V   +  N L+  +L++ R+  
Sbjct: 127 IQPVIGEVIAESPAEKANLREGDRIVKVNNKLVKDFSDVQKEILINGLNSSTLLIERKGE 186

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGL-DEISSIT 235
               + +MP  +  V++    R++  +GI    +   +H++  +L S S  + + I    
Sbjct: 187 E-FTVSIMPE-EVVVEK---ARKILRIGIMAKNE--PVHTKIGILSSLSEAICNTIDVSV 239

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
                 L    GK + +++I GPV IA+ +    +H    Y+ F+AM S  +G +NLLPI
Sbjct: 240 VTLKAALQMIVGKRS-VSEIGGPVAIAKESGRTLEHSIEMYLLFIAMLSVNLGLLNLLPI 298

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           P+LDGGHL+  L E + GK   +    ++ ++G+ II+FL  +   NDI  L
Sbjct: 299 PVLDGGHLLFILYEAVTGKLPNIKARNILLQIGIMIIIFLTVISFSNDIKNL 350


>gi|154248352|ref|YP_001419310.1| putative membrane-associated zinc metalloprotease [Xanthobacter
           autotrophicus Py2]
 gi|154162437|gb|ABS69653.1| putative membrane-associated zinc metalloprotease [Xanthobacter
           autotrophicus Py2]
          Length = 385

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 117/356 (32%), Positives = 185/356 (51%), Gaps = 30/356 (8%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L ++V  HE GH+ VAR   ++VL+FS+GFGPE+ G   R G RW+++ +PLGGYV F  
Sbjct: 29  LTLVVFFHELGHFWVARRAGVKVLTFSLGFGPEIAGFNDRHGTRWRLAAVPLGGYVRFFG 88

Query: 74  DEKDMRS------------------FFCAAPWKKILTVLAGPLANCVMAILFFTFFF--Y 113
           DE    +                  FF    W+  + V AGP+AN ++AI+ F F F  +
Sbjct: 89  DEDAASTPNQARLAEMTPAERRESFFFQPVAWRAAI-VAAGPIANFLLAIVIFAFVFMVF 147

Query: 114 NTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V  P V  V+P S A  AG K GD ++ +DG  V +F ++   V       ++  + 
Sbjct: 148 GKQVTAPRVDQVNPGSAAESAGFKPGDLVLEIDGAKVESFSDMQRIVGSRAGEGLAFTIE 207

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGI--SFSYDETKLHSRTVLQSFSRGLDE- 230
           R     L L  +P L++  D FG   +   +GI  S +  +   H    +++   G+ E 
Sbjct: 208 RGDR-QLTLTAVPELKEVKDPFGNVHRTGLLGISRSLAAGDVTTHRYGPIEAVGLGVQET 266

Query: 231 --ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
             + + T G+LG L +  G+++  +Q+ GP+ IA+++      G  A ++  A+ S +IG
Sbjct: 267 WFVVTRTFGYLGGLIA--GRES-ADQLGGPIRIAQVSGQVATFGIGALLSLAAVLSVSIG 323

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +NL PIP+LDGGHL+ +  E IRG+ L      +  R+GL ++L L      ND+
Sbjct: 324 LLNLFPIPLLDGGHLLFYAFEAIRGRPLSARTQDIGFRIGLALVLMLMIFATWNDV 379


>gi|206890118|ref|YP_002248074.1| membrane-associated zinc metalloprotease, putative
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742056|gb|ACI21113.1| membrane-associated zinc metalloprotease, putative
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 354

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 192/350 (54%), Gaps = 11/350 (3%)

Query: 8   LLYTVSLI-IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           L+Y V L   ++ IHE GH++ A+L  +RVL FS+GFGP+++G        + +S +PLG
Sbjct: 3   LIYAVILFGFLIFIHELGHFLAAKLSGVRVLKFSIGFGPKILG-KKIGETEYLLSAVPLG 61

Query: 67  GYVSFSEDE------KDMRSFFCAAPWKKILTVLAGPLANCVMAIL-FFTFFFYNTGVMK 119
           GYV    +E       + RSF     +KKI  VLAGPL N   A+L F+  F +   V+K
Sbjct: 62  GYVKMYGEEVGDEIIDEKRSFKHQPVYKKIFIVLAGPLFNIFGAVLLFWVIFVHGVPVLK 121

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
           P++  +   SPA IAG++KGD II LD   ++ + ++A ++++NP  E+   + R+   +
Sbjct: 122 PIIGEIIENSPAKIAGLEKGDRIIELDSQKINNWFDMAQFIQQNPNKELIFKIERKG-EI 180

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL 239
           L+LK+ P+ ++  + FG K  V  +GI    DE  +     + + ++   +   I     
Sbjct: 181 LNLKITPQAKEAKNLFGEKVVVGQIGIK-PADEFYIKKEDPITAVTKSFQKCYEIVELTY 239

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
             +   F +    + I GP+ I + A    + G  ++++F A+ S  +G +NLLPIP+LD
Sbjct: 240 LTIVKIFQRVVSTDVIGGPILIFQAAGKTAEQGLVSFLSFAAIISINLGVLNLLPIPVLD 299

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           GGH++ F++E IR K L      V  ++G+  ++ L  L   NDI  L+ 
Sbjct: 300 GGHILFFMIEGIRRKPLSEKFVAVAQKIGIAFLIALMMLAFYNDIIRLLN 349


>gi|148255863|ref|YP_001240448.1| putative Zinc metalloprotease [Bradyrhizobium sp. BTAi1]
 gi|146408036|gb|ABQ36542.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Bradyrhizobium sp. BTAi1]
          Length = 383

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/355 (32%), Positives = 179/355 (50%), Gaps = 22/355 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH+++AR   ++VL+FS+GFGPELIG   R   RWK+S IPLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLIARWAGVKVLTFSLGFGPELIGFNDRHNTRWKISAIPLGGYVKFFG 86

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYN 114
           DE +                   SF      ++   V AGP+AN ++A++ F     ++ 
Sbjct: 87  DESEASTPSAEALAKMTPQERADSFHHKTVGQRAAIVAAGPIANFILAVIIFAGMALYFG 146

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
                P V  V P S AA AG K GD I ++DG  +  F ++   V  +   E+S ++ R
Sbjct: 147 KPNTTPRVDAVQPDSVAAAAGFKNGDVIAAIDGRPIETFADMQRVVSVSAGSELSFLIKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSY--DETKLHSRTVLQSFSRGLDEIS 232
           +    L LK  P L++  D FG   ++  +GI ++   DE++       +S   G +++ 
Sbjct: 207 DGT-ELTLKATPALKEVKDLFGNSHRIGVLGIQYNAKPDESRSIPVGFFESIKIGFEQVW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            I       ++S F        + GP+ IA+++      GF   +   A  S +IG +NL
Sbjct: 266 FIIATTFKFIASLFAGAGSAGDVGGPIRIAQLSGQAASLGFQFVVQLCATLSVSIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            P+P+LDGGHL+ + +E +RG+ L      +  R+GL ++L L      NDI  L
Sbjct: 326 FPVPLLDGGHLLFYGVEAVRGRPLSERAQEMGFRIGLGLVLMLMVFATYNDILHL 380


>gi|158423324|ref|YP_001524616.1| putative membrane-associated zinc metallopeptidase [Azorhizobium
           caulinodans ORS 571]
 gi|158330213|dbj|BAF87698.1| putative membrane-associated zinc metallopeptidase [Azorhizobium
           caulinodans ORS 571]
          Length = 407

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 122/356 (34%), Positives = 190/356 (53%), Gaps = 30/356 (8%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L ++V  HE GH+ VAR   +RVL+FS+GFGPEL G   R G RW+++ IPLGG+V F  
Sbjct: 51  LTLVVFFHELGHFWVARRAGVRVLTFSLGFGPELFGFNDRHGTRWRLAAIPLGGFVKFYG 110

Query: 74  DEK----------------DMRSFFCAAP--WKKILTVLAGPLANCVMAILFFTFFF--Y 113
           DE                 + R  F   P  W+  + V AGP+AN ++AI+ F F F  +
Sbjct: 111 DEDAASTPDPVKLAQMSPAERRQSFFYQPLRWRAAI-VAAGPVANFILAIVIFAFVFMVF 169

Query: 114 NTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V  P V  V+P+S A  AG K GD I+++DG  V +F ++   V  +    ++  + 
Sbjct: 170 GRQVSSPRVDQVAPSSAAERAGFKAGDLILTIDGTPVESFSDMQRIVGSSAGSPLTFKVD 229

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDE- 230
           R    V  L   P +++  D FG   ++  +GIS S     + +R    +++ + G  E 
Sbjct: 230 RGGAPV-ELSATPEMREVKDAFGNVHRMGMLGISRSLAAADVVTRRYGPVEAVAMGAQET 288

Query: 231 --ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
             + + T  +LG L S  G+++  +Q+ GP+ IA+++      GF A ++  A+ S +IG
Sbjct: 289 WFVVARTFDYLGGLIS--GRESP-DQLGGPIRIAQVSGQVATFGFGALLSLAAVLSVSIG 345

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +NL PIP+LDGGHL+ + +E +RG  L      +  R+GL I+L L      ND+
Sbjct: 346 LLNLFPIPLLDGGHLLFYAVEAVRGHPLSPRAQDIGFRIGLAIVLMLMVFATWNDV 401


>gi|39935980|ref|NP_948256.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Rhodopseudomonas palustris CGA009]
 gi|192291633|ref|YP_001992238.1| membrane-associated zinc metalloprotease [Rhodopseudomonas
           palustris TIE-1]
 gi|39649834|emb|CAE28356.1| Zinc metalloprotease [Rhodopseudomonas palustris CGA009]
 gi|192285382|gb|ACF01763.1| membrane-associated zinc metalloprotease [Rhodopseudomonas
           palustris TIE-1]
          Length = 383

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 180/352 (51%), Gaps = 22/352 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH++VAR   ++VL+FS+GFGPE++G   R G RWK+S +PLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVARWNGVKVLTFSIGFGPEIVGFNDRYGTRWKLSAVPLGGYVKFFG 86

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D+ +                   SF       +   V+AGPLAN ++A++ FTF F   G
Sbjct: 87  DDSEASTPSGDALSQMSASERAVSFHHKPVGPRAAIVVAGPLANFILAVVLFTFLFSVFG 146

Query: 117 V--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
           V      V  V P S A  AG K GD + S++G  +S F E+  +V     +++   + R
Sbjct: 147 VPNTSARVDGVQPGSAAEAAGFKPGDVVTSINGSAISNFLEMQRFVGAEAGNQLKFTVKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEIS 232
                + L   P+L++  DRFG  +++  +GIS S    ++ +  V    +F  G+ E  
Sbjct: 207 GD-STVDLVATPQLKEIKDRFGNVQRLGILGISRSTAAGEVTTEQVNPAVAFWMGIKETW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +       +   F      +Q+ GP+ IA+++      GF   +   A+ S +IG +NL
Sbjct: 266 FVVDRTFSYIGGIFTGREAADQLGGPLRIAQVSGQVATIGFTPLLHLAAVLSISIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            P+P+LDGGHL+ + +E  RG+ L      +  R+GL ++L L      NDI
Sbjct: 326 FPVPLLDGGHLLFYGIEAARGRPLSERAQELGFRIGLALVLMLMMFATYNDI 377


>gi|154253628|ref|YP_001414452.1| putative membrane-associated zinc metalloprotease [Parvibaculum
           lavamentivorans DS-1]
 gi|154157578|gb|ABS64795.1| putative membrane-associated zinc metalloprotease [Parvibaculum
           lavamentivorans DS-1]
          Length = 392

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 119/356 (33%), Positives = 179/356 (50%), Gaps = 22/356 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L ++V  HE GH+ VAR C ++V +FS+GFG E+ G   R G RWKVS IPLGGYV F+ 
Sbjct: 28  LTVVVFFHELGHFSVARWCGVKVSTFSIGFGREIFGWNDRHGTRWKVSWIPLGGYVKFAG 87

Query: 74  DE----------------KDMRSFFCAAPW-KKILTVLAGPLANCVMAILFFT--FFFYN 114
           DE                ++    F   P  ++   V AGP+AN ++A + F   F F  
Sbjct: 88  DENAASMPSREQLERTPIEERSGLFHFKPLHQRAAVVAAGPIANFILATVIFACIFTFLG 147

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             +  PVV  V P S AA AG   GD I+++DG  +++FE++   V  N   E+   + R
Sbjct: 148 RSIATPVVDEVRPDSAAAAAGFVAGDRIVAIDGSPIASFEQMQRIVTGNGGAELRFDVAR 207

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLH--SRTVLQSFSRGLDEIS 232
               V  L  +P +Q+  DRFG   ++  +GI    D   +       + +   G  E  
Sbjct: 208 GEETVA-LTAVPEVQEVTDRFGNVHRIAMLGIVRHVDSGNVEVVRSDPVTALWLGAKETW 266

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +    L  +   F      +Q+ GP+ IA+++      GF A I+  AM S +IG +NL
Sbjct: 267 FVAERTLSYIGGIFTGTEDPDQLGGPLRIAQVSGQVATIGFAALISMTAMLSVSIGLLNL 326

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            P+P+LDGGHL+ + +E +RG+ LG        R+GL +++ L      ND+  L 
Sbjct: 327 FPVPMLDGGHLLYYAVEAVRGRPLGEQAQEYGFRIGLALVMMLMVFATWNDLVHLQ 382


>gi|91977320|ref|YP_569979.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Rhodopseudomonas palustris BisB5]
 gi|91683776|gb|ABE40078.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Rhodopseudomonas palustris BisB5]
          Length = 383

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 119/356 (33%), Positives = 181/356 (50%), Gaps = 24/356 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF-- 71
           L I+V  HE GH++VAR   ++VL+FS+GFGPE+ G   R G RWK+S IPLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVARWNGVKVLTFSLGFGPEIAGFNDRHGTRWKLSAIPLGGYVKFFG 86

Query: 72  ----------------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT 115
                           S DE+ + SF       +   V+AGPLAN ++AI+ FTF F   
Sbjct: 87  DDSEASTPSNDSLSKMSADERSV-SFHHKGVGPRAAIVVAGPLANFILAIVLFTFLFAVF 145

Query: 116 GV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
           GV      V  + P S A   G + GD I+++DG  + +F ++   V  +   E+   + 
Sbjct: 146 GVPSTSARVDAIQPGSAAEAGGFQAGDVILAIDGSPIHSFLDMQRKVGGDAGREMKFTVQ 205

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFS--RGLDEI 231
           R     + LK  P L++  DRFG  +++  +GIS S    +  +  V  + +   G+ E 
Sbjct: 206 RGS-STIDLKATPELREIKDRFGNVQRLGILGISRSTTANEATTERVNPAVAVWMGIKET 264

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
             +       +   F      +Q+ GP+ IA+I+      GF   +   A+ S +IG +N
Sbjct: 265 WFVVDRTFSYIGGLFAGREAADQLGGPLRIAQISGQVATIGFTPLLHLAAVLSISIGLLN 324

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           L P+P+LDGGHL+ + +E +RG+ L      +  R+GL ++L L      NDI  L
Sbjct: 325 LFPVPLLDGGHLMFYAIEAVRGRPLSERAQEMGFRIGLGLVLMLMVFATYNDILHL 380


>gi|316933928|ref|YP_004108910.1| membrane-associated zinc metalloprotease [Rhodopseudomonas
           palustris DX-1]
 gi|315601642|gb|ADU44177.1| membrane-associated zinc metalloprotease [Rhodopseudomonas
           palustris DX-1]
          Length = 383

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 117/355 (32%), Positives = 179/355 (50%), Gaps = 22/355 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH++VAR   ++VL+FS+GFGPE++G   R G RWK+S +PLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVARWNGVKVLTFSIGFGPEIVGFNDRHGTRWKLSAVPLGGYVKFFG 86

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D+ +                   SF       +   V+AGPLAN ++AI+ FTF F   G
Sbjct: 87  DDSEASTPSGEALSQMSAADRAVSFHHKPVGPRAAIVVAGPLANFILAIVLFTFLFSVFG 146

Query: 117 V--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
           V      V  V P S A  AG + GD + S+DG  + +F E+   V      ++   + R
Sbjct: 147 VPSTSARVDGVQPGSAAESAGFRPGDVVTSIDGSAIGSFLEMQRIVSAEAGRQLRFTVKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFS--RGLDEIS 232
               V  L   P L++  DRFG  +++  +GIS S    ++ +  V  + +   G+ E  
Sbjct: 207 GDSTV-DLTATPELKEIKDRFGNVQRLGILGISRSTAAGEVTTEQVNPAVALWMGVKETW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +       +   F      +Q+ GP+ IA+++      GF   +   A+ S +IG +NL
Sbjct: 266 FVVDRTFSYIGGIFTGREAADQLGGPLRIAQVSGQVATIGFTPLLHLAAVLSISIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            P+P+LDGGHL+ + +E +RG+ L      +  R+GL ++L L      NDI  L
Sbjct: 326 FPVPLLDGGHLLFYGIEAVRGRPLSERAQELGFRIGLALVLMLMMFATYNDILHL 380


>gi|157803348|ref|YP_001491897.1| putative monovalent cation/H+ antiporter subunit E [Rickettsia
           canadensis str. McKiel]
 gi|157784611|gb|ABV73112.1| putative monovalent cation/H+ antiporter subunit E [Rickettsia
           canadensis str. McKiel]
          Length = 358

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/351 (31%), Positives = 186/351 (52%), Gaps = 15/351 (4%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + +++  +V IHEFGHY VAR  N++V  FS+GFG ELIGI+ + GVRWK+ L+PLGGYV
Sbjct: 7   FIITISFLVFIHEFGHYAVARYVNVKVEEFSIGFGKELIGISDKKGVRWKIGLVPLGGYV 66

Query: 70  SF----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYNTGV 117
                       +++  +  +F+  +  ++ L V AGPL N ++AI+ F   + ++    
Sbjct: 67  KIYGYDRTLIANAKEVNEKVAFYTKSCLERFLIVAAGPLINYLLAIIIFAGLYCYFGKTE 126

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           + P++ +V  +SPA  A +++GD II ++   V  F +V   +  N     +L + R + 
Sbjct: 127 IPPIIGDVVASSPAETADLREGDKIIKVNNKPVKDFGDVQKEILINGFSSSTLTIERNN- 185

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITR 236
               + +MP+ +  +     K    ++ I        +H++  +L  F   ++    ++ 
Sbjct: 186 EEFTVNIMPQ-EIIITHPEAKNVKKTLRIGIIAKNAPIHTKIGILIGFWEAINTTIDMSA 244

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L  +S        L++I GPV IAR +      G   Y+ F+AM S  +G +NLLPIP
Sbjct: 245 LTLKAISQMIVGKRSLDEIGGPVAIARESGKSIAQGPQMYLLFIAMLSVNLGLLNLLPIP 304

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +LDGGHLI  L E I G+        ++ ++G  II+FL  + + NDI  L
Sbjct: 305 VLDGGHLIFILYEAITGRLPNPKTKNILLQLGAAIIVFLIIISVSNDIQNL 355


>gi|58617592|ref|YP_196791.1| putative metalloprotease [Ehrlichia ruminantium str. Gardel]
 gi|58417204|emb|CAI28317.1| Hypothetical zinc metalloprotease [Ehrlichia ruminantium str.
           Gardel]
          Length = 379

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 120/371 (32%), Positives = 195/371 (52%), Gaps = 31/371 (8%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+L  FL   + + IIV +HE+GHY++A+LCN+++  FS+GFGPEL GI  +SG RWK S
Sbjct: 17  FYLLSFL---IIMSIIVFVHEYGHYIIAKLCNVKIEVFSIGFGPELFGINDKSGTRWKFS 73

Query: 62  LIPLGGYVSFSEDE-------------KDMRSF-FCAAP-WKKILTVLAGPLANCVMAIL 106
           LIPLGGYV    D+             ++ +S+ FC     +K L   AGP AN + +++
Sbjct: 74  LIPLGGYVKMLGDDGPSSATGSSSNLPENEKSYAFCEKSLLQKSLIAFAGPFANLIFSLV 133

Query: 107 FFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
             T FF   G+++    + +V   S AA AG+  GD I+ ++G  +  FE++  Y+ +  
Sbjct: 134 LLTAFFNIHGILRHNSTIGDVIENSAAANAGLVAGDVILEINGHHIRWFEQIKEYMEKYA 193

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFS-----YDETKLHSRT 219
                L+ Y  +  +  +KV P L++T       +  P +G+  S     Y+  KL   T
Sbjct: 194 QDNELLIKYSRNKDIHIIKVKPTLKETEGSSNNTKAKPFLGVVISNIPSNYESQKL---T 250

Query: 220 VLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAF 279
           +  SF + ++    +++  L VL         LN++ GP+ IA+ +        N  +  
Sbjct: 251 LGNSFIQSINYTYLLSKSILQVLGQILTGQRSLNELGGPIRIAQYSGESVKQ--NQVLLC 308

Query: 280 LAMFSWAIGFMNLLPIPILDGGHLITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFL 338
           +AM S  +G +NLLPIP+LDGGH+  +L++ I R K +     R    +GL ++L L   
Sbjct: 309 MAMISINLGIINLLPIPMLDGGHIFQYLIQAILRRKEVNPKYQRYAATIGLMLLLSLMIF 368

Query: 339 GIRNDIYGLMQ 349
              ND+  + +
Sbjct: 369 VTFNDVRNIFK 379


>gi|57239552|ref|YP_180688.1| putative metalloprotease [Ehrlichia ruminantium str. Welgevonden]
 gi|58579538|ref|YP_197750.1| putative metalloprotease [Ehrlichia ruminantium str. Welgevonden]
 gi|57161631|emb|CAH58560.1| putative membrane-associated zinc metalloprotease [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58418164|emb|CAI27368.1| Hypothetical zinc metalloprotease [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 379

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 120/371 (32%), Positives = 195/371 (52%), Gaps = 31/371 (8%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+L  FL   + + IIV +HE+GHY++A+LCN+++  FS+GFGPEL GI  +SG RWK S
Sbjct: 17  FYLLSFL---IIMSIIVFVHEYGHYIIAKLCNVKIEVFSIGFGPELFGINDKSGTRWKFS 73

Query: 62  LIPLGGYVSFSEDE-------------KDMRSF-FCAAP-WKKILTVLAGPLANCVMAIL 106
           LIPLGGYV    D+             ++ +S+ FC     +K L   AGP AN + +++
Sbjct: 74  LIPLGGYVKMLGDDGPSSATGSSSNLPENEKSYAFCEKSLLQKSLIAFAGPFANLIFSLV 133

Query: 107 FFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
             T FF   G+++    + +V   S AA AG+  GD I+ ++G  +  FE++  Y+ +  
Sbjct: 134 LLTAFFNIHGILRHNSTIGDVIENSAAANAGLVAGDVILEINGHHIRWFEQIKEYMEKYA 193

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFS-----YDETKLHSRT 219
                L+ Y  +  +  +KV P L++T       +  P +G+  S     Y+  KL   T
Sbjct: 194 QDNELLIKYSRNKDIHIIKVKPTLKETEGSSNNIKAKPFLGVVISNIPSNYESQKL---T 250

Query: 220 VLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAF 279
           +  SF + ++    +++  L VL         LN++ GP+ IA+ +        N  +  
Sbjct: 251 LGNSFIQSINYTYLLSKSILQVLGQILTGQRSLNELGGPIRIAQYSGESVKQ--NQVLLC 308

Query: 280 LAMFSWAIGFMNLLPIPILDGGHLITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFL 338
           +AM S  +G +NLLPIP+LDGGH+  +L++ I R K +     R    +GL ++L L   
Sbjct: 309 MAMISINLGIINLLPIPMLDGGHIFQYLIQAILRRKEVNPKYQRYAATIGLMLLLSLMIF 368

Query: 339 GIRNDIYGLMQ 349
              ND+  + +
Sbjct: 369 VTFNDVRNIFK 379


>gi|20978831|sp|Q98MC1|Y638_RHILO RecName: Full=Putative zinc metalloprotease mll0638
          Length = 367

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 120/349 (34%), Positives = 182/349 (52%), Gaps = 25/349 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRS 80
           HE GHY+V R C I V +FS+GFGPELIG   R G RWK+  IPLGGYV F  D     S
Sbjct: 20  HEMGHYLVGRWCGIGVRAFSIGFGPELIGFNDRHGTRWKLCAIPLGGYVKFVGDMNATSS 79

Query: 81  ------------------FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKP 120
                             F   A WK+  TV+AGPL N ++ I+ F+  F + G  V +P
Sbjct: 80  QPTSEELETLTDEERKVAFHTQAIWKRAATVVAGPLFNFLLTIVVFSVLFASYGRYVAEP 139

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           +V+ V+  SPAA AG++ GD  +S+DG  V  F +V   V       I+ V+ R+   V 
Sbjct: 140 MVAEVTADSPAAKAGIQPGDRFVSVDGSKVETFGDVQRLVSGRAGDTITFVMLRDGKEVT 199

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEISSITRGF 238
            +   P+L +  D  G K +V  +G+  + +  + +L + T + + +  ++E   + +  
Sbjct: 200 -VTATPQLMEQQDALGNKVKVAVIGVVNNKELGQPRLITYTPVGAVAAAVEETGHVIQRT 258

Query: 239 LGVLSS-AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
              L   A G++ +  Q+ GPV IA +A      GF   +  +A+ S  IGF+NLLPIP 
Sbjct: 259 GQFLQRFAVGREDKC-QLGGPVKIADMAGKAAKLGFEWLVQLVALLSVGIGFLNLLPIPP 317

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYG 346
           LDGGHL+ + +E +  + +   +  +  R GL ++L        ND++G
Sbjct: 318 LDGGHLLFYGVEAVIRRPVSERMMEMAYRAGLLLVLCFMGFVFWNDLFG 366


>gi|209964513|ref|YP_002297428.1| membrane-associated zinc metalloprotease, putative [Rhodospirillum
           centenum SW]
 gi|209957979|gb|ACI98615.1| membrane-associated zinc metalloprotease, putative [Rhodospirillum
           centenum SW]
          Length = 377

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 174/342 (50%), Gaps = 21/342 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED------ 74
           HE GHY VAR   +RV  FS+GFGPEL G   R+G RWK S +PLGGYV    D      
Sbjct: 25  HELGHYWVARRNGVRVEVFSIGFGPELFGFNDRAGTRWKFSAVPLGGYVKMFGDADAASR 84

Query: 75  ----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPVV 122
                     E+  RSF+  +   +   V AGP AN   AI+     F  Y      PV+
Sbjct: 85  PDFRLDDLPPEERARSFYHQSLGSRAAIVAAGPAANFAFAIVALALLFTVYGQPFTAPVI 144

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
             VSP   AA AG+  GD ++S+DG T+  FE++   V + P   ++LV+ R+ + V  +
Sbjct: 145 EEVSPDGAAAEAGLLPGDRVLSIDGQTIERFEDITQLVVQYPGRPLALVVQRDGLEV-PV 203

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVL 242
            V PR  +  DRFG    +  +G+    DE K   R  L +      E  S+T G L  +
Sbjct: 204 TVTPRTVEVEDRFGNTHTIGRIGVLRGADEFK--KRDPLSAVWYAGKETLSLTLGTLKAV 261

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
                     +++ GP+ IA+++      GF A + F+A+ S  +G +NL PIP+LDGGH
Sbjct: 262 GQMISGTRGTDELGGPLRIAQMSGEVAQTGFVALVWFVAILSINLGLINLFPIPMLDGGH 321

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L+ + +E +RG+ LG        R+GL ++L L      ND+
Sbjct: 322 LLFYGIEAVRGRPLGERAQEYGFRIGLALVLTLMVFATWNDL 363


>gi|291278557|ref|YP_003495392.1| membrane-associated zinc metalloprotease [Deferribacter
           desulfuricans SSM1]
 gi|290753259|dbj|BAI79636.1| membrane-associated zinc metalloprotease [Deferribacter
           desulfuricans SSM1]
          Length = 355

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 189/342 (55%), Gaps = 17/342 (4%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---- 71
           I+V IHEFGH++ A+L  ++VL FS+GFGP LI         + +SLIPLGGYV      
Sbjct: 12  ILVFIHEFGHFIFAKLFGVKVLRFSIGFGPVLIS-KKMGETEYALSLIPLGGYVKMYGEN 70

Query: 72  --SEDE----KDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVV 122
              ED+    +D    F   P W +   VLAGPL N ++AI+ F+F F  +G+ K  PV+
Sbjct: 71  PDEEDDVVSDEDADKAFSNKPVWYRFFIVLAGPLFNYLLAIIIFSFIFM-SGIEKLLPVI 129

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
             V    PAAI G++ GD II +DG  V  +E++  Y++     E+ + + R+   ++ L
Sbjct: 130 GEVKDGMPAAITGIQPGDKIIEIDGHKVKFWEDIGNYIKFKAGEEVHVKIDRDG-NIISL 188

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVL 242
            ++P+ +   + FG  + V  +GI    D  ++    + +SF  G  + + +T+  L  +
Sbjct: 189 TLVPKKEKVKNIFGEDKYVGLIGIMPKGDYIEV-KYNLFESFVLGFKKTNEVTKLTLLGI 247

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
                K    + I GP+ I ++A      GF++ +AF+A+ S  +  +NLLPIP+LDGGH
Sbjct: 248 VKIIQKVVPADNIGGPIMIFQMASETAKAGFSSLLAFMAVISINLAILNLLPIPVLDGGH 307

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L+ +++EMI  + + + V  V   +GL +++ L F    NDI
Sbjct: 308 LLFYIIEMIIRRPVSLKVRMVAQYIGLALLISLMFFAFYNDI 349


>gi|88607986|ref|YP_506595.1| putative membrane-associated zinc metalloprotease [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600155|gb|ABD45623.1| putative membrane-associated zinc metalloprotease [Neorickettsia
           sennetsu str. Miyayama]
          Length = 366

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 183/348 (52%), Gaps = 22/348 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED- 74
           +IV  HEFGHY+ A++  ++V  FS+GFG EL G + +SG RWK+S+IP GGYV    D 
Sbjct: 17  VIVFAHEFGHYIFAKMFGVKVEEFSIGFGKELFGFSDKSGTRWKLSMIPAGGYVKMFGDL 76

Query: 75  --------EK--------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTG 116
                   EK          ++      ++K L +  GP AN V A L  +F +  +   
Sbjct: 77  DKSSAVDFEKIHMMDDCMKAQTLNYKPLYQKALVIFGGPFANFVFAFLVLSFLYGYFGKV 136

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
            ++PVV++V   SPAA AG + GD I++++   +++F+E+  ++  N    +S  + R  
Sbjct: 137 TVEPVVASVISDSPAAHAGFRVGDRILTMNNKPIASFDEIRKFIYLNRDSAVSFTVLRNG 196

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
              + + V PR++   D FG + ++P +GI  S  + +     V+ +    L EI ++  
Sbjct: 197 -DEISMSVTPRIEVGEDIFGNREELPKLGIEAS--KIQRSEIGVVGAMRFSLIEIGNVIH 253

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L +L        + N I GP+ IA+ +      GF   + F+AM S  +G  NL PIP
Sbjct: 254 STLKLLWQTITGKAKTNAIGGPIKIAKYSGQSMRMGFTMVLWFMAMLSINLGLFNLFPIP 313

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +LDGGHL+ +L+E I+G  + +   +   R G+ +++ +    + NDI
Sbjct: 314 MLDGGHLLFYLIEWIKGDRVAIGFQQWAGRAGMLLLIAILVFAVFNDI 361


>gi|115524567|ref|YP_781478.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Rhodopseudomonas palustris BisA53]
 gi|115518514|gb|ABJ06498.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Rhodopseudomonas palustris BisA53]
          Length = 383

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 122/355 (34%), Positives = 175/355 (49%), Gaps = 22/355 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH++VAR   ++VL+FS+GFGPEL+G   + G RWK+S IPLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVARWAGVKVLTFSLGFGPELVGFNDKHGTRWKISAIPLGGYVKFFG 86

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           DE +                   SF       +   V AGP+AN ++AI+ F   F   G
Sbjct: 87  DESEASTPSSAALAAMSAQERQGSFHHKKVGPRAAIVAAGPIANFLLAIVIFATLFTING 146

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             +    V NV   S AA AG +KGD I+++DG  +  F E+   V      E+S  + R
Sbjct: 147 RPITSARVDNVQADSAAAAAGFQKGDVILAIDGKKIDNFTEMQRTVGAQAGQELSFTVQR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEIS 232
                L LK  P L++  D FG   +V  +GIS S     + +  V    +   G  E  
Sbjct: 207 AEA-TLELKATPVLKEIKDSFGNVHRVGILGISRSNSPGDVLTERVNPATALVLGAKETW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +    L  +   F      +Q+ GP+ IA+I+      G +  +   A+ S +IG +NL
Sbjct: 266 FVVDRTLSYIGGIFTGREAADQLGGPLRIAQISGQVATFGLSPLLHLAAVLSVSIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            P+P+LDGGHL+ +  E IRG+ L      +  R+GL ++L L      NDI  L
Sbjct: 326 FPVPLLDGGHLLFYAFEAIRGRPLSERAQEMGFRIGLGLVLMLMVFATYNDILHL 380


>gi|110633740|ref|YP_673948.1| peptidase RseP [Mesorhizobium sp. BNC1]
 gi|110284724|gb|ABG62783.1| site-2 protease. Metallo peptidase. MEROPS family M50B
           [Chelativorans sp. BNC1]
          Length = 379

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 181/350 (51%), Gaps = 28/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED------ 74
           HE GHY+V R C I V +FS+GFGPEL+G T R G RWK+S IPLGGYV F  D      
Sbjct: 33  HEMGHYLVGRWCGIGVRAFSIGFGPELVGFTDRHGTRWKLSAIPLGGYVKFVGDVGATSA 92

Query: 75  ----------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                      ++ R+ F   P WK+  TV AGP  N ++ +  F+  F  +   +  P+
Sbjct: 93  PDAEGLEKLSAEERRTAFHLQPIWKRAATVFAGPFFNFLLTVAVFSVMFSLFGRYISDPM 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V+ V P SPAA+AG+  GD  +S+DG  V  F +V   V       ++ V+ R+   +  
Sbjct: 153 VAEVRPDSPAAVAGIIPGDRFVSIDGKPVETFGDVQRIVSGRAGDPLTFVMERDGRQIT- 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGI--SFSYDETKLHSRTVLQSFSRGLDEISSI---TR 236
           +   P L +  D  G + ++  +G+  + +  + +L     +++   G++E +     T 
Sbjct: 212 VTATPELSEQADALGNQIKIGVIGVINNEALGQPRLVEYGPVEAVGAGIEETAGAIVRTG 271

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
            FL  L +  G++ R  Q+ GPV IA +A      GF   +   A+ S  IG +NLLPIP
Sbjct: 272 QFLQRLVA--GREDRC-QLGGPVKIADMAGRAASLGFEWLVQLAALLSVGIGILNLLPIP 328

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYG 346
            LDGGHL+ + +E +  + +   V   + R+G+ ++L        ND++G
Sbjct: 329 PLDGGHLLFYAIEAVLRRPVPEQVAEAVYRVGMLMVLVFMGFVFWNDLFG 378


>gi|312114740|ref|YP_004012336.1| membrane-associated zinc metalloprotease [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311219869|gb|ADP71237.1| membrane-associated zinc metalloprotease [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 386

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 117/363 (32%), Positives = 182/363 (50%), Gaps = 33/363 (9%)

Query: 7   FLLYTVSLI----IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           F L+TV  +    ++V+IHE GH++ AR   ++V +FSVGFGPE+ G   RSG+RW+++ 
Sbjct: 13  FFLWTVPFLLVLGVVVIIHELGHFLAARALGVKVETFSVGFGPEIAGFVDRSGIRWRLAW 72

Query: 63  IPLGGYVSFSED-----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAI 105
           +PLGGYV F  D                 E+   +F  A  W++ L VLAGP AN  + I
Sbjct: 73  VPLGGYVKFKGDENASSVASAEEIAKLTPEERKGNFHTADLWRRTLIVLAGPFANFALGI 132

Query: 106 LFFTFFFYNTGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN 163
             F       G+   +  +  V P +PAA AG++ GD I+S+ G  V +FE+ + YV+ N
Sbjct: 133 AIFAGLALANGISYQEARIVCVEPNTPAAKAGLEAGDKILSIGGRPVKSFEDFSYYVKLN 192

Query: 164 PLHEISLVLYREHVGVLHLKVMPRLQDT--VDRFGIKRQVPSVGISFSYDETKLHSRTVL 221
               + + + R    V+ L  +P L +   + R G+      +G S   +  ++ S  + 
Sbjct: 193 ARSTLDIEVDRGGR-VMALTAVPELTENECIGRLGV------MGGS-RRENARIESVGLS 244

Query: 222 QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLA 281
           QS   G++    I  G        F  +   + + GPV IA +AK F   GF   I  +A
Sbjct: 245 QSVGIGVERTWRIIEGPFQFFGQLFKGNACASTLGGPVKIAEVAKTFASDGFVNLIPLIA 304

Query: 282 MFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIR 341
             S ++G  NL PIP+LDGGHL+ +  E I G+ L      +  + G  +++ L      
Sbjct: 305 FISISVGLFNLFPIPVLDGGHLLFYGAEAILGRPLSQRAQEIGFQFGFTLLIMLMIFVTW 364

Query: 342 NDI 344
           N+I
Sbjct: 365 NNI 367


>gi|118590004|ref|ZP_01547408.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Stappia aggregata IAM 12614]
 gi|118437501|gb|EAV44138.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Stappia aggregata IAM 12614]
          Length = 380

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 123/357 (34%), Positives = 179/357 (50%), Gaps = 24/357 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH+ VAR CN++V +FSVGFG EL G   R G RWK+  IPLGGYV F+ 
Sbjct: 22  LTIVVFFHELGHFAVARWCNVKVDAFSVGFGRELFGYNDRKGTRWKLCWIPLGGYVKFAG 81

Query: 74  D----------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D                E++ ++ F A P W+++  V AGP+AN ++AI+ FT  F  +G
Sbjct: 82  DDNAASVPSREAIAQMSEEERKTAFIAKPVWQRMAVVAAGPIANFLLAIVIFTALFVTSG 141

Query: 117 VM--KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
               +PVV  V     A   G+  GD +  +DG  +  F E+   V  +      LV   
Sbjct: 142 KQGYEPVVEQVFAGGAAERDGLLAGDVVKEIDGRPIQTFGEMRQIVLMSA--NTPLVFEV 199

Query: 175 EHVGV-LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKL-HSRTVL-QSFSRGLDEI 231
           E  G  + L V P  ++    FG K+    + +    D + L H +  L ++   G  E 
Sbjct: 200 ERAGKDVTLTVTPDAKEKEVFFGEKQVAGDISLRGVSDPSHLVHIKYGLGEAALEGTAET 259

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
             I    +  +     +    +Q+ GP+ +A+I+    D GF   I+  A+ S +IG +N
Sbjct: 260 WRIIESTVSYIWGIISQRQSADQLGGPIRVAQISGQVADLGFMPLISLAAVLSVSIGLIN 319

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           L P+PILDGGHL+ F  E +RGK L   V  V  R+GL ++L L       DI  L+
Sbjct: 320 LAPVPILDGGHLVYFAAEALRGKPLSERVQDVGFRIGLGLVLMLMVFVTWKDIMRLV 376


>gi|262276976|ref|ZP_06054769.1| RIP metalloprotease RseP [alpha proteobacterium HIMB114]
 gi|262224079|gb|EEY74538.1| RIP metalloprotease RseP [alpha proteobacterium HIMB114]
          Length = 366

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 179/350 (51%), Gaps = 28/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--------- 71
           HE+GHY  A+   + V  FS+GFG EL G   + G RWK+  IPLGGYV F         
Sbjct: 19  HEYGHYYFAKKYKVGVTDFSIGFGKELFGFYDKDGTRWKICAIPLGGYVKFFGDSNSASQ 78

Query: 72  -----SEDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVS 123
                  D+KD        P +++ + V AGP+AN ++AI  F+  F   G  +  P+++
Sbjct: 79  PVSLSKIDDKDHSKLLTTKPLYQRAIIVSAGPIANFILAIFIFSLIFMTVGKDITVPIIT 138

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLK 183
            V   SPA+ AG+K  D I  +D   + +  +VA Y+  +   ++ + + R     L   
Sbjct: 139 EVQQNSPASKAGLKSNDQITFIDEKKIESINDVALYITTSKSDKVKVEVLRNQRP-LSFI 197

Query: 184 VMPRLQDTVDRFGIKRQVPSVGISFSYDETKLH------SRTVLQSFSRGLDEISSITRG 237
           + P  + T D FG   +   +GI  +  + K+       S+ +  S     + IS +T  
Sbjct: 198 IEPEKKITKDNFGNNIERKLIGIKIAPLKGKMEKEKLGPSKAIFLSIKETYNTIS-MTLS 256

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
           +LG +    GK++  NQ+ GP+ IA+I+    +HG   +++ +A  S ++G +NL PIP+
Sbjct: 257 YLGKM--IVGKESA-NQLGGPIKIAQISGKVAEHGLIPFLSIMAYISISLGLINLFPIPL 313

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           LDGGHL  +L+E +RGK L  ++     + G+ ++  L F    ND+  L
Sbjct: 314 LDGGHLFFYLIEFLRGKPLSENIQIYFYKFGMAVLFTLMFFATFNDLKSL 363


>gi|75676043|ref|YP_318464.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Nitrobacter winogradskyi Nb-255]
 gi|74420913|gb|ABA05112.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Nitrobacter
           winogradskyi Nb-255]
          Length = 383

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 113/357 (31%), Positives = 178/357 (49%), Gaps = 22/357 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH++VAR   ++VL+FSVGFGPEL G   R G RWK+S IPLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVARWAGVKVLTFSVGFGPELAGFNDRHGTRWKLSAIPLGGYVKFFG 86

Query: 74  DEKDM-----------------RSFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYN 114
           D+ +                   SF   +  ++   V AGP+AN ++AI+ F   F F  
Sbjct: 87  DDSEASTPSSSTLASMTAEERGSSFHHKSVGRRAAIVAAGPIANFILAIVIFASLFMFLG 146

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
                  V  V   S A  AG K GD + +++G  + +F ++   V       ++  + R
Sbjct: 147 KPSTTARVDGVQAGSAAEAAGFKAGDIVTAINGGRIDSFSDMQRIVGTKAGETLTFAVKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEIS 232
               ++ LK +P L++  DRFG   ++  +GI+ +     + +  V  + +   G++E  
Sbjct: 207 GD-SIVDLKGVPELKEIKDRFGNTHRIGVLGITRATSPGDVTTEYVNPVTALWMGVEETW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +    +  +   F      +Q+ GP+ IA+I+      G  A I   A+ S +IG +NL
Sbjct: 266 FVIDRTMAYIGGIFSGREAADQVGGPLRIAQISGQVATIGPAALIHLAAVLSVSIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
            P+P+LDGGHL+ +  E +RG+ +      V  R+GL ++L L      NDI  L +
Sbjct: 326 FPVPLLDGGHLLFYAAEAVRGRPISERAQEVGFRIGLGLVLMLMVFATYNDILHLAR 382


>gi|13470837|ref|NP_102406.1| hypothetical protein mll0638 [Mesorhizobium loti MAFF303099]
 gi|14021580|dbj|BAB48192.1| mll0638 [Mesorhizobium loti MAFF303099]
          Length = 346

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 118/346 (34%), Positives = 180/346 (52%), Gaps = 25/346 (7%)

Query: 24  GHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRS--- 80
           GHY+V R C I V +FS+GFGPELIG   R G RWK+  IPLGGYV F  D     S   
Sbjct: 2   GHYLVGRWCGIGVRAFSIGFGPELIGFNDRHGTRWKLCAIPLGGYVKFVGDMNATSSQPT 61

Query: 81  ---------------FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVS 123
                          F   A WK+  TV+AGPL N ++ I+ F+  F + G  V +P+V+
Sbjct: 62  SEELETLTDEERKVAFHTQAIWKRAATVVAGPLFNFLLTIVVFSVLFASYGRYVAEPMVA 121

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLK 183
            V+  SPAA AG++ GD  +S+DG  V  F +V   V       I+ V+ R+   V  + 
Sbjct: 122 EVTADSPAAKAGIQPGDRFVSVDGSKVETFGDVQRLVSGRAGDTITFVMLRDGKEVT-VT 180

Query: 184 VMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
             P+L +  D  G K +V  +G+  + +  + +L + T + + +  ++E   + +     
Sbjct: 181 ATPQLMEQQDALGNKVKVAVIGVVNNKELGQPRLITYTPVGAVAAAVEETGHVIQRTGQF 240

Query: 242 LSS-AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
           L   A G++ +  Q+ GPV IA +A      GF   +  +A+ S  IGF+NLLPIP LDG
Sbjct: 241 LQRFAVGREDKC-QLGGPVKIADMAGKAAKLGFEWLVQLVALLSVGIGFLNLLPIPPLDG 299

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYG 346
           GHL+ + +E +  + +   +  +  R GL ++L        ND++G
Sbjct: 300 GHLLFYGVEAVIRRPVSERMMEMAYRAGLLLVLCFMGFVFWNDLFG 345


>gi|220921526|ref|YP_002496827.1| membrane-associated zinc metalloprotease [Methylobacterium nodulans
           ORS 2060]
 gi|219946132|gb|ACL56524.1| membrane-associated zinc metalloprotease [Methylobacterium nodulans
           ORS 2060]
          Length = 386

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 178/364 (48%), Gaps = 29/364 (7%)

Query: 8   LLYTVS-----LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           LLY V      L ++V IHE GH++V R C + V SFS+GFGPE++G T R G RWK+S 
Sbjct: 14  LLYIVPSFLFVLTVVVFIHELGHFLVGRWCGVGVTSFSIGFGPEILGFTDRKGTRWKLSA 73

Query: 63  IPLGGYVSFSEDEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAI 105
           IPLGGYV F  D+                     SF     WK+I  V AGP AN ++AI
Sbjct: 74  IPLGGYVKFVGDQNGASVPDAGSLARMSAAERAVSFHTQNVWKRIAIVAAGPAANFLLAI 133

Query: 106 LFFTFFFYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN 163
             F    Y  G   + P VS V   S A  AG + GD + +++G  V+ F ++   V   
Sbjct: 134 AVFAGSIYAIGRYEVAPRVSGVQAGSAAERAGFQAGDVVQAINGRPVTNFADMQRIVSGA 193

Query: 164 PLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVL 221
               + + + R  V    ++ +P        FG  R +  +GI    D  + KL     +
Sbjct: 194 GGERLVVTVDRGGVPT-SIEAVPDTVQEKTPFGTHR-LGRLGIQGPRDTADVKLVRYGAV 251

Query: 222 QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIA-KNFFDHGFNAYIAFL 280
            S   G+ E   +       +          +Q+SGP+GIAR++ +     G  A +  +
Sbjct: 252 DSLRIGVSETYYVVERTFDYIGKLITGRESADQLSGPMGIARVSGQAARAGGLGAVVGLI 311

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           A+ S +IG +NL P+P+LDGGHL+ + +E++RG+ L      +  R+GL ++L L     
Sbjct: 312 AVLSVSIGLINLFPVPLLDGGHLLFYTIEILRGRPLSERAQEIGFRIGLALVLMLMLFAT 371

Query: 341 RNDI 344
            NDI
Sbjct: 372 WNDI 375


>gi|85716989|ref|ZP_01047952.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Nitrobacter sp. Nb-311A]
 gi|85696191|gb|EAQ34086.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Nitrobacter sp. Nb-311A]
          Length = 368

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 177/352 (50%), Gaps = 22/352 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L ++V  HE GH++VAR   ++VL+FSVGFGPEL G   R G RWK+S IPLGGYV F  
Sbjct: 12  LTVVVFFHELGHFLVARWAGVKVLTFSVGFGPELAGFNDRHGTRWKLSAIPLGGYVRFFG 71

Query: 74  D-----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYN 114
           D                 E+   SF      ++   V AGP+AN ++AIL F   F F  
Sbjct: 72  DDSEASTPSNTALASMTAEERENSFHHKNVGRRAAIVAAGPIANFILAILIFASLFTFLG 131

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
                  V  +   S A  AG K GD +I+++G  + +F ++   V  +    ++  + R
Sbjct: 132 KPSTTARVDAIQAGSAAEAAGFKTGDIVIAINGDKIDSFSDMQRIVGTSAGETMTFAVKR 191

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFS--RGLDEIS 232
               ++ LK +P L++  DRFG   ++  +GIS +     + +  V  + +   G+ E  
Sbjct: 192 GD-SIIDLKGVPELKEIKDRFGNTYRIGVLGISRATSPGDVTTEYVNPAAAVWLGVKETW 250

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +    +  +   F      +Q+ GP+ IA+I+      G  A I   A+ S +IG +NL
Sbjct: 251 FVIDRTMAYIGGIFTGREAADQVGGPLRIAQISGQVATIGTAALIHLAAVLSVSIGLLNL 310

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            P+P+LDGGHL+ + +E +RG+ +      V  R+GL ++L L      NDI
Sbjct: 311 FPVPLLDGGHLLFYAVEAVRGRPISERAQEVGFRVGLGLVLMLMVFATYNDI 362


>gi|260459220|ref|ZP_05807475.1| membrane-associated zinc metalloprotease [Mesorhizobium
           opportunistum WSM2075]
 gi|259034774|gb|EEW36030.1| membrane-associated zinc metalloprotease [Mesorhizobium
           opportunistum WSM2075]
          Length = 380

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 120/349 (34%), Positives = 179/349 (51%), Gaps = 25/349 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-------- 72
           HE GHY+V R C I V +FS+GFGPELIG   R G RWK+  IPLGGYV F         
Sbjct: 33  HEMGHYLVGRWCGIGVRAFSIGFGPELIGFNDRHGTRWKLCAIPLGGYVKFVGDMSATSS 92

Query: 73  ----------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKP 120
                      DE+   +F   A WK+  TV AGPL N ++ I+ F+  F   G  V +P
Sbjct: 93  KPTAGELETLTDEERKIAFHTQAIWKRAATVAAGPLFNFLLTIVVFSVLFTTYGRYVAEP 152

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           +V+ V+  SPAA AG+  GD  +S+DG  V  F +V   V       I+ V+ R    V 
Sbjct: 153 MVAQVTADSPAARAGILPGDRFVSVDGSKVETFGDVQRLVSGRAGDTITFVMLRGGKEVT 212

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEISS-ITRG 237
            +   P+L +  D  G K +V  +G+  + +  + +L + T + + +  ++E    I R 
Sbjct: 213 -VTATPQLMEQEDALGNKVRVAVIGVVNNKELGQPRLVTYTPVGAVAAAVEETGHVIERT 271

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
              +   A G++ +  Q+ GPV IA +A      GF   +  +A+ S  IG +NLLPIP 
Sbjct: 272 GQFMQRFAVGREDKC-QLGGPVKIADMAGKAAKLGFEWLVQLVALLSVGIGILNLLPIPP 330

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYG 346
           LDGGHL+ + +E +  + +   +  +  R GL ++L        ND++G
Sbjct: 331 LDGGHLLFYGVEAVIRRPVSEWMMEMAYRAGLLLVLCFMGFVFWNDLFG 379


>gi|92117248|ref|YP_576977.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Nitrobacter hamburgensis X14]
 gi|91800142|gb|ABE62517.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Nitrobacter
           hamburgensis X14]
          Length = 383

 Score =  182 bits (463), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 111/352 (31%), Positives = 175/352 (49%), Gaps = 22/352 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH++V R   +++L+FSVGFGPEL G   R G RWK+S IPLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVGRWAGVKILTFSVGFGPELAGFNDRHGTRWKLSAIPLGGYVKFFG 86

Query: 74  D-----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYN 114
           D                 E+   SF       +   V AGP+AN ++AI  F   F  + 
Sbjct: 87  DDSEASTPSNAILASMTAEERAGSFHHKKVLPRAAIVAAGPIANFILAIFIFAGLFMIFG 146

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
                P V  V   S A  AG K GD + +++G  + +F ++   V  +    ++  + R
Sbjct: 147 KPSTTPRVDTVQAGSAAEAAGFKAGDIVTAINGSGIDSFSDMQRIVGTSAGETLTFAVKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFS--RGLDEIS 232
               V+ L+  P+L++  DRFG + ++  +GI+ +     + +  V  + +   G+ E  
Sbjct: 207 GD-SVIDLRGTPQLKEIKDRFGNEHRIGVLGIAHATSPGDVTTERVNPATAVWLGVKETW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +    +  +   F      +QI GP+ IA+I+      G  A I   A+ S +IG +NL
Sbjct: 266 FVVDSTMAYIGGIFTGREDADQIGGPLRIAQISGQVATIGPAALIHLAAVLSISIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            P+P+LDGGHL+ + +E +RG+ +      +  R+GL ++L L      NDI
Sbjct: 326 FPVPLLDGGHLLFYAVEAVRGRPMSERAQEMGFRIGLGLVLMLMVFATYNDI 377


>gi|87199397|ref|YP_496654.1| peptidase RseP [Novosphingobium aromaticivorans DSM 12444]
 gi|87135078|gb|ABD25820.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 373

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 186/363 (51%), Gaps = 23/363 (6%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L + + L  +V IHEFGHY+V R   ++   FS+GFG E+ G T + G RWK+S +
Sbjct: 10  LTTLLAFVLVLGPLVFIHEFGHYLVGRWFGVKADVFSIGFGKEIAGWTDKRGTRWKLSAL 69

Query: 64  PLGGYVSFSED----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILF 107
           PLGGYV F+ D                E+  R+F     W++ L VLAGP+ N + A+L 
Sbjct: 70  PLGGYVQFAGDMNPASQPSPEWLSLPAEERNRTFPAKPLWQRSLIVLAGPVTNLLFAVLI 129

Query: 108 FTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPL 165
              F   Y   V+ PVV  +   S A  AGV+ GD I+S+ G  V +F +V   V +NP 
Sbjct: 130 LAGFTLGYGKVVVPPVVGEIQGGSAADRAGVELGDRIVSIRGKAVDSFLDVRLEVGQNPG 189

Query: 166 HEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGIS-FSYDETKLHSRTVLQSF 224
             + LV+ R+   V  +     ++   DRFG  +++  +GI   SY+  ++     +++ 
Sbjct: 190 EPLDLVVLRDGRQV-EIAASAAVKMESDRFGNTQKIGFLGIGPKSYEIVRVGP---VEAL 245

Query: 225 SRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFS 284
           + G+ +   I R  +  +         + ++ GP+ IA+ +      G+ A++ F+A+ S
Sbjct: 246 AEGVMQTGGIIRMMVNGIGQIITGKREVKELGGPIKIAKYSGEQLVSGWQAFVGFVALIS 305

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             +GF+NLLPIP+LDGGHL  +  E IR K +G        R GL  ++ L      ND+
Sbjct: 306 INLGFINLLPIPVLDGGHLAFYAAEAIRRKPVGQRGQEWAFRTGLAFVMALMLFVTINDV 365

Query: 345 YGL 347
             L
Sbjct: 366 ASL 368


>gi|58698452|ref|ZP_00373361.1| membrane-associated zinc metalloprotease, putative [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58535044|gb|EAL59134.1| membrane-associated zinc metalloprotease, putative [Wolbachia
           endosymbiont of Drosophila ananassae]
          Length = 383

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 113/361 (31%), Positives = 178/361 (49%), Gaps = 23/361 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL +++ + +IV +HE+GHY+VA+ C ++V SFS+GFGPE+ G   +SG RWK+S +PLG
Sbjct: 18  FLSFSLIISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSAVPLG 77

Query: 67  GYV----------------SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTF 110
           GYV                  +E+EK + SF      KK   V AGP AN V A++ FT 
Sbjct: 78  GYVKMLGDTNAASVPADQQELTEEEK-LYSFHTKPRHKKAAVVFAGPFANMVFAVIAFTI 136

Query: 111 FFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEI 168
           FF   G  +  PV+ NV   S A  AG+  GD I  ++   +  FE+++  +  NP   +
Sbjct: 137 FFSIAGYYRTPPVIENVIEGSAAKQAGLLPGDTITQINEHKIKYFEDISRVIMSNPKTRM 196

Query: 169 SLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
             + Y  +       + P +    D FG   +  ++GI        L   + L + S  +
Sbjct: 197 E-IEYSRNNEKHRTSLTPLIIKDKDVFGNTIERETIGI---ISVNTLKQSSFLGAVSLSV 252

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
            E        +  L         +N+I GP+ IA+ +      GF   + F+A+ S  + 
Sbjct: 253 SETYHTMCLTIKALFHIIVGKRSINEIGGPIKIAKYSGQSAKKGFIMVLYFMAIISANLA 312

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            +NLLPIP+LDGGHL  +++E +  + L +   +     G  ++  L   G+ NDI  L 
Sbjct: 313 AINLLPIPLLDGGHLFHYIIEAVIRRDLSLKCQKYAAIFGALVLFLLMATGMSNDIRDLF 372

Query: 349 Q 349
           +
Sbjct: 373 E 373


>gi|330813818|ref|YP_004358057.1| membrane-associated zinc metalloprotease [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327486913|gb|AEA81318.1| membrane-associated zinc metalloprotease [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 370

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/369 (31%), Positives = 184/369 (49%), Gaps = 29/369 (7%)

Query: 3   WLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           +L     + + + ++V IHE+GHY  A+   + V  FS+GFG EL G   + G RWKV L
Sbjct: 4   FLQSAFYFILLISVVVFIHEYGHYYFAKKYKVTVTDFSIGFGKELFGWFDKDGTRWKVCL 63

Query: 63  IPLGGYVSFSED--------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAILF 107
           IPLGGYV F  D               KD        P +++ + V AGP+AN ++AI  
Sbjct: 64  IPLGGYVKFFGDSNAASKPSKPSEVNSKDHYKLLANKPLYQRAIIVAAGPIANFILAIFI 123

Query: 108 FTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPL 165
           F+  F   G     P++  V   SPAA AG+K GD I  ++G  + +  EV+  +     
Sbjct: 124 FSLIFMIKGKDSSIPIIQEVQKESPAASAGLKAGDQISFINGTKIESINEVSALINMPGA 183

Query: 166 HEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLH------SRT 219
            ++       +  +L  ++MP ++   D  G K Q   +GI  +    K+       ++ 
Sbjct: 184 DDVIQFEITRNSKLLKFEIMPIVKSGTDSLGNKSQRKMIGIKIAPLNNKMDRQQLGPTKA 243

Query: 220 VLQSFSRGLDEISSITRGFLG-VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA 278
           +  +F      I ++T G+LG V++ +   D    Q+ GP+ IA+I     D+GF  +++
Sbjct: 244 IYFAFKETYKTI-TLTLGYLGNVIAGSASPD----QLGGPIKIAQITGQVADYGFFPFLS 298

Query: 279 FLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
            +A  S ++G +NL PIP+LDGGHL  +L+E  RGK L   +     R G  ++  L F 
Sbjct: 299 IMAYISISLGLINLFPIPLLDGGHLFFYLIEFARGKPLSEKIQEYFYRFGFFLLFTLMFF 358

Query: 339 GIRNDIYGL 347
              ND+ GL
Sbjct: 359 ATFNDLKGL 367


>gi|23013457|ref|ZP_00053350.1| COG0750: Predicted membrane-associated Zn-dependent proteases 1
           [Magnetospirillum magnetotacticum MS-1]
          Length = 385

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 184/360 (51%), Gaps = 22/360 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
            +++ V L ++V +HEFGH++VAR   ++V  FS+GFGPE+ G  + +G RW++ L+PLG
Sbjct: 18  LVIFLVILTVVVFVHEFGHFLVARWNGVKVEVFSIGFGPEVWGRVAANGTRWRIGLLPLG 77

Query: 67  GYVSF---------------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF 111
           G+V                   DE+  ++F      ++   V+AGP AN + AIL     
Sbjct: 78  GFVKMFGDADAASATASDQPMSDEEKAQAFCHKRVGQRAAIVVAGPAANFLFAILGLAGM 137

Query: 112 FYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
           F   G  V +PV+  V P + A  AG+K GD I +++G  V  F+++   VR     E+S
Sbjct: 138 FMVLGQPVTQPVIGMVHPGTAAETAGLKAGDRITAINGRAVERFQDIQRMVRLEIESELS 197

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
           L + R       +   PR+      FG   +VP +GIS     T++     + +    L 
Sbjct: 198 LSVRRGDKS-FDVAARPRIISRKGVFGDMEKVPVLGISADPASTEIVRHGPVSALGEALA 256

Query: 230 EISSITRG-FLGVLSSAFG-KDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
           E  ++ R  F+G+     G +DT  +++ GP+ IA+ A      G  + + +  + S  +
Sbjct: 257 ETENMVRSTFIGIGQMINGTRDT--DELGGPIRIAKGAGEAAQLGLASVVFYTILLSLNL 314

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           G +NL PIPILDGGHL+ +  E I G+ LG        R+GL ++L L     RND+  L
Sbjct: 315 GLINLFPIPILDGGHLMFYAFEAILGRPLGEKAQEYGFRIGLFLVLALMVFATRNDLVSL 374


>gi|225630816|ref|YP_002727607.1| membrane-associated zinc metalloprotease, putative [Wolbachia sp.
           wRi]
 gi|225592797|gb|ACN95816.1| membrane-associated zinc metalloprotease, putative [Wolbachia sp.
           wRi]
          Length = 372

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 175/358 (48%), Gaps = 21/358 (5%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL +++ + +IV +HE+GHY+VA+ C ++V SFS+GFGPE+ G   +SG RWK+S +PLG
Sbjct: 18  FLSFSLIISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSAVPLG 77

Query: 67  GYVSFSED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF 111
           GYV    D               E+ + SF      KK   V AGP AN V A++ FT F
Sbjct: 78  GYVKMLGDTNAASVPADQQELTEEEKLYSFHTKPRHKKAAVVFAGPFANMVFAVIAFTIF 137

Query: 112 FYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
           F   G  +  PV+ NV   S A  AG+  GD I  ++   +  FE+++  +  NP   + 
Sbjct: 138 FSIAGYYRTPPVIENVIEGSAAKQAGLLPGDTITQINEHKIKYFEDISRVIMSNPKTRME 197

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            + Y  +       + P +    D FG   +  ++GI        L   + L + S  + 
Sbjct: 198 -IEYSRNNEKHRTSLTPLIIKDKDVFGNTIERETIGI---ISVNTLKQSSFLGAVSLSVS 253

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
           E        +  L         +N+I GP+ IA+ +      GF   + F+A+ S  +  
Sbjct: 254 ETYHTMCLTIKALFHIIVGKRSINEIGGPIKIAKYSGQSAKKGFIMVLYFMAIISANLAA 313

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +NLLPIP+LDGGHL  +++E +  + L +   +     G  ++  L   G+ NDI  L
Sbjct: 314 INLLPIPLLDGGHLFHYIIEAVIRRDLSLKCQKYAAIFGALVLFLLMATGMSNDIRDL 371


>gi|254689379|ref|ZP_05152633.1| membrane-associated zinc metalloprotease, putative [Brucella
           abortus bv. 6 str. 870]
 gi|260754897|ref|ZP_05867245.1| membrane metalloproteinase [Brucella abortus bv. 6 str. 870]
 gi|260675005|gb|EEX61826.1| membrane metalloproteinase [Brucella abortus bv. 6 str. 870]
          Length = 379

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 185/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +V  +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAVQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|163868106|ref|YP_001609310.1| zinc metalloprotease [Bartonella tribocorum CIP 105476]
 gi|161017757|emb|CAK01315.1| zinc metalloprotease [Bartonella tribocorum CIP 105476]
          Length = 376

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 111/351 (31%), Positives = 178/351 (50%), Gaps = 27/351 (7%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMR 79
           +HE GHY++ R C I+ L FS+GFGP++   T + G +W+++LIPLGGYV F  DE+   
Sbjct: 24  VHELGHYLIGRWCGIKALVFSLGFGPQIASYTDKHGTKWRLALIPLGGYVKFVGDEEKND 83

Query: 80  ------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNV 125
                       SF  A  WKK  TV AGP  N +  ++  TFFF+  G  V++PVV ++
Sbjct: 84  TLLSPSSPIVDGSFANAHAWKKAATVFAGPFFNALFTVVILTFFFFMYGRVVIEPVVGSL 143

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG-VLHLKV 184
              SPA  +G++ GD  + +DG  V +FE++  YV  +    I   +  E +G V    +
Sbjct: 144 VKDSPAIQSGLELGDRFVEMDGRRVESFEDLMNYVAFHGKEPIEFKI--ERMGRVFTTVI 201

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLH--SRTVLQSFSRG--------LDEISSI 234
            P++ +  D FG + Q   +G+    D        +T +++   G        L+  + I
Sbjct: 202 TPKVVERDDGFGNRTQSAMIGVGVPVDSNNPARLDQTYIKNIHYGFVTAIREALNRTAFI 261

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
           T      +S   G      ++SGP    +IA    + GF + +   A  S ++GF+NL P
Sbjct: 262 TTQTFLFMSRLIGGKEDRCRLSGPSKTVKIAWKVSEAGFISLLNLAAFLSISVGFINLFP 321

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           I  LDGGHL+  ++E+I G+ +   V  ++ R+G  ++L        ND +
Sbjct: 322 ILPLDGGHLLFHVIEVITGRKISTKVQGIVFRLGFSLLLLFMIFVFFNDYF 372


>gi|327399651|ref|YP_004340520.1| membrane-associated zinc metalloprotease [Hippea maritima DSM
           10411]
 gi|327182280|gb|AEA34461.1| membrane-associated zinc metalloprotease [Hippea maritima DSM
           10411]
          Length = 361

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 191/354 (53%), Gaps = 14/354 (3%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
            +L   V L+++V+IHEFGH++VARL  + V  FSVGFGP L     +    +  SLI L
Sbjct: 2   SWLWGIVGLVLMVIIHEFGHFIVARLLGVGVERFSVGFGPILFRFKPKK-TEYAFSLILL 60

Query: 66  GGYV-----SFSEDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGV-- 117
           GGYV     SF +D+      F A P WK++L V AGP  N V A++F     YN G+  
Sbjct: 61  GGYVKLKGESFKDDDAYQPDSFVAQPLWKRVLIVFAGPFFNIVSAVVFIALA-YNIGITT 119

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           + P V  V   SPA  AG+ +GD ++++DG +V  ++E+A  ++ +P   I+L + R   
Sbjct: 120 LAPTVGKVMKNSPAQAAGIHEGDIVVAIDGKSVRTWKEMAKLIKLHPNKMITLKIKRGD- 178

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
            ++ LK  P+     D FG +     +GI+ S D  KL    + +S  +G+ E   +T+ 
Sbjct: 179 KLIALKATPKSVRVKDVFGKEVLQGRLGIAPSGDTVKLRYGPI-ESVQKGIQETIYMTKL 237

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
            +  L     +    ++I GP+ I   A      G  A++ F+A+ S  +G +NLLPIP+
Sbjct: 238 IIVGLVKLIERVIPTSEIGGPIMIIDFAGKAASAGLGAFLWFIAVISINLGILNLLPIPV 297

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI--YGLMQ 349
           LDGGHL+ + +E +RGK +         ++G+ ++L L      ND   YG+++
Sbjct: 298 LDGGHLLFYTIEAVRGKPVSEKAQENFQKIGIALLLALMLFAFVNDFRRYGVVK 351


>gi|71083517|ref|YP_266236.1| membrane-associated zinc metalloprotease [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71062630|gb|AAZ21633.1| membrane-associated zinc metalloprotease [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 377

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 188/362 (51%), Gaps = 24/362 (6%)

Query: 6   CFLLYTVSLIIIVV-IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIP 64
            ++L  ++LI++VV IHE+GHY  A+   + V  FS+GFG E+ G   +SG RWKV +IP
Sbjct: 3   SYILPFIALIVVVVFIHEYGHYYFAKRYGVGVTDFSIGFGKEMFGWNDKSGTRWKVCVIP 62

Query: 65  LGGYVSFSED-----------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAIL 106
           LGGYV F  D                 ++D    F   P +++ L V  GPLAN ++AIL
Sbjct: 63  LGGYVKFFGDRNVYSQADNDKIIKEYSKEDQDKLFVLKPLYQRALIVFGGPLANFLLAIL 122

Query: 107 FF--TFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
            F   + F+       V++ V   SPA +AG+K  D ++S+DG  V++  +V+ Y+  + 
Sbjct: 123 IFFSVYTFFGKDFTPAVINEVQKDSPAMVAGLKDNDIVVSIDGNEVTSIMDVSKYIMMST 182

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF-SYDETKLHSRT-VLQ 222
              I+  + R     L  +V P + +  D  G K     VGI   +Y+    H +    +
Sbjct: 183 DEFINFTVNRFDQD-LTFRVKPNIVEGEDNLGNKISKRMVGIKLGAYNNEVNHVKLGPTK 241

Query: 223 SFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
           +    ++E+  ++   L  + S    +   +Q+ GP+ IA+I+    + G   +I+ +A 
Sbjct: 242 ALFYAVNEVYYVSTSSLKYIGSMLTGNGDTSQLGGPIRIAKISGQVAEFGILPFISLMAY 301

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S ++G +NL PIP+LDGGHL+ + +E + G+ L         R+G+ ++L L F    N
Sbjct: 302 ISISLGLINLFPIPMLDGGHLMFYGIEKVLGRPLSQKTQEGFFRIGMFLLLSLMFFTTFN 361

Query: 343 DI 344
           D+
Sbjct: 362 DL 363


>gi|225631212|ref|ZP_03787908.1| membrane-associated zinc metalloprotease, putative [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225591092|gb|EEH12278.1| membrane-associated zinc metalloprotease, putative [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 372

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 175/358 (48%), Gaps = 21/358 (5%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL +++ + +IV +HE+GHY+VA+ C ++V SFS+GFGPE+ G   +SG RWK+S +PLG
Sbjct: 18  FLSFSLIISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSAVPLG 77

Query: 67  GYVSFSED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF 111
           GYV    D               E+ + SF      KK   V AGP AN V A++ FT F
Sbjct: 78  GYVKMLGDTNAASVPADQQELTEEEKLYSFHTKLRHKKAAVVFAGPFANMVFAVIAFTIF 137

Query: 112 FYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
           F   G  +  PV+ NV   S A  AG+  GD I  ++   +  FE+++  +  NP   + 
Sbjct: 138 FSIAGYYRTPPVIENVIEGSAAKQAGLLPGDTITQINEHKIKYFEDISRVIMSNPKTRME 197

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            + Y  +       + P +    D FG   +  ++GI        L   + L + S  + 
Sbjct: 198 -IEYSRNNEKHRTSLTPLIIKDKDVFGNTIERETIGI---ISVNTLKQSSFLGAVSLSVS 253

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
           E        +  L         +N+I GP+ IA+ +      GF   + F+A+ S  +  
Sbjct: 254 ETYHTMCLTIKALFHIIVGKRSINEIGGPIKIAKYSGQSAKKGFIMVLYFMAIISANLAA 313

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +NLLPIP+LDGGHL  +++E +  + L +   +     G  ++  L   G+ NDI  L
Sbjct: 314 INLLPIPLLDGGHLFHYIIEAVIRRDLSLKCQKYAAIFGALVLFLLMATGMSNDIRDL 371


>gi|332185986|ref|ZP_08387732.1| RIP metalloprotease RseP [Sphingomonas sp. S17]
 gi|332013801|gb|EGI55860.1| RIP metalloprotease RseP [Sphingomonas sp. S17]
          Length = 378

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 175/360 (48%), Gaps = 20/360 (5%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L +  +L  +V +HE GHY+  R   ++  +FS+GFG E+ G T R G RWK+  +PL
Sbjct: 10  TILAFVCALGPLVFVHEMGHYLAGRWFGVKADTFSIGFGREMAGFTDRRGTRWKIGWLPL 69

Query: 66  GGYVSFSED----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFT 109
           GGYV F+ D                E+  R+F     W++ + V AGP  N   AIL   
Sbjct: 70  GGYVKFAGDMNPASQPDAAWLSLPPEERARTFQAKPVWQRAIIVAAGPAINFFAAILILA 129

Query: 110 FFFYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE 167
            F Y  G  V+ PVV  V P S AA   +K GD + ++DG  V+ F ++A YV+      
Sbjct: 130 GFAYAYGEVVIPPVVGQVMPGSAAAATSLKPGDRVTAIDGRAVTDFADIARYVQIRAGEP 189

Query: 168 ISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRG 227
           +++   R          +   Q   DRFG + +V  +G+        +   ++L++    
Sbjct: 190 VTIAATRNGTPFTTSTTIGSEQQR-DRFGNQYRVGRLGLR-GAGTIDVQPVSLLRAPVVA 247

Query: 228 LDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
           ++    I R  +  L         + ++ GPV IA+++      G +A++ F+A+ S  +
Sbjct: 248 VERTGEIVRMMVETLGQVISGRRSVKELGGPVSIAKVSGEQMSLGIDAFVFFVALVSINL 307

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           GF+NLLP+P+LDGGHL+ + +E +R + L         R GL  IL L      ND+  L
Sbjct: 308 GFINLLPVPMLDGGHLLFYAIEAVRRRPLEPVAQEWAFRGGLLAILALMLFVTFNDLGNL 367


>gi|254719218|ref|ZP_05181029.1| membrane-associated zinc metalloprotease, putative [Brucella sp.
           83/13]
 gi|265984213|ref|ZP_06096948.1| membrane metalloproteinase [Brucella sp. 83/13]
 gi|306837967|ref|ZP_07470825.1| membrane-associated zinc metalloprotease, putative [Brucella sp. NF
           2653]
 gi|264662805|gb|EEZ33066.1| membrane metalloproteinase [Brucella sp. 83/13]
 gi|306406891|gb|EFM63112.1| membrane-associated zinc metalloprotease, putative [Brucella sp. NF
           2653]
          Length = 379

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 185/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I+ F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIVIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|91762064|ref|ZP_01264029.1| membrane-associated zinc metalloprotease [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91717866|gb|EAS84516.1| membrane-associated zinc metalloprotease [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 377

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 188/362 (51%), Gaps = 24/362 (6%)

Query: 6   CFLLYTVSLIIIVV-IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIP 64
            ++L  ++LI++VV IHE+GHY  A+   + V  FS+GFG E+ G   +SG RWKV +IP
Sbjct: 3   SYILPFIALIVVVVFIHEYGHYYFAKRYGVGVTDFSIGFGKEMFGWNDKSGTRWKVCVIP 62

Query: 65  LGGYVSFSED-----------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAIL 106
           LGGYV F  D                 ++D    F   P +++ L V  GPLAN ++AIL
Sbjct: 63  LGGYVKFFGDRNVYSQADNDKIIKEYSKEDQDKLFVLKPLYQRSLIVFGGPLANFLLAIL 122

Query: 107 FF--TFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
            F   + F+       V++ V   SPA +AG+K  D ++S+DG  V++  +V+ Y+  + 
Sbjct: 123 IFFSVYTFFGKDFTPAVINEVQKDSPAMVAGLKDNDIVVSIDGNEVTSIMDVSKYIMMST 182

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF-SYDETKLHSRT-VLQ 222
              I+  + R     L  +V P + +  D  G K     VGI   +Y+    H +    +
Sbjct: 183 DEFINFTVNRFDQD-LTFRVKPNIVEGEDNLGNKISKRMVGIKLGAYNNEVNHVKLGPTK 241

Query: 223 SFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
           +    ++E+  ++   L  + S    +   +Q+ GP+ IA+I+    + G   +I+ +A 
Sbjct: 242 ALFYAVNEVYYVSTSSLKYIGSMLTGNGDTSQLGGPIRIAKISGQVAEFGILPFISLMAY 301

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S ++G +NL PIP+LDGGHL+ + +E + G+ L         R+G+ ++L L F    N
Sbjct: 302 ISISLGLINLFPIPMLDGGHLMFYGIEKVLGRPLSQKTQEGFFRIGMFLLLSLMFFTTFN 361

Query: 343 DI 344
           D+
Sbjct: 362 DL 363


>gi|326388637|ref|ZP_08210230.1| peptidase RseP [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206888|gb|EGD57712.1| peptidase RseP [Novosphingobium nitrogenifigens DSM 19370]
          Length = 360

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/348 (34%), Positives = 183/348 (52%), Gaps = 27/348 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED-- 74
           +V IHE GHY+  RL  +R   FS+GFG EL+G T R G RWK+S++PLGGYV F+ D  
Sbjct: 10  LVFIHELGHYLAGRLFGVRADVFSIGFGRELLGWTDRRGTRWKLSVLPLGGYVQFAGDVN 69

Query: 75  --------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGVM 118
                         E+  ++      W++ + VLAGPL N V A+L    F   Y T V 
Sbjct: 70  PAGQPSAEWLSLPPEERAKTLLGRPLWQRAIIVLAGPLINLVAAVLILAGFAMAYGTLVA 129

Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR-EHV 177
            PV+  V+  S A  AG+  GD ++SL G +V  F ++   V ++P   + +V+ R  H 
Sbjct: 130 PPVIGMVAKGSAAEQAGLMPGDRVVSLLGSSVDTFLQIRMTVSQHPGEVLDVVVDRGGH- 188

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETK-LHSRTVLQSFSRGLDEISSITR 236
             L  ++ P  +   D+FG  + +  +GI+ +  E + +     L+   R   +I ++T 
Sbjct: 189 -RLDKRITPVTKVETDQFGNSQAIGFLGIAPATIERRPVGPLGALEVGVRQTRDIIAMT- 246

Query: 237 GFLGVLSSAFGK-DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
              G+     GK D R  ++ GP+ IA+ +   F  G+ +++ F+A+ S  +GF+NLLPI
Sbjct: 247 -VTGIRQIVVGKRDVR--ELGGPIKIAKYSGEQFVSGWQSFVGFIALISINLGFINLLPI 303

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
           P+LDGGHL  FL E IR K +      +    GL +++ L      ND
Sbjct: 304 PVLDGGHLALFLAEAIRRKPISQRAQELAFGTGLVLVVALMLFVTFND 351


>gi|153009365|ref|YP_001370580.1| putative membrane-associated zinc metalloprotease [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561253|gb|ABS14751.1| putative membrane-associated zinc metalloprotease [Ochrobactrum
           anthropi ATCC 49188]
          Length = 379

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/349 (33%), Positives = 185/349 (53%), Gaps = 28/349 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE----- 75
           HE GHY+VAR C I   +FS+GFGPELIG T + G RWK+S IPLGGYV F  DE     
Sbjct: 33  HEMGHYLVARWCGIGSQAFSIGFGPELIGFTDKHGTRWKISAIPLGGYVKFIGDESATSS 92

Query: 76  ------------KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                       +  R+F     WK+  TV AGP  N ++ I+ F+ FF  Y   +  P+
Sbjct: 93  PVDVDNASLSADEQRRAFHTQPVWKRAATVFAGPAFNIILTIVIFSVFFALYGRQISDPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  IS++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEAGDRFISVEGEKITTFSDVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISS-ITR 236
           L+ +P + +  D  G K ++ ++G+  +  E   + R +    L+S  + + E    I+R
Sbjct: 212 LQAVPAIVERTDPLGNKIKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVMETGYIISR 269

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
                   A G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+P
Sbjct: 270 TGEFFQRFAVGREDKC-QLGGPVKIANMAGKAASQGFDWLIQLMAMLSVGIGLLNLFPLP 328

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
            LDGGHL+ + +E I+G  + V+   +  R+G  +++      + ND++
Sbjct: 329 PLDGGHLVFYAVEAIKGSPVSVAAQEIFYRVGFLLVMGFMGFVLFNDLF 377


>gi|42520892|ref|NP_966807.1| membrane-associated zinc metalloprotease, putative [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42410632|gb|AAS14741.1| membrane-associated zinc metalloprotease, putative [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 372

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 113/359 (31%), Positives = 179/359 (49%), Gaps = 23/359 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL +++ + +IV +HE+GHY+VA+ C ++V SFS+GFGPE+ G   +SG RWK+S++PLG
Sbjct: 18  FLSFSLIISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSVVPLG 77

Query: 67  GYVSFSED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF 111
           GYV    D               E+ + SF      KK   V AGP AN V A++ FT F
Sbjct: 78  GYVKMLGDTNAASVPADQQELTEEEKLYSFHTKPRHKKAAVVFAGPFANMVFAVIAFTIF 137

Query: 112 FYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
           F   G  +  PV+ NV   S A  AG+  GD I  ++   +  FE+++  +  NP   + 
Sbjct: 138 FSIAGYYRTPPVIENVIEGSAAKQAGLLPGDTITQINEHKIKYFEDISRVIMSNPKTRME 197

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            V Y  +       + P +    D FG   +  ++GI        L   + L + S  + 
Sbjct: 198 -VEYSRNNEKHRTSLTPLIIKDKDVFGNTIERETIGI---ISVNTLKQSSFLGAVSLSVS 253

Query: 230 EI-SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           E   ++      +     GK +  ++I GP+ IA+ +      GF   + F+A+ S  + 
Sbjct: 254 ETYHTMCLTIKAIFQIIVGKRSA-SKIGGPIKIAKYSGQSAKKGFIMVLYFMAIISANLA 312

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            +NLLPIP+LDGGHL  +++E +  + L +   +     G  ++  L   G+ NDI  L
Sbjct: 313 AINLLPIPLLDGGHLFHYIIEAVIRRDLSLKCQKYAAIFGALVLFLLMATGMSNDIRDL 371


>gi|254704442|ref|ZP_05166270.1| membrane-associated zinc metalloprotease, putative [Brucella suis
           bv. 3 str. 686]
 gi|261755120|ref|ZP_05998829.1| membrane metalloproteinase [Brucella suis bv. 3 str. 686]
 gi|261744873|gb|EEY32799.1| membrane metalloproteinase [Brucella suis bv. 3 str. 686]
          Length = 379

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 184/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNEGALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|23502034|ref|NP_698161.1| membrane-associated zinc metalloprotease [Brucella suis 1330]
 gi|62290069|ref|YP_221862.1| membrane-associated zinc metalloprotease [Brucella abortus bv. 1
           str. 9-941]
 gi|82699995|ref|YP_414569.1| hypothetical protein BAB1_1178 [Brucella melitensis biovar Abortus
           2308]
 gi|161619107|ref|YP_001592994.1| membrane-associated zinc metalloprotease [Brucella canis ATCC
           23365]
 gi|163843420|ref|YP_001627824.1| membrane-associated zinc metalloprotease [Brucella suis ATCC 23445]
 gi|189024308|ref|YP_001935076.1| membrane-associated zinc metalloprotease [Brucella abortus S19]
 gi|225627624|ref|ZP_03785661.1| membrane-associated zinc metalloprotease [Brucella ceti str. Cudo]
 gi|237815575|ref|ZP_04594572.1| membrane-associated zinc metalloprotease [Brucella abortus str.
           2308 A]
 gi|254693863|ref|ZP_05155691.1| membrane-associated zinc metalloprotease, putative [Brucella
           abortus bv. 3 str. Tulya]
 gi|254701897|ref|ZP_05163725.1| membrane-associated zinc metalloprotease, putative [Brucella suis
           bv. 5 str. 513]
 gi|254706662|ref|ZP_05168490.1| membrane-associated zinc metalloprotease, putative [Brucella
           pinnipedialis M163/99/10]
 gi|254710230|ref|ZP_05172041.1| membrane-associated zinc metalloprotease, putative [Brucella
           pinnipedialis B2/94]
 gi|254714226|ref|ZP_05176037.1| membrane-associated zinc metalloprotease, putative [Brucella ceti
           M644/93/1]
 gi|254717662|ref|ZP_05179473.1| membrane-associated zinc metalloprotease, putative [Brucella ceti
           M13/05/1]
 gi|254730409|ref|ZP_05188987.1| membrane-associated zinc metalloprotease, putative [Brucella
           abortus bv. 4 str. 292]
 gi|256031724|ref|ZP_05445338.1| membrane-associated zinc metalloprotease, putative [Brucella
           pinnipedialis M292/94/1]
 gi|256061237|ref|ZP_05451388.1| membrane-associated zinc metalloprotease, putative [Brucella
           neotomae 5K33]
 gi|256257625|ref|ZP_05463161.1| membrane-associated zinc metalloprotease, putative [Brucella
           abortus bv. 9 str. C68]
 gi|256369581|ref|YP_003107091.1| membrane-associated zinc metalloprotease, putative [Brucella
           microti CCM 4915]
 gi|260168857|ref|ZP_05755668.1| membrane-associated zinc metalloprotease, putative [Brucella sp.
           F5/99]
 gi|260546619|ref|ZP_05822358.1| membrane metalloproteinase [Brucella abortus NCTC 8038]
 gi|260566311|ref|ZP_05836781.1| membrane metalloproteinase [Brucella suis bv. 4 str. 40]
 gi|260758114|ref|ZP_05870462.1| membrane metalloproteinase [Brucella abortus bv. 4 str. 292]
 gi|260883909|ref|ZP_05895523.1| membrane metalloproteinase [Brucella abortus bv. 9 str. C68]
 gi|261214149|ref|ZP_05928430.1| membrane metalloproteinase [Brucella abortus bv. 3 str. Tulya]
 gi|261219503|ref|ZP_05933784.1| membrane metalloproteinase [Brucella ceti M13/05/1]
 gi|261314122|ref|ZP_05953319.1| membrane metalloproteinase [Brucella pinnipedialis M163/99/10]
 gi|261317789|ref|ZP_05956986.1| membrane metalloproteinase [Brucella pinnipedialis B2/94]
 gi|261321998|ref|ZP_05961195.1| membrane metalloproteinase [Brucella ceti M644/93/1]
 gi|261325245|ref|ZP_05964442.1| membrane metalloproteinase [Brucella neotomae 5K33]
 gi|261752461|ref|ZP_05996170.1| membrane metalloproteinase [Brucella suis bv. 5 str. 513]
 gi|261758345|ref|ZP_06002054.1| membrane metalloproteinase [Brucella sp. F5/99]
 gi|265988820|ref|ZP_06101377.1| membrane metalloproteinase [Brucella pinnipedialis M292/94/1]
 gi|297248467|ref|ZP_06932185.1| RIP metalloprotease RseP [Brucella abortus bv. 5 str. B3196]
 gi|306841879|ref|ZP_07474559.1| membrane-associated zinc metalloprotease, putative [Brucella sp.
           BO2]
 gi|38258793|sp|Q8G0E1|Y1156_BRUSU RecName: Full=Putative zinc metalloprotease BR1156
 gi|23347988|gb|AAN30076.1| membrane-associated zinc metalloprotease, putative [Brucella suis
           1330]
 gi|62196201|gb|AAX74501.1| hypothetical membrane-associated zinc metalloprotease [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616096|emb|CAJ11134.1| Mammalian sterol-regulatory element binding protein (SREBP) site 2
           protease:PDZ/DHR/GLGF domain:Zinc metalloprotease
           (putativ [Brucella melitensis biovar Abortus 2308]
 gi|161335918|gb|ABX62223.1| membrane-associated zinc metalloprotease [Brucella canis ATCC
           23365]
 gi|163674143|gb|ABY38254.1| membrane-associated zinc metalloprotease [Brucella suis ATCC 23445]
 gi|189019880|gb|ACD72602.1| membrane-associated zinc metalloprotease, putative [Brucella
           abortus S19]
 gi|225617629|gb|EEH14674.1| membrane-associated zinc metalloprotease [Brucella ceti str. Cudo]
 gi|237788873|gb|EEP63084.1| membrane-associated zinc metalloprotease [Brucella abortus str.
           2308 A]
 gi|255999743|gb|ACU48142.1| membrane-associated zinc metalloprotease, putative [Brucella
           microti CCM 4915]
 gi|260095669|gb|EEW79546.1| membrane metalloproteinase [Brucella abortus NCTC 8038]
 gi|260155829|gb|EEW90909.1| membrane metalloproteinase [Brucella suis bv. 4 str. 40]
 gi|260668432|gb|EEX55372.1| membrane metalloproteinase [Brucella abortus bv. 4 str. 292]
 gi|260873437|gb|EEX80506.1| membrane metalloproteinase [Brucella abortus bv. 9 str. C68]
 gi|260915756|gb|EEX82617.1| membrane metalloproteinase [Brucella abortus bv. 3 str. Tulya]
 gi|260924592|gb|EEX91160.1| membrane metalloproteinase [Brucella ceti M13/05/1]
 gi|261294688|gb|EEX98184.1| membrane metalloproteinase [Brucella ceti M644/93/1]
 gi|261297012|gb|EEY00509.1| membrane metalloproteinase [Brucella pinnipedialis B2/94]
 gi|261301225|gb|EEY04722.1| membrane metalloproteinase [Brucella neotomae 5K33]
 gi|261303148|gb|EEY06645.1| membrane metalloproteinase [Brucella pinnipedialis M163/99/10]
 gi|261738329|gb|EEY26325.1| membrane metalloproteinase [Brucella sp. F5/99]
 gi|261742214|gb|EEY30140.1| membrane metalloproteinase [Brucella suis bv. 5 str. 513]
 gi|264661017|gb|EEZ31278.1| membrane metalloproteinase [Brucella pinnipedialis M292/94/1]
 gi|297175636|gb|EFH34983.1| RIP metalloprotease RseP [Brucella abortus bv. 5 str. B3196]
 gi|306288009|gb|EFM59411.1| membrane-associated zinc metalloprotease, putative [Brucella sp.
           BO2]
          Length = 379

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 184/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|256159890|ref|ZP_05457612.1| membrane-associated zinc metalloprotease, putative [Brucella ceti
           M490/95/1]
 gi|256255124|ref|ZP_05460660.1| membrane-associated zinc metalloprotease, putative [Brucella ceti
           B1/94]
 gi|261222322|ref|ZP_05936603.1| membrane metalloproteinase [Brucella ceti B1/94]
 gi|265998286|ref|ZP_06110843.1| membrane metalloproteinase [Brucella ceti M490/95/1]
 gi|260920906|gb|EEX87559.1| membrane metalloproteinase [Brucella ceti B1/94]
 gi|262552754|gb|EEZ08744.1| membrane metalloproteinase [Brucella ceti M490/95/1]
          Length = 379

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 184/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERADPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|99036032|ref|ZP_01315070.1| hypothetical protein Wendoof_01000087 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 372

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 112/359 (31%), Positives = 179/359 (49%), Gaps = 23/359 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL +++ + +IV +HE+GHY+VA+ C ++V SFS+GFGPE+ G   +SG RWK+S++PLG
Sbjct: 18  FLSFSLIISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSVVPLG 77

Query: 67  GYVSFSED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF 111
           GYV    D               E+ + SF      KK   V AGP AN V A++ FT F
Sbjct: 78  GYVKMLGDTNAASVPADQQELTEEEKLYSFHTKPRHKKAAVVFAGPFANMVFAVIAFTIF 137

Query: 112 FYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
           F   G  +  PV+ NV   S A  AG+  GD I  ++   +  FE+++  +  NP   + 
Sbjct: 138 FSIAGYYRTPPVIENVIEGSAAKQAGLLPGDTITQINEHKIKYFEDISRVIMSNPKTRME 197

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            + Y  +       + P +    D FG   +  ++GI        L   + L + S  + 
Sbjct: 198 -IEYSRNNEKHRTSLTPLIIKDKDVFGNTIERETIGI---ISVNTLKQSSFLGAVSLSVS 253

Query: 230 EI-SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           E   ++      +     GK +  ++I GP+ IA+ +      GF   + F+A+ S  + 
Sbjct: 254 ETYHTMCLTIKAIFQIIVGKRSA-SEIGGPIKIAKYSGQSAKKGFIMVLYFMAIISANLA 312

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            +NLLPIP+LDGGHL  +++E +  + L +   +     G  ++  L   G+ NDI  L
Sbjct: 313 AINLLPIPLLDGGHLFHYIIEAVIRRDLSLKCQKYAAIFGALVLFLLMATGMSNDIRDL 371


>gi|294852495|ref|ZP_06793168.1| RIP metalloprotease RseP [Brucella sp. NVSL 07-0026]
 gi|294821084|gb|EFG38083.1| RIP metalloprotease RseP [Brucella sp. NVSL 07-0026]
          Length = 379

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 184/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQTVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|304391651|ref|ZP_07373593.1| RIP metalloprotease RseP [Ahrensia sp. R2A130]
 gi|303295880|gb|EFL90238.1| RIP metalloprotease RseP [Ahrensia sp. R2A130]
          Length = 381

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 180/364 (49%), Gaps = 22/364 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F L   L + V L I+V  HE GH+ VAR   ++V +F+VGFGPELIG T + G RWK+ 
Sbjct: 13  FALTKVLPFIVVLTIVVFFHELGHFAVARWNRVKVDAFAVGFGPELIGRTDKHGTRWKLC 72

Query: 62  LIPLGGYVSFSEDEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMA 104
            IPLGGYV F  D  +                   +F   + W++   V AGP+AN ++A
Sbjct: 73  AIPLGGYVRFLGDANEASAPDAHALEGMTSEELDGAFQNKSVWRRAAVVAAGPIANFILA 132

Query: 105 ILFFT-FFFYNTGVMKP-VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
            + +T  F Y   V  P VV  V+  +PA  AG+  GD I S++G  V+ FE+V+     
Sbjct: 133 SVIYTGVFVYQGEVTVPAVVGEVTEGAPAQQAGILPGDLITSVEGQDVADFEDVSRLTMI 192

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT--V 220
           +    ++  + R+    L   V P + +  D+FG   +V  +GIS          R   +
Sbjct: 193 SSDQPLAFTVDRDGKS-LDFIVAPLMTERKDQFGNTYKVGLIGISSRRGVENFVHRDLGI 251

Query: 221 LQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
            ++F + +D I  I       L   F      +Q+ GP+GI ++       G  + ++  
Sbjct: 252 GEAFVKSIDAIGLIISRTGYFLRDIFLGKQDADQLRGPLGIGQMTSQVATLGIVSLLSLA 311

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           A  S +IG MNL PIP+LDGGHL+ +  E IRG++       +  R+GL  +L +     
Sbjct: 312 AALSVSIGLMNLFPIPMLDGGHLVFYAYEAIRGRAASPRAQEIAYRVGLTCVLMMMIFAT 371

Query: 341 RNDI 344
            NDI
Sbjct: 372 SNDI 375


>gi|83592928|ref|YP_426680.1| peptidase RseP [Rhodospirillum rubrum ATCC 11170]
 gi|83575842|gb|ABC22393.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Rhodospirillum rubrum ATCC 11170]
          Length = 367

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 117/362 (32%), Positives = 181/362 (50%), Gaps = 25/362 (6%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L + V L  +V +HEFGH++VARL  +RV  FS+GFG EL G   R G RW++SL+
Sbjct: 5   LHTVLSFLVVLTAVVFVHEFGHFLVARLNGVRVEVFSIGFGRELFGFNDRYGTRWRLSLL 64

Query: 64  PLGGYVSFSEDEKDMR----------------SFFCAAPWKKILTVLAGPLANCVMAILF 107
           PLGGYV F  D  +                  SF      ++   VLAGP+AN + +I+ 
Sbjct: 65  PLGGYVRFFGDADETSGTAETTRPLSKAEEAVSFHHKRVGQRFAIVLAGPMANFLFSIVV 124

Query: 108 FTFFFYNTGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV---APYVRE 162
           F   +   G     PVV  V   S AA AG+  GD I+++DG  +  F++V    P    
Sbjct: 125 FAGLYMTIGQPHSAPVVGEVIAGSAAAEAGLLAGDRIVAIDGTPIDRFQDVRRVVPLSNG 184

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQ 222
            PLH   + + R++   L +  +PR+ +T D  G K QV  +G+  S  +  +     L 
Sbjct: 185 APLH---IDILRDNA-PLAVIALPRMVETDDGLGNKVQVAQLGVKVSLSQADVQRLGPLD 240

Query: 223 SFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
           +  + + +   ++   L  L      +    ++ GPV IA+ +    + G    + F+A+
Sbjct: 241 ALGQAVGQTWQLSADTLTYLGQVVRGNRSAEELGGPVRIAQFSGKAAERGVLDLVTFIAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NL PIP+LDGGHL+ + +E +RG+ LG        R GL ++L +      N
Sbjct: 301 LSVNLGLINLFPIPMLDGGHLMFYTIEALRGRPLGARAQEYGLRFGLALVLAMMVFATWN 360

Query: 343 DI 344
           D+
Sbjct: 361 DL 362


>gi|148559202|ref|YP_001259074.1| RIP metalloprotease RseP [Brucella ovis ATCC 25840]
 gi|148370459|gb|ABQ60438.1| RIP metalloprotease RseP [Brucella ovis ATCC 25840]
          Length = 379

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 183/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G   ++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLFVMGFMGFVLFNDLF 377


>gi|239832043|ref|ZP_04680372.1| membrane-associated zinc metalloprotease [Ochrobactrum intermedium
           LMG 3301]
 gi|239824310|gb|EEQ95878.1| membrane-associated zinc metalloprotease [Ochrobactrum intermedium
           LMG 3301]
          Length = 421

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 183/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE----- 75
           HE GHY+VAR C I   +FS+GFGPELIG T + G RWK+S IPLGGYV F  DE     
Sbjct: 75  HEMGHYLVARWCGIGSQAFSIGFGPELIGFTDKHGTRWKISAIPLGGYVKFIGDESATSS 134

Query: 76  ------------KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                       +  R+F     WK+  TV AGP  N ++ ++ F+ FF  Y   +  P+
Sbjct: 135 PVDVNNASLSVDEQRRAFHTQPVWKRAATVFAGPAFNIILTVVIFSVFFALYGRQISDPL 194

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  IS+DG  ++ F +V   V      +++  + R+   ++ 
Sbjct: 195 IAGVQPGSPAAEAGFEAGDRFISVDGEKITTFSDVQRIVSGRAGDKLNFTVERDGK-MVD 253

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P + +  D  G K ++ ++G+  +  E   + R +    L+S ++ + E   I  G
Sbjct: 254 LQAVPAIVERTDPLGNKIKLGAIGVETT--EAVGNFRRIEYGPLESVAQAVMETGYII-G 310

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 311 RTGEFFQRFAVGREDKC-QLGGPVKIANMAGKAASQGFDWLIQLMAMLSVGIGLLNLFPL 369

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +      +  R G  +++      + ND++
Sbjct: 370 PPLDGGHLVFYAVEAIKGSPVSAPAQDIFYRAGFLLVMGFMGFVLFNDLF 419


>gi|190571425|ref|YP_001975783.1| membrane-associated zinc metalloprotease [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213018824|ref|ZP_03334632.1| membrane-associated zinc metalloprotease [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|190357697|emb|CAQ55146.1| membrane-associated zinc metalloprotease [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212995775|gb|EEB56415.1| membrane-associated zinc metalloprotease [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 371

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 113/359 (31%), Positives = 181/359 (50%), Gaps = 21/359 (5%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL +++ + IIV +HE GHY+VA+ C ++V SFS+GFGPE+ G   +SG RWK+S  PLG
Sbjct: 15  FLSFSLIISIIVFVHECGHYIVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSAFPLG 74

Query: 67  GYVSFSED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF 111
           GYV    D               E+ + SF     ++K   V AGP AN +  ++ FT F
Sbjct: 75  GYVKMLGDTNAASVPVDQQKLTEEEKLYSFHTKPRYQKAAIVFAGPFANMIFTVIAFTIF 134

Query: 112 FYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
           F   G  +  PV+ NV   S A  AG+  GD I  ++   +  FE+++  +  NP   I 
Sbjct: 135 FSVAGYYRTPPVIGNVIEESAAKQAGLLPGDTITQINEYKIKYFEDISRVIMSNPETRIE 194

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
           +   R +     + + P   +  D FG   +  ++GI+ S +   L   + L + S  ++
Sbjct: 195 IKYSRNNEEYRTI-LTPFTVEDRDVFGNIIERKTIGIT-SINMIGLKQSSFLGAASLSVN 252

Query: 230 EI-SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           E   ++      +     GK + +N+I GP+ IA+ +      G    + F+A+ S  + 
Sbjct: 253 ETYHTMCLTIKALFQIVVGKRS-INEIGGPIKIAKYSGQSAKKGLIMVLYFMAIISANLA 311

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            +NLLPIP+LDGGHL  +++E +  + L +   +     G  I+  L  + I NDI  L
Sbjct: 312 AINLLPIPLLDGGHLFHYIIEAVIRRDLSLKYQKYAATFGATILFLLMAVAITNDIRHL 370


>gi|240850309|ref|YP_002971702.1| membrane-associated zinc metalloprotease [Bartonella grahamii
           as4aup]
 gi|240267432|gb|ACS51020.1| membrane-associated zinc metalloprotease [Bartonella grahamii
           as4aup]
          Length = 382

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 180/352 (51%), Gaps = 29/352 (8%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMR 79
           +HEFGHY++AR C I+ L FS+GFGPE+   T + G +W+++LIP+GGYV F  DE+   
Sbjct: 30  VHEFGHYLIARWCGIKALVFSLGFGPEIASYTDKHGTKWRLALIPVGGYVKFVGDEEKND 89

Query: 80  ------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNV 125
                       SF  A  WKK  TV AGP  N +  ++  TFFF+  G   ++PVV ++
Sbjct: 90  TVSSQSSLIVDGSFASAHAWKKAATVFAGPFFNALFTVVILTFFFFIYGRVAIEPVVGSL 149

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
              SPA  +G++ GD  + +DG  V +FE++  YV  +    I   +  E +G     V+
Sbjct: 150 VKDSPALQSGLELGDRFVEMDGRRVESFEDLMNYVAFHGREPIEFKI--ERMGRFFTTVI 207

Query: 186 -PRLQDTVDRFGIKRQVPSVGISFSYDETK------LHSRTVLQSFSRGLDEISS----- 233
            P++ +  D FG + +   +G+    D          + + +   F   + E S      
Sbjct: 208 TPKIVERDDGFGNRTRSAMIGVGVPIDLNNPAHLDPTYIKHIRYGFVTAVREASDRTVFI 267

Query: 234 ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
           +T+  L +     GK+ R  ++SGP    +IA    + GF + +   A  S ++G +NL 
Sbjct: 268 VTQTVLFMSRLIGGKEDRC-RLSGPSKTVKIAWKVSETGFVSLLNLAAFLSISVGLINLF 326

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           PI  LDGGHL+  ++E+I G+ +   +  +I R+G  I+L        ND +
Sbjct: 327 PILPLDGGHLLLHVIEVITGREISAKIQGIIFRLGFSILLLFMIFVFFNDYF 378


>gi|239948524|ref|ZP_04700277.1| RIP metalloprotease RseP [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922800|gb|EER22824.1| RIP metalloprotease RseP [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 357

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 111/351 (31%), Positives = 189/351 (53%), Gaps = 15/351 (4%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + +++ I+V IHEFGHY +AR  N++V  FS+GFG ELIGIT + GVRWK+ LIPLGGYV
Sbjct: 7   FIITISILVFIHEFGHYCIARYFNVKVEEFSIGFGKELIGITDKKGVRWKICLIPLGGYV 66

Query: 70  SF----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGV 117
                       +E+  +  +F+  +  ++ L V AGPL N ++A++ F  F  ++    
Sbjct: 67  KIYGYDRSLMDKTEEINEKVAFYAKSCLERFLIVAAGPLINYLLAVIIFAGFYCYFGKTE 126

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           + P++ +V  +SPA  A +++GD I+ ++  +V  F +V   +  N     +L + R++ 
Sbjct: 127 IPPIIGDVVASSPAERADLREGDKIVKVNDKSVKDFGDVQKEILINGFSPSTLTIERKNE 186

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITR 236
             + + +MP+ +  +     K+   ++ I        +H++  +L  F   ++    ++ 
Sbjct: 187 EFI-VNIMPQ-EIIISPPEEKKVKKTLRIGIIAKNEPIHTKIGILGGFWEAINTTIDMSA 244

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L  +S         ++I GPV IA+ +      G   Y+ F+AM S  +G +NLLPIP
Sbjct: 245 LTLKAISQMIVGKRSFDEIGGPVAIAKESGKSIAGGGQMYLLFIAMLSVNLGLLNLLPIP 304

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +LDGGHL+  L E I  K        ++ ++G  II+FL  + + NDI  L
Sbjct: 305 VLDGGHLVIILYEAITDKLPNPKTKNILLQLGAIIIIFLIIISVSNDIQNL 355


>gi|298291816|ref|YP_003693755.1| membrane-associated zinc metalloprotease [Starkeya novella DSM 506]
 gi|296928327|gb|ADH89136.1| membrane-associated zinc metalloprotease [Starkeya novella DSM 506]
          Length = 381

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 176/352 (50%), Gaps = 22/352 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH+ VAR   ++V++FSVGFGPE++G   R G RWK+S IPLGGYV F  
Sbjct: 25  LTIVVFFHELGHFWVARRAGVKVVAFSVGFGPEIVGFNDRHGTRWKLSAIPLGGYVKFLG 84

Query: 74  D----------------EKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D                E+D R SFF      +   V AGP+AN ++AI+ F   F   G
Sbjct: 85  DESAASTPDRGALDTMSEEDRRGSFFHKPVGARAAIVAAGPIANFILAIVIFAGLFMTVG 144

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V  P V +V   S A  AG    D I+S+DG  + +F ++   V  +   ++S+V+ R
Sbjct: 145 RQVTTPQVDSVQAGSAAERAGFLPNDVILSIDGEKIDSFGDMRRVVSASADQKLSIVVER 204

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSY--DETKLHSRTVLQSFSRGLDEIS 232
               V  L   P  ++  D FG   ++  +GIS +    + K      +++ +    E+ 
Sbjct: 205 GGQQVT-LDATPDRREITDSFGNVHRIGVLGISRNTAGGQVKTERFGPVEAVTMAGREVW 263

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            I       L          +Q+ GP+ IA+++      G  A +   A+ S +IG +NL
Sbjct: 264 FIVDRTFSYLGGVVTGRESADQLGGPIRIAQVSGQVATFGIAALLQLAAVLSVSIGLLNL 323

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            P+P+LDGGHL+ + +E +RG+ L      V  R+GL ++L L      NDI
Sbjct: 324 FPVPLLDGGHLLFYAIEALRGRPLSERAQEVGFRIGLALVLMLMLFATWNDI 375


>gi|306844020|ref|ZP_07476615.1| membrane-associated zinc metalloprotease, putative [Brucella sp.
           BO1]
 gi|306275775|gb|EFM57499.1| membrane-associated zinc metalloprotease, putative [Brucella sp.
           BO1]
          Length = 379

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 183/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESLLSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R    ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERGGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASRAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|319783665|ref|YP_004143141.1| membrane-associated zinc metalloprotease [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169553|gb|ADV13091.1| membrane-associated zinc metalloprotease [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 380

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 175/349 (50%), Gaps = 25/349 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRS 80
           HE GHY+V R C I V +FS+GFGPEL G     G RWK+  IPLGGYV F  D     S
Sbjct: 33  HEMGHYLVGRWCGIGVRAFSIGFGPELFGFNDSHGTRWKLCAIPLGGYVKFVGDMNATSS 92

Query: 81  ------------------FFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKP 120
                             F     WK+  TV+AGPL N ++ I+ F+  F  Y   V +P
Sbjct: 93  QPTSEEIERLTEEERKVAFHTQPIWKRAATVVAGPLFNFLLTIVVFSVLFTAYGRYVAEP 152

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           +V+ V+  SPAA AG+  GD  +S+DG  V  F +V   V       I+ V+ R+   V 
Sbjct: 153 MVAEVTADSPAAKAGILPGDRFVSVDGNKVETFGDVQRLVSGRADDAITFVMLRDGREVT 212

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEISSITRGF 238
            +   PRL +  D  G K +V  +G+  + +  + +L + T + + +  ++E   + +  
Sbjct: 213 -VTAAPRLMEQEDALGNKVKVAVIGVVNNKELGQPRLITYTPVGAVAAAVEETGHVIQRT 271

Query: 239 LGVLSS-AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
              L     G++ +  Q+ GPV IA +A      GF   +  +A+ S  IG +NLLPIP 
Sbjct: 272 GQFLQRFVVGREDKC-QLGGPVKIADMAGRAAKLGFEWLVQLVALLSVGIGILNLLPIPP 330

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYG 346
           LDGGHL+ + +E +  + +   +  +  R GL ++L        ND++G
Sbjct: 331 LDGGHLLFYGVEAVIRRPVSERMMEMAYRAGLLLVLCFMGFVFWNDLFG 379


>gi|15604036|ref|NP_220551.1| hypothetical protein RP161 [Rickettsia prowazekii str. Madrid E]
 gi|20978861|sp|Q9ZE02|Y161_RICPR RecName: Full=Putative zinc metalloprotease RP161
 gi|3860727|emb|CAA14628.1| unknown [Rickettsia prowazekii]
 gi|292571755|gb|ADE29670.1| Putative membrane-associated zinc metalloprotease [Rickettsia
           prowazekii Rp22]
          Length = 359

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 121/358 (33%), Positives = 192/358 (53%), Gaps = 27/358 (7%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + +++ I+V IHEFGHY +AR  +++V  FS+GFG ELIGIT R GVRWK+  IPLGGYV
Sbjct: 7   FIITISILVFIHEFGHYCIARYLDVKVEEFSIGFGKELIGITDRKGVRWKLCFIPLGGYV 66

Query: 70  SF------------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV 117
                         +++  +  +F+  +   +   V AGPL N ++A++ FT F+   G 
Sbjct: 67  KIYGYDSSTRIIDKTKEVNEEVTFYSRSCLARFSIVAAGPLINYLLAVIIFTSFYCYFGK 126

Query: 118 MK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
           ++  P++ +V  ASPA  AG+K+GD I+ ++   V  F +V   +  N     +L + R+
Sbjct: 127 VEIPPIIGDVVAASPAERAGLKEGDKIVKVNNKYVKDFVDVQKEILINGFSSSTLTIARK 186

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQV-PSVGISFSYDETKLHSRT-----VLQSFSRGLD 229
                  KV  R Q+ +     K+++  +  I        +H++      VL++ +  +D
Sbjct: 187 SE---EFKVNIRPQEIIISHPEKKKIGKTFRIGIIAKNEPIHTKIGIFGGVLEAINTTID 243

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
            IS++T   L  +S        L++I GP+ IA+ +      G   Y+ F+AM S  +G 
Sbjct: 244 -ISTLT---LKAISQMILGTRPLDEIGGPISIAQESGKSMASGAQMYLLFIAMLSINLGL 299

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +NLLPIP+LDGGHLI  L E I G+        ++ ++G  IIL L  + I NDI  L
Sbjct: 300 LNLLPIPVLDGGHLIFILYEAITGRLPNPKTRNILLQLGAVIILLLIIISISNDIKNL 357


>gi|83311590|ref|YP_421854.1| membrane-associated Zn-dependent protease 1 [Magnetospirillum
           magneticum AMB-1]
 gi|82946431|dbj|BAE51295.1| Predicted membrane-associated Zn-dependent protease 1
           [Magnetospirillum magneticum AMB-1]
          Length = 385

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 114/359 (31%), Positives = 181/359 (50%), Gaps = 22/359 (6%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           +++ V L ++V +HE GH+++AR   ++V  FS+GFGPE+ G  +  G RW++ L+PLGG
Sbjct: 19  VIFLVILTVVVFVHELGHFLIARWNGVKVEVFSIGFGPEVWGRVAADGTRWRIGLLPLGG 78

Query: 68  YVSF---------------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
           YV                    E+  ++F      ++   V+AGP AN + AIL     F
Sbjct: 79  YVKMFGDADAASATASDQPMTAEERAQAFCHKRVGQRAAIVVAGPAANFLFAILGLAGMF 138

Query: 113 YNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
              G  V +PV+  V P + A  AG+K GD I +++G  V  F+++   VR    +E+SL
Sbjct: 139 MVLGQPVTQPVIGMVHPGTAAEAAGLKAGDRITAINGRAVERFQDIQRMVRLEIENELSL 198

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
            + R       +   PR+      FG   +VP +GIS     T +     + +    L E
Sbjct: 199 SVARGD-KAFDVSARPRIIQRKGVFGDMEKVPVLGISADPASTVIVRHGPISALGEALAE 257

Query: 231 ISSITRG-FLGVLSSAFG-KDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
             ++ R  F+G+     G +DT  +++ GP+ IA+ A      G  + + +  + S  +G
Sbjct: 258 TENMVRSTFIGIGQMVNGTRDT--DELGGPIRIAKGAGEAAQLGLASVVFYTILLSLNLG 315

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            +NL PIPILDGGHL+ +  E I G+ LG        R+GL ++L L     RND+  L
Sbjct: 316 LINLFPIPILDGGHLMFYAFEAILGRPLGEKAQEYGFRIGLFLVLALMVFATRNDLVSL 374


>gi|94263222|ref|ZP_01287039.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [delta proteobacterium MLMS-1]
 gi|93456440|gb|EAT06560.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [delta proteobacterium MLMS-1]
          Length = 357

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 192/356 (53%), Gaps = 20/356 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG--VRWKVS 61
           ++  + + + L +++ +HE GH++ A+L  ++VL+FS+GFGP+L    SR      +++ 
Sbjct: 1   MNTIISFIIVLGLLIFVHELGHFLFAKLFKVKVLTFSLGFGPKL---ASRQAGETEYRIG 57

Query: 62  LIPLGGYVSF-------SEDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFY 113
             PLGGYV+          D  D    F + P W++ + V AGP  N   A+L F   F 
Sbjct: 58  AFPLGGYVNMLGENPAEEVDPADQGRTFSSKPLWQRFIIVAAGPFFNLAFAVLLFFMIFA 117

Query: 114 NTGVMKPV----VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
             G+ +P     +  ++P SPAA AG++KGD I+S+DG+  + +E+VA  +R++    I 
Sbjct: 118 AVGIPQPAPGTNLGEIAPDSPAAEAGLQKGDTILSIDGVATAEWEDVARLIRDSGGQPIE 177

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFG-IKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
           L + R       + V P  Q+  + FG +  Q   +GI+ S D T   S +V  +   G 
Sbjct: 178 LEIGRNGETFSTVGV-PDKQEVKNIFGEVVGQRFMLGITRSSD-TVYQSVSVFSALGSGF 235

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           ++  S+    L  +     +    +++ GP+ IA++A    + G+  +I F+A+ S  +G
Sbjct: 236 EQTLSLIWLTLVAIGKMLQQIIPASELGGPILIAQLAGQQMEAGWINFIYFMALISINLG 295

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +NLLPIPILDGGHL  F +E I  + + + V  + +++G+ +I+ L F    NDI
Sbjct: 296 ILNLLPIPILDGGHLTFFTIEAIIRRPVSMKVREIASQVGILLIIGLMFFVFYNDI 351


>gi|296284733|ref|ZP_06862731.1| hypothetical protein CbatJ_13983 [Citromicrobium bathyomarinum
           JL354]
          Length = 372

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 182/364 (50%), Gaps = 22/364 (6%)

Query: 3   WLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           W+  FLL    L  +V +HE GH ++ R   ++  +FSVGFG EL G   + G RW++S 
Sbjct: 10  WIVGFLLV---LGPLVTLHELGHLLIGRWLGVKAEAFSVGFGKELAGFNDKHGTRWRISA 66

Query: 63  IPLGGYVSFSED-------EKDMR----SFFCAAPWKKILTVLAGPLANCVMAILFFTFF 111
           +PLGGYV F  D       ++D      +F  A+ W++ L V AGP  N ++A+  F  F
Sbjct: 67  LPLGGYVQFKGDMNPASMPDRDAPVEDGAFQHASLWRRALIVFAGPATNILIAVGIFAAF 126

Query: 112 FYNTGVMKPVVSNV-------SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
           F   G   PV  N        +  S A  AG++ GD ++S++G  + +F E+   +   P
Sbjct: 127 FMFIGRPVPVDPNAQLTIASFTEDSAAREAGLQVGDRLVSVNGAKLESFSELQNTIMLRP 186

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSF 224
              ++  + R+   V  + V  R  +  DRFG + ++  +G++    +    +   +++ 
Sbjct: 187 EETMTFEIERDGA-VSTVDVTTRSTEVEDRFGNEMRIGMIGVAPQEVQYDYRALGPIEAI 245

Query: 225 SRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFS 284
             G+D+        +  +   F     + ++ GP+ IA+ +      G  A+I+F+A+ S
Sbjct: 246 GAGIDQSVKTVDMMITGIGQIFTGKRSVQELGGPISIAKFSGEHLSLGPLAFISFVALIS 305

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             + F+NLLPIP LDGGHL  +  E IR K +G   T +  R G+ ++L L      ND+
Sbjct: 306 LNLAFINLLPIPALDGGHLAFYAAEAIRRKPVGPRTTEMAYRTGVALVLALMLFVTVNDL 365

Query: 345 YGLM 348
             L+
Sbjct: 366 VKLL 369


>gi|157825344|ref|YP_001493064.1| membrane-associated zinc metalloprotease [Rickettsia akari str.
           Hartford]
 gi|157799302|gb|ABV74556.1| Membrane-associated zinc metalloprotease [Rickettsia akari str.
           Hartford]
          Length = 357

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 115/345 (33%), Positives = 185/345 (53%), Gaps = 15/345 (4%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV------- 69
           +V IHEFGHY +AR  N++V  FS+GFG ELIGIT   GVRWK+ LIPLGGYV       
Sbjct: 14  LVFIHEFGHYCIARYFNVKVEDFSIGFGKELIGITDTKGVRWKICLIPLGGYVKIYGYDR 73

Query: 70  SFSEDEKDMR---SFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGVMKPVVSN 124
           S  E  K++    +F+  +  ++ L V AGPL N ++AI+ F  F  ++    + P++S+
Sbjct: 74  SLVEQTKEVNEKVAFYAKSCLERFLIVAAGPLINYLLAIIIFAGFYCYFGKTEIPPIISD 133

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V   SPA  A +++GD I+ ++  +V  F +V   +  N     +L + R+      + +
Sbjct: 134 VVALSPAERADLREGDKIVKVNNKSVKDFVDVQKEILINGFSSSTLTIERKS-EEFTVNI 192

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITRGFLGVLS 243
           MP+ +  +     K+   ++ I        +H++  +L+ F   ++    ++   L  +S
Sbjct: 193 MPQ-EIIISPHEEKKVKKTLHIGIIAKNEPIHTKIGILRGFWEAINTTIDMSALTLKAIS 251

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
                   L++I GPV IA+ +      G   Y+ F+AM S  +G +NLLPIP+LDGGHL
Sbjct: 252 QMIVGKRSLDEIGGPVAIAKESGKSIAGGTQMYLLFIAMLSVNLGLLNLLPIPVLDGGHL 311

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           I  + E I  +        ++ ++G  II+FL  L + NDI  L+
Sbjct: 312 IFIIYEAITDRLPNPQTKNILLQLGAAIIIFLIILSVFNDIQNLL 356


>gi|144898239|emb|CAM75103.1| Peptidase M50 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 375

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 181/364 (49%), Gaps = 21/364 (5%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           FW +  +++ + L ++V +HE GHY++AR   ++V  FS+GFGPE+ G   R G RW+ S
Sbjct: 4   FW-NYIVVFLLILTVVVFVHELGHYLIARWNGVKVEVFSIGFGPEIWGFNDRHGTRWRFS 62

Query: 62  LIPLGGYV---------SFSEDEKDMR------SFFCAAPWKKILTVLAGPLANCVMAIL 106
            +PLGGYV         S + D + M       SF      ++   V AGP AN + AIL
Sbjct: 63  ALPLGGYVKMFGDADAASATGDPRPMTDDEMAVSFRHKRVGQRAAIVFAGPAANFIFAIL 122

Query: 107 FFTFFFYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
                F   G  V +PV+  V P S A  AG+K GD I+  +   V  F+++   VR + 
Sbjct: 123 GLAVMFMILGQPVTEPVIGQVMPGSAAEQAGLKAGDRIVIANDSEVERFQDIQRIVRLDI 182

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSF 224
              +SL + R   G L     PR+ +    FG   +VP +GI+     T++ +     + 
Sbjct: 183 DKPLSLTVERAG-GRLDFVAHPRIVERKGIFGDMEKVPVLGIAADSGSTRVVTHGPGTAL 241

Query: 225 SRGLDEISS-ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMF 283
              + E  + I+  F+G+     G     +++ GP+ IA+ A      G  +   ++ M 
Sbjct: 242 VLAVRETGTMISATFVGI-GQMIGGSRDSDELGGPIRIAKGAGEAAQLGVASVAFYVIML 300

Query: 284 SWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
           S  +G +NL PIPILDGGHL+ +  E I G+ LG        R+GL ++L L     RND
Sbjct: 301 SLNLGLINLFPIPILDGGHLVFYAFEAILGRPLGEKAQEYGFRIGLFLVLALMVFATRND 360

Query: 344 IYGL 347
           I  L
Sbjct: 361 IVSL 364


>gi|90423943|ref|YP_532313.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Rhodopseudomonas palustris BisB18]
 gi|90105957|gb|ABD87994.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Rhodopseudomonas palustris BisB18]
          Length = 383

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 114/355 (32%), Positives = 174/355 (49%), Gaps = 22/355 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH++VAR   ++VL+FS+GFGPEL+G   + G RWK+S +PLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVARWAGVKVLTFSLGFGPELVGFNDKHGTRWKISAVPLGGYVKFFG 86

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           DE +                   SF       +   V AGP+AN +++I  F   F  +G
Sbjct: 87  DESEASTPSSAALSAMSAAEREGSFHHKKVGPRAAIVAAGPIANFLLSIAIFAALFTISG 146

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             +    V  V   S AA AG K GD ++ + G  + +F E+   V      E+S  + R
Sbjct: 147 RPITSARVDTVQADSAAAAAGFKPGDVVLQIGGKKIDSFTEMQRTVGSEAGQELSFTIKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEIS 232
                L L+  P L++  D FG   +V  +GIS + +   + +  V    +   G+ E  
Sbjct: 207 GDA-TLELRATPVLKEIKDSFGNAHRVGILGISRATNPGDVVTERVDPATALLLGVKETW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +    L  +   F      +Q+ GP+ IA+I+      G +  +   A+ S +IG +NL
Sbjct: 266 FVVDRTLAYIGGIFTGREAADQLGGPLRIAQISGQVATFGISPLLHLAAVLSVSIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            P+P+LDGGHL+ + +E  RG+ L      +  R+GL ++L L      NDI  L
Sbjct: 326 FPVPLLDGGHLLFYAVEAARGRPLSERAQEMGFRIGLGLVLMLMVFATYNDILHL 380


>gi|297568952|ref|YP_003690296.1| membrane-associated zinc metalloprotease [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924867|gb|ADH85677.1| membrane-associated zinc metalloprotease [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 357

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 193/355 (54%), Gaps = 18/355 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSL 62
           +   + + + L +++ +HEFGH++VA+L N++VL FS+GFGP L G   R G   ++VS 
Sbjct: 1   MSTIISFIIVLGVLIFVHEFGHFIVAKLFNVKVLKFSLGFGPRLFG--RRIGETDYQVSA 58

Query: 63  IPLGGYVSF--------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN 114
           +PLGGYV+         +E  +  RSF     W++ L V AGP  N   A+L F   +  
Sbjct: 59  LPLGGYVNMLGENPGETAEAAETERSFAGKPLWQRFLIVAAGPFFNLGFAVLLFFLVYAF 118

Query: 115 TGVMKPV----VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
            G+  PV    +  V+P SPAA AG+  GD I++++G     +E+V+  +R+     + L
Sbjct: 119 IGLPHPVPGTKIGEVAPDSPAAEAGLLAGDHILAVNGTATEDWEDVSRLIRDGEGRPVML 178

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFG-IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            + R +  VL +   P+ Q+  + FG +  Q   +G++ S  E +  S ++ ++   G  
Sbjct: 179 DI-RRNGEVLQVTSTPKKQEVTNIFGEVVGQRYMLGVTRS-SEVEYQSISLFEALGAGFA 236

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
           +  S+    L  +     +     ++ GP+ IA++A    + G+  ++ F+A+ S  +G 
Sbjct: 237 QTWSLIWLTLVAIVKMIQQIIPATELGGPILIAQLAGQQMEVGWINFVYFMALISINLGI 296

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +NLLPIP+LDGGHL+ F +E I  + + + V  V  ++G+ ++L L F    NDI
Sbjct: 297 LNLLPIPVLDGGHLVFFTVEAITRRPVSMRVREVAQQVGILLLLALMFFVFYNDI 351


>gi|242278725|ref|YP_002990854.1| membrane-associated zinc metalloprotease [Desulfovibrio salexigens
           DSM 2638]
 gi|242121619|gb|ACS79315.1| membrane-associated zinc metalloprotease [Desulfovibrio salexigens
           DSM 2638]
          Length = 355

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 183/355 (51%), Gaps = 17/355 (4%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           M W+  F+L    LI     HE GH++ AR+  I V +FS+GFGP L G T      +++
Sbjct: 1   MSWIVDFILVLGGLIFF---HELGHFLAARMLGIGVKTFSLGFGPRLAGFT-WGATNYRL 56

Query: 61  SLIPLGGYVSFSEDEKDMRS---------FFCAAPWKKILTVLAGPLANCVMAILFFTFF 111
           SLIPLGGYVS + +E+DM           F    PW +++ V AGPL N V+A + F   
Sbjct: 57  SLIPLGGYVSLAGEERDMTEDNGFNDKELFMNRPPWHRMIVVAAGPLFNFVLAWVIFWGI 116

Query: 112 FYNTGVM--KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
             + G M   P V  + P SPA  AG++ GD ++S+ G  +  + ++A  ++ +    ++
Sbjct: 117 IISNGQMGLAPTVGKLQPDSPALHAGIEVGDNVLSIQGHNIIFWSDLAETIQSSQSDTLN 176

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            V+ R+      + + P++Q+  + FG   + P VGI  S D   +    +  + +   +
Sbjct: 177 FVIERDG-STKEIAIKPQVQELKNIFGETIRRPVVGIVASGDSKTIEMNGIDGAVAAA-E 234

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
           +  ++T+     +     +   ++ I GP+ IA+  K   + G    + F A  S  +G 
Sbjct: 235 QTWNVTKLICTSIVKMVERVVPMDSIGGPIMIAQAIKQQSERGLLELLQFTAFISINLGL 294

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +NLLPIP+LDGGHL+ F LE +  + L   +  V T++GL  +L L    I ND+
Sbjct: 295 LNLLPIPVLDGGHLLFFSLETVMRRPLNEKLQAVATKIGLIFLLCLMAFAIINDL 349


>gi|319408400|emb|CBI82055.1| zinc metalloprotease [Bartonella schoenbuchensis R1]
          Length = 383

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 113/358 (31%), Positives = 183/358 (51%), Gaps = 29/358 (8%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           +++I+ +HE GHY++ R C IRV  FS+GFGP++   T + G +W+++LI LGGYV F  
Sbjct: 24  IMVIIFVHEMGHYLIGRWCGIRVSVFSLGFGPQIFSYTDKHGTQWRLALILLGGYVKFVG 83

Query: 74  DEKDMR------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMK 119
           D+                SF  A  WK+  TV AGPL N + +I+  TFFF++ G   ++
Sbjct: 84  DKDGTSMLSSQSFPQVCGSFASAHAWKRAATVFAGPLFNILFSIVVLTFFFFSYGRVTIE 143

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG- 178
           PVV ++   +PA  AG+  GD  + +DG  V +FE++  YV  +    I   L  E +G 
Sbjct: 144 PVVGSLVENAPAIQAGLVLGDRFVEMDGQRVESFEDLITYVTFHSEDPIEFKL--ERMGQ 201

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET------KLHSRTVLQSFSRGLDEIS 232
           V    + P + +  D FG + +V  +G+    D        + + + +  +    + E S
Sbjct: 202 VFKTVITPTITERDDGFGNRIRVGMIGVGAPVDPVNPMRLDQAYKKHIHYNLLEAVREAS 261

Query: 233 S-----ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
                 IT+    V     G+  R  Q+SGP    +IA    + GF + + F A  S  I
Sbjct: 262 KRTAFIITQTVFFVNRLMEGQGDRC-QLSGPSKTVKIAWQISESGFISLLNFTAFLSIGI 320

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           G +NL PIP LDGGHL+ +++E I G+ + + +  +I  +G  ++       + ND +
Sbjct: 321 GLINLFPIPPLDGGHLLFYVIEAIAGRRVPIKIQEIIFYIGFFVVFMFMIFALFNDYF 378


>gi|17987112|ref|NP_539746.1| membrane metalloprotease [Brucella melitensis bv. 1 str. 16M]
 gi|225852653|ref|YP_002732886.1| membrane-associated zinc metalloprotease [Brucella melitensis ATCC
           23457]
 gi|256044811|ref|ZP_05447715.1| membrane-associated zinc metalloprotease [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256263853|ref|ZP_05466385.1| membrane metalloproteinase [Brucella melitensis bv. 2 str. 63/9]
 gi|260565589|ref|ZP_05836073.1| membrane metalloproteinase [Brucella melitensis bv. 1 str. 16M]
 gi|265991235|ref|ZP_06103792.1| membrane metalloproteinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|20978815|sp|Q8YHH1|Y829_BRUME RecName: Full=Putative zinc metalloprotease BMEI0829
 gi|17982774|gb|AAL52010.1| membrane metalloprotease [Brucella melitensis bv. 1 str. 16M]
 gi|225641018|gb|ACO00932.1| membrane-associated zinc metalloprotease [Brucella melitensis ATCC
           23457]
 gi|260151657|gb|EEW86751.1| membrane metalloproteinase [Brucella melitensis bv. 1 str. 16M]
 gi|263002019|gb|EEZ14594.1| membrane metalloproteinase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093984|gb|EEZ17918.1| membrane metalloproteinase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409174|gb|ADZ66239.1| membrane-associated zinc metalloprotease [Brucella melitensis M28]
 gi|326538884|gb|ADZ87099.1| membrane-associated zinc metalloprotease [Brucella melitensis
           M5-90]
          Length = 379

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 115/350 (32%), Positives = 183/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPL GYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLVGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|222475497|ref|YP_002563914.1| hypothetical protein AMF_827 [Anaplasma marginale str. Florida]
 gi|222419635|gb|ACM49658.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 367

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 189/347 (54%), Gaps = 34/347 (9%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKD--- 77
           HE+GHY VA+LC +RV +FS+GFGPEL GIT  SG RWK SL+P+GGYV    D ++   
Sbjct: 37  HEYGHYAVAKLCGVRVKTFSLGFGPELFGITDGSGTRWKFSLVPVGGYVKMLGDTQEDNL 96

Query: 78  ---MRSF-FCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNVSPASP 130
               +SF F   P W++     AGPLAN + ++L F   F   G+M   P+V ++ P S 
Sbjct: 97  SEGEKSFAFNEKPLWQRFAVAGAGPLANLLFSVLVFFVLFSTRGIMSPMPIVGSILPGST 156

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH-LKVMPRL- 188
           A   G+  GD I+ +DG  +S FEE+  Y+  +P  E ++V  R+  GV H +K+ P + 
Sbjct: 157 AEKVGLMAGDRIVEVDGHEISWFEEIRHYIAGSPNQEFTMVFLRD--GVQHSIKLSPDVW 214

Query: 189 QDTVDRFGIKRQVPSVGISFSYDETKLHS----RTVLQSFSRGLDEISSITRGFLGVLSS 244
            D   R GI   +       S + T+       R  ++SF R +  I  IT   L V+  
Sbjct: 215 SDDAHRLGIAANI-------SPETTRARRLPVLRAAVESF-RCIFRIVKIT--LLAVVQL 264

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAY-IAFLAMFSWAIGFMNLLPIPILDGGHL 303
             G    ++++ GPV   RIAK+  +   N   + F+ + S  +G +NLLPIP+LDGG++
Sbjct: 265 VTGARG-MDELGGPV---RIAKHSGESIRNKEGLWFVGLISANLGVVNLLPIPMLDGGYM 320

Query: 304 ITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           + + L+ I R K++      V+  +G  +++ +      ND+  +++
Sbjct: 321 LQYALQGIFRRKTINPKYQNVMMAIGFVLLVSMMVFVTFNDVKSILK 367


>gi|255004607|ref|ZP_05279408.1| hypothetical protein AmarV_04900 [Anaplasma marginale str.
           Virginia]
          Length = 362

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 189/347 (54%), Gaps = 34/347 (9%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKD--- 77
           HE+GHY VA+LC +RV +FS+GFGPEL GIT  SG RWK SL+P+GGYV    D ++   
Sbjct: 32  HEYGHYAVAKLCGVRVKTFSLGFGPELFGITDGSGTRWKFSLVPVGGYVKMLGDTQEDNL 91

Query: 78  ---MRSF-FCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNVSPASP 130
               +SF F   P W++     AGPLAN + ++L F   F   G+M   P+V ++ P S 
Sbjct: 92  SEGEKSFAFNEKPLWQRFAVAGAGPLANLLFSVLVFFVLFSTRGIMSPMPIVGSILPGST 151

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH-LKVMPRL- 188
           A   G+  GD I+ +DG  +S FEE+  Y+  +P  E ++V  R+  GV H +K+ P + 
Sbjct: 152 AEKVGLMAGDRIVEVDGHEISWFEEIRHYIAGSPNQEFTMVFLRD--GVQHSIKLSPDVW 209

Query: 189 QDTVDRFGIKRQVPSVGISFSYDETKLHS----RTVLQSFSRGLDEISSITRGFLGVLSS 244
            D   R GI   +       S + T+       R  ++SF R +  I  IT   L V+  
Sbjct: 210 SDDAHRLGIAANI-------SPETTRARRLPVLRAAVESF-RCIFRIVKIT--LLAVVQL 259

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAY-IAFLAMFSWAIGFMNLLPIPILDGGHL 303
             G    ++++ GPV   RIAK+  +   N   + F+ + S  +G +NLLPIP+LDGG++
Sbjct: 260 VTGARG-MDELGGPV---RIAKHSGESIRNKEGLWFVGLISANLGVVNLLPIPMLDGGYM 315

Query: 304 ITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           + + L+ I R K++      V+  +G  +++ +      ND+  +++
Sbjct: 316 LQYALQGIFRRKTINPKYQNVMMAIGFVLLVSMMVFVTFNDVKSILK 362


>gi|157964228|ref|YP_001499052.1| putative membrane-associated zinc metalloprotease [Rickettsia
           massiliae MTU5]
 gi|157844004|gb|ABV84505.1| Putative membrane-associated zinc metalloprotease [Rickettsia
           massiliae MTU5]
          Length = 359

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 184/344 (53%), Gaps = 15/344 (4%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF----- 71
           +V IHEFGHY +AR  N++V  FS+GFG  LIGIT + GVRWK+ LIPLGGYV       
Sbjct: 16  LVFIHEFGHYCIARYFNVKVEEFSIGFGKALIGITDKKGVRWKICLIPLGGYVKIYGYDR 75

Query: 72  -----SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGVMKPVVSN 124
                ++D  +  +F+  +  ++ L V AGPL N ++A++ F  F  ++    + P++ +
Sbjct: 76  SLMDKTKDVNEKVAFYAKSCLERFLIVAAGPLINYLLAVIIFAGFYCYFGKTAIPPIIGD 135

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V  +SPA  A ++ GD I+ ++  +V  F +V   +  N  +  +L + R+    + + +
Sbjct: 136 VVASSPAERADLRAGDKIVKVNDRSVKDFGDVQREILINGFNSSTLTIERKSEEFI-VNI 194

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITRGFLGVLS 243
           MP+ +  +     K+   ++ I        +H++  +L  F   ++    ++   L  +S
Sbjct: 195 MPQ-EIIISPPEEKQFKKTLRIGIIAKNEPIHTKIGILGGFWEAINTTIDMSALTLNAIS 253

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
                    ++I GPV IA+ +      G   Y+ F+AM S  +G +NLLPIP+LDGGHL
Sbjct: 254 QMIVGKRSFDEIGGPVAIAKESGKSIAGGTQMYLLFIAMLSVNLGLLNLLPIPVLDGGHL 313

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +  L E I GK     +  ++ ++G  II+FL  + + NDI  L
Sbjct: 314 VFILYEAITGKLPNPKIKNILLQLGAIIIIFLIIISVSNDIQNL 357


>gi|299134994|ref|ZP_07028185.1| membrane-associated zinc metalloprotease [Afipia sp. 1NLS2]
 gi|298589971|gb|EFI50175.1| membrane-associated zinc metalloprotease [Afipia sp. 1NLS2]
          Length = 382

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 119/355 (33%), Positives = 176/355 (49%), Gaps = 22/355 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L ++V  HE GH++VAR   +RVL+FS+GFGPEL G   R+G RWK+S IPLGGYV F  
Sbjct: 26  LTVVVFFHELGHFLVARWAGVRVLTFSLGFGPELFGFNDRTGTRWKLSAIPLGGYVKFFG 85

Query: 74  D----------------EKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYN 114
           D                EK+ + SF   +  ++   V AGP+AN ++AI+ F   F FY 
Sbjct: 86  DASEASTPAPQMLAAMSEKERQDSFHHKSVARRAAIVAAGPIANFILAIVIFGALFTFYG 145

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
                  V  V   S AA AG K GD + S+DG T+  F ++   V      ++   + R
Sbjct: 146 KPNTSARVDTVQANSAAAAAGFKPGDVVTSIDGQTIETFVDMQRIVSTRAGEQLHFTVKR 205

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEIS 232
               V +L   P L++  D F    ++  +GIS S    E  +           G+ E  
Sbjct: 206 GDR-VENLTATPELREVKDSFNNVHKIGILGISRSATPGEHAVERVDPATGLWLGVKEAW 264

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            + +  +  +   F +    +Q+ GP+ IA+I+      G  A +   A+ S +IG +NL
Sbjct: 265 FVAKSTILYIGDIFTRRASADQLGGPIRIAQISGQVATIGLAALVHLTAVLSVSIGLLNL 324

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            P+P+LDGGHL+ + +E IRG+ L      +  R GL ++L L      NDI  L
Sbjct: 325 FPVPMLDGGHLLFYAVEAIRGRPLSERSQEMGFRFGLALVLMLMVFATYNDILHL 379


>gi|94986831|ref|YP_594764.1| membrane-associated Zn-dependent proteases 1 [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731080|emb|CAJ54443.1| predicted membrane-associated Zn-dependent proteases 1 [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 374

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 117/356 (32%), Positives = 188/356 (52%), Gaps = 30/356 (8%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--ED 74
           ++  HE GH+M+AR+  I V +FS+GFGP++  I  R   ++ +SLIPLGGYVS +  ED
Sbjct: 24  LIFFHELGHFMMARILGIGVKTFSLGFGPKIFTIGKRK-TKYSLSLIPLGGYVSLAGEED 82

Query: 75  EKDMRS-----------------FFCAAPWKKILTVLAGPLANCVMAILFFTFF----FY 113
           E + +                  F    PW ++L VLAGP+AN ++A  FF ++      
Sbjct: 83  EDENKKIEQSSQITDELFLPTEKFSNRPPWHRLLVVLAGPVANILLA--FFIYWGVSWVQ 140

Query: 114 NTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
            +  + P++  ++  SPA  AG+  GD I  +DG+ VS +++VA Y+ E+  +E+++ L 
Sbjct: 141 GSTFLLPIIGTITENSPAEHAGLLPGDIITRVDGMPVSQWDQVAEYIAESQGNEVTITLS 200

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD-ETKLHSRTVLQSFSRGLDEIS 232
           R+   +L  ++ P  +   + FG K+    +GIS   D ET+    + L +   GL +  
Sbjct: 201 RDD-KLLEFRLTPEEKSRTNLFGEKKPAWLIGISAQGDIETR--PLSFLAASVTGLKKTW 257

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
                    L   F K   L+ I GP+ IA++     + G    +   A+ S  +G +NL
Sbjct: 258 FSISFTCESLLKLFQKVVPLDSIGGPILIAQLVGQQANAGIIPLLLLTALISINLGVLNL 317

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIPILDGGH++  LLEMI  + +   +  V  R+G+ ++L L      NDI  L+
Sbjct: 318 LPIPILDGGHVVFLLLEMIFQRPISPFIKTVSMRIGIVLLLSLMVFATWNDIMRLV 373


>gi|256113716|ref|ZP_05454520.1| membrane-associated zinc metalloprotease [Brucella melitensis bv. 3
           str. Ether]
 gi|265995071|ref|ZP_06107628.1| membrane metalloproteinase [Brucella melitensis bv. 3 str. Ether]
 gi|262766184|gb|EEZ11973.1| membrane metalloproteinase [Brucella melitensis bv. 3 str. Ether]
          Length = 379

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 184/350 (52%), Gaps = 30/350 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED------ 74
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPL GYV F  D      
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLVGYVKFIGDESKTSS 92

Query: 75  ----------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                     E+D +  F   P WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV----LQSFSRGLDEISSITRG 237
           L+ +P++ +  D  G K ++ ++G+  +  E   + R +    L+S  + + E   I  G
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVETT--EAVGNFRRIEYGPLESVGQAVIETGHII-G 268

Query: 238 FLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             G     F  G++ +  Q+ GPV IA +A      GF+  I  +AM S  IG +NL P+
Sbjct: 269 RTGEFFKRFAVGREDKC-QLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPL 327

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           P LDGGHL+ + +E I+G  +  +   +  R+G  +++      + ND++
Sbjct: 328 PPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLF 377


>gi|163795635|ref|ZP_02189601.1| UDP-N-acetylglucosamine acyltransferase [alpha proteobacterium
           BAL199]
 gi|159179234|gb|EDP63767.1| UDP-N-acetylglucosamine acyltransferase [alpha proteobacterium
           BAL199]
          Length = 375

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 174/362 (48%), Gaps = 21/362 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +D  + + + L I+V +HE GHY+VAR   +RV  FSVGFG EL G T+ SG RW++S I
Sbjct: 6   VDYVIPFLIILTILVFVHEMGHYLVARRAGVRVEVFSVGFGRELFGWTASSGTRWRISAI 65

Query: 64  PLGGYVSFSED----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILF 107
           PLGGYV    D                E+   SF   +   +   V AGP+AN + AIL 
Sbjct: 66  PLGGYVKMLGDADPASAGATGLDAMTSEQRAVSFHHKSLKARAAIVAAGPIANFLFAILL 125

Query: 108 FTFFFYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPL 165
               +   G     PVV  V   S A  AG++ GD  +S DG++V  F ++   V   P 
Sbjct: 126 LAGLYAIVGRPYAPPVVDEVVAGSAAEQAGIRIGDTFVSADGVSVKQFSDLRRVVFGKPG 185

Query: 166 HEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFS 225
             + +V+ R+     ++ ++P      DRFG +     +G+    ++  +       +  
Sbjct: 186 EPLPMVIERDGQ-RQNVTIIPEAVTETDRFGTQHIFGRLGV--RSNQVSIERLNPFSAVG 242

Query: 226 RGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSW 285
               E  SI    L V+           ++ GP+ IA+++ N    G+   + F+AM S 
Sbjct: 243 VATTETWSIVGQTLDVVGQIIAGTRGTEELGGPLRIAQMSGNVAQSGWITTVWFVAMLSI 302

Query: 286 AIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
            +G +NL PIP+LDGGHL+ + +E +RG+ LG       +  GL  ++ L      ND+ 
Sbjct: 303 NLGLINLFPIPVLDGGHLLFYGVEALRGRPLGERAQEWASMAGLTFVIALMLFVTWNDLV 362

Query: 346 GL 347
            L
Sbjct: 363 QL 364


>gi|288958460|ref|YP_003448801.1| zinc metalloprotease Atu1380 [Azospirillum sp. B510]
 gi|288910768|dbj|BAI72257.1| zinc metalloprotease Atu1380 [Azospirillum sp. B510]
          Length = 379

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 110/346 (31%), Positives = 163/346 (47%), Gaps = 23/346 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED------ 74
           HE GHY++AR   +R+ +FS+GFGPE+ G T RSG RWK S +PLGGYV    D      
Sbjct: 27  HELGHYLIARRNGVRIETFSIGFGPEIFGFTDRSGTRWKFSALPLGGYVKMFGDADPAST 86

Query: 75  ----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVV 122
                     E+   SF      ++   V AGP+AN V +I+     F   G     P V
Sbjct: 87  PGAHLDAMTAEERAVSFHHKRVGQRAAIVAAGPIANFVFSIVVLALLFMTAGQSFTPPDV 146

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
             V P S A  AG++ GD I+S+ G  V  FEE+   V   P   +++ L R+   ++ +
Sbjct: 147 GGVQPGSAAERAGIQPGDLILSVGGTGVQRFEEIRQIVSIRPGEPLTVELKRDGR-MMTV 205

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSR-TVLQSFSRGLDEISSITRGFLGV 241
              P  Q   DR G   Q+  +GIS        H   T +    R   E++ +  G    
Sbjct: 206 TATPDSQSVTDRLGNSHQIGLLGISRGSVGMMRHDPVTAVWQAGR---EVAGMITGTFTA 262

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           L           ++ GP+ IA+++      G+   + F+   S  +G +NL P+P+LDGG
Sbjct: 263 LGQMVQGSRGTEELGGPLRIAQMSGEVAQSGWYPLVWFMTFLSVNLGMINLFPVPMLDGG 322

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           HL+ +  E + G+ LG        R+GL ++L L      ND+  L
Sbjct: 323 HLLFYGFEKLLGRPLGARAQEYGFRIGLALVLTLMVFATWNDLVQL 368


>gi|67459512|ref|YP_247136.1| membrane-associated zinc metalloprotease [Rickettsia felis
           URRWXCal2]
 gi|67005045|gb|AAY61971.1| Membrane-associated zinc metalloprotease [Rickettsia felis
           URRWXCal2]
          Length = 357

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 111/344 (32%), Positives = 183/344 (53%), Gaps = 15/344 (4%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF----- 71
           +V IHEFGHY +AR  N++V  FS+GFG ELIGIT   GVRWK+ LIPLGGYV       
Sbjct: 14  LVFIHEFGHYCIARYFNVKVEEFSIGFGKELIGITDTRGVRWKICLIPLGGYVKIYGYDR 73

Query: 72  -----SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGVMKPVVSN 124
                +++  +  +F+  +  ++ L V AGPL N ++A++ F  F  ++    + P++ +
Sbjct: 74  SLMDKTKEVNEKVAFYAKSCLERFLIVAAGPLINYLLAVIIFAGFYCYFGKTEIPPIIGD 133

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V  +SPAA A +++GD I+ ++  +V  F +V   +  N     +L + R+      + +
Sbjct: 134 VVASSPAARADLREGDKIVKVNDKSVKDFGDVQREILINGFSSSTLTIERKS-EEFTVNI 192

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITRGFLGVLS 243
           MP+ +  +     K+   ++ I        +H++  +L  F   ++    ++   L  +S
Sbjct: 193 MPQ-EIIISPPEEKKVKKTLRIGIIAKNEPIHTKIGILGGFWEAINTTIDMSALTLKAIS 251

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
                    ++I GPV IA+ +      G   Y+ F+AM S  +G +NLLPIP+LDGGHL
Sbjct: 252 QMIVGKRSFDEIGGPVAIAKESGKSIAGGTQMYLLFIAMLSVNLGLLNLLPIPVLDGGHL 311

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           I  L E I G+        ++ ++G  II+FL  + + NDI  L
Sbjct: 312 IFILYEAITGRLPNPKTKNILLQLGAAIIIFLIIISVSNDIQNL 355


>gi|56417132|ref|YP_154206.1| hypothetical protein AM1094 [Anaplasma marginale str. St. Maries]
 gi|56388364|gb|AAV86951.1| hypothetical protein AM1094 [Anaplasma marginale str. St. Maries]
          Length = 367

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 189/347 (54%), Gaps = 34/347 (9%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKD--- 77
           HE+GHY VA+LC +RV +FS+GFGPEL GIT  SG RWK SL+P+GGYV    D ++   
Sbjct: 37  HEYGHYAVAKLCGVRVKTFSLGFGPELFGITDGSGTRWKFSLVPVGGYVKMLGDTQEDNL 96

Query: 78  ---MRSF-FCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNVSPASP 130
               +SF F   P W++     AGPLAN + ++L F   F   G+M   P+V ++ P S 
Sbjct: 97  SEGEKSFAFNEKPLWQRFAVAGAGPLANLLFSVLVFFVLFSTRGIMSPMPIVGSILPGST 156

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH-LKVMPRL- 188
           A   G+  GD I+ +DG  +S FEE+  Y+  +P  E ++V  R+  GV H +K+ P + 
Sbjct: 157 AEKVGLMVGDRIVEVDGHEISWFEEIRHYIAGSPNQEFTMVFLRD--GVQHSIKLSPDVW 214

Query: 189 QDTVDRFGIKRQVPSVGISFSYDETKLHS----RTVLQSFSRGLDEISSITRGFLGVLSS 244
            D   R GI   +       S + T+       R  ++SF R +  I  IT   L V+  
Sbjct: 215 SDDAHRLGIAANI-------SPETTRARRLPVLRAAVESF-RCIFRIVKIT--LLAVVQL 264

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAY-IAFLAMFSWAIGFMNLLPIPILDGGHL 303
             G    ++++ GPV   RIAK+  +   N   + F+ + S  +G +NLLPIP+LDGG++
Sbjct: 265 VTGARG-MDELGGPV---RIAKHSGESIRNKEGLWFVGLISANLGVVNLLPIPMLDGGYM 320

Query: 304 ITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           + + L+ I R K++      V+  +G  +++ +      ND+  +++
Sbjct: 321 LQYALQGIFRRKTINPKYQNVMMAIGFVLLVSMMVFVTFNDVKSILK 367


>gi|319405838|emb|CBI79470.1| putative enzyme [Bartonella sp. AR 15-3]
          Length = 398

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 113/356 (31%), Positives = 175/356 (49%), Gaps = 24/356 (6%)

Query: 13  SLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS 72
           +++IIV +HE GHY++ R C I+   FS+GFGPEL+  T + G RW++ L  LGGYV F 
Sbjct: 31  TILIIVFVHEMGHYLMGRWCGIQASVFSIGFGPELLNYTDKRGTRWRLGLFFLGGYVKFI 90

Query: 73  EDEKDMR-----------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMK 119
           ED K++            SF  A  WK+ +TV AG L N +  I+  TFFF+  G  V++
Sbjct: 91  EDSKEIISSSKSSSFTPGSFMAAHAWKRAMTVFAGSLFNVLFTIVVLTFFFFFYGRVVVE 150

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
           PVV  +   SPA  AG+  GD  + +DG  + +F ++  YV       +   + R    +
Sbjct: 151 PVVGYLEKDSPAIQAGLMPGDRFVKMDGKKIESFGDLVAYVALRGRDPVEFKIDRMG-QI 209

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFS-YDETKLHSRTV---------LQSFSRGLD 229
           L + + P++    D FG + +V  +GI      +   H   V         ++S    L 
Sbjct: 210 LTVIITPKVIKRDDGFGNQVRVGMIGIRAPVVGDNPEHLDPVYKKHIHYNWIESIKESLR 269

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
               I    +   S   G      Q+SGP    +IA    + GF++ + F A FS  IG 
Sbjct: 270 RTILIIIQTISFFSRLIGGQEDHCQLSGPSKTVQIAWKINETGFSSMLYFTAFFSICIGL 329

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           +N  PIP LDGGHL+ +++E I GK +   +  +   +G   ++      + ND +
Sbjct: 330 INFFPIPPLDGGHLLFYIIEAIVGKPVPAKIQEIAFHIGFFTVIVFTVFALFNDYF 385


>gi|51473360|ref|YP_067117.1| membrane associated zinc metalloprotease [Rickettsia typhi str.
           Wilmington]
 gi|51459672|gb|AAU03635.1| probable membrane associated zinc metalloprotease [Rickettsia typhi
           str. Wilmington]
          Length = 357

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 117/357 (32%), Positives = 190/357 (53%), Gaps = 27/357 (7%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + +++ I+V IHEFGHY +AR  +++V  F++GFG ELIGIT + GVRWK+  IPLGGYV
Sbjct: 7   FIITISILVFIHEFGHYCIARYLDVKVEEFAIGFGKELIGITDKKGVRWKLCFIPLGGYV 66

Query: 70  SF-----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTG 116
                        +E  K + +F+  +  ++   V AGPL N ++A++ FT F  ++   
Sbjct: 67  KIYGYDHRMIDQTTEVNKKV-TFYARSCLERFAIVAAGPLINYLLAVIIFTSFYCYFGKT 125

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
            + P++ +V  +SPA  AG+K+GD I+ ++   V  F +V   +  N     +L + R+ 
Sbjct: 126 EIPPIIGDVVASSPAERAGLKEGDKIVKVNDKYVKDFVDVQKEILINGFSSSTLTIARKS 185

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSV-GISFSYDETKLHSRTVL-----QSFSRGLDE 230
           V      V  R Q+ +     K++V     I        +H++  L     ++ +  +D 
Sbjct: 186 V---KFTVNIRPQEIIISHPAKKKVEKTFRIGIIAKNEPIHTKIGLFGGIWEAINTTID- 241

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
           IS++T   L  +S        L++I GP+ IA+ +      G   Y+ F+AM S  +G +
Sbjct: 242 ISTLT---LKAISQIILGTRPLDEIGGPISIAQESSKSIASGAQMYLLFIAMLSINLGLL 298

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           NLLPIP+LDGGHLI  L E + G+        ++ ++G  II+ L  + I NDI  L
Sbjct: 299 NLLPIPVLDGGHLIFILYEAVTGRLPNPKTRNILLQLGAAIIMLLIIISISNDIKNL 355


>gi|158520498|ref|YP_001528368.1| putative membrane-associated zinc metalloprotease [Desulfococcus
           oleovorans Hxd3]
 gi|158509324|gb|ABW66291.1| putative membrane-associated zinc metalloprotease [Desulfococcus
           oleovorans Hxd3]
          Length = 355

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 115/347 (33%), Positives = 185/347 (53%), Gaps = 19/347 (5%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVR-WKVSLIPLGGYVS 70
           + L +++  HE GH++VARL  + V  FS+GFGP L G   +SG+  ++VS IPLGGYV 
Sbjct: 9   IVLGVLIFFHELGHFLVARLFGVGVEKFSLGFGPRLFGF--KSGITDYQVSAIPLGGYVK 66

Query: 71  F----SEDEKDMR------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVM 118
                 +DE D+       SF      K+ L V AGP+ N ++A+L F   F  Y    +
Sbjct: 67  MVGEDPDDEADLSEAEQAISFTHKPVGKRFLIVAAGPVFNMLLAVLIFYGLFQVYGKAYL 126

Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178
            PV+  V P SPAA AG+  GD ++++D   V+ ++E+A  ++ +    + L + RE  G
Sbjct: 127 LPVIGEVMPESPAAAAGMLAGDRVVAVDDTGVTTWDEMALMIQNSGGRALRLTVQREG-G 185

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR-G 237
           +L + V P   D    FG  R    +G++ + +  +     V ++  R +D+   + R  
Sbjct: 186 LLRVDVQPDPTDGETIFGEPRTDYKIGVAAAGEVVRERLNPV-EAMGRSVDQTWEVIRLT 244

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
            +GV     G  +  N + GP+ IA++A      G  + +AF+A  S  +  +N+LPIP+
Sbjct: 245 AIGVGKMVSGTVSAKN-LGGPILIAQMAGEQARQGSASLLAFIAFISINLAILNILPIPV 303

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LDGGHL+ F +E +RG+ +         + G+ +IL L  L + NDI
Sbjct: 304 LDGGHLLFFAIEAVRGRPVSARTRETAQQFGMFLILMLMVLVMYNDI 350


>gi|158320552|ref|YP_001513059.1| putative membrane-associated zinc metalloprotease [Alkaliphilus
           oremlandii OhILAs]
 gi|158140751|gb|ABW19063.1| putative membrane-associated zinc metalloprotease [Alkaliphilus
           oremlandii OhILAs]
          Length = 334

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 173/333 (51%), Gaps = 23/333 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
           I+V IHE GH+ VA+L  I+V  F++G GP+LI  T++    + + L+PLGGYV    ED
Sbjct: 13  ILVFIHELGHFTVAKLVGIKVHEFALGMGPKLI-YTTKGDTLYSIRLLPLGGYVKMEGED 71

Query: 75  EK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           EK  D RSF       +I  + AGP  N ++AI+ F  FFY  G    ++S V   SPA 
Sbjct: 72  EKSEDERSFNKKPVLARIAVIFAGPFMNFILAIVLFLTFFYFVGSPTTIISKVQDQSPAQ 131

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVR--ENPLHEISLVLYREHVGVLHLKVMPRLQD 190
           +AG++ GD I +++G  +  +EEV   +   E    EI+++   EH   L   V+P   +
Sbjct: 132 VAGIEAGDSIYAINGQKIHTWEEVTERISKSEGSPMEITIIRDGEH---LEKTVIPMQDE 188

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDT 250
           T +R         +GI      T    +++  +    L  I SI RG L  L +  G+  
Sbjct: 189 TSNRI-------LIGI------TTTMKKSLSSAGENALFAIKSIVRGILEFLRNLVGRKV 235

Query: 251 RLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEM 310
              ++ GPVGI  +       G    ++  A+ S  +G MNLLPIP LDG  ++  ++EM
Sbjct: 236 NTGEVMGPVGIINLVGEVSRTGLLDIVSLTAVLSVNLGLMNLLPIPALDGSRILFLIIEM 295

Query: 311 IRGKSLGVSVTRVITRMGLCIIL-FLFFLGIRN 342
           +RGK +      +I  +G  I++ F+ F+  ++
Sbjct: 296 LRGKPVDQDKEGMIHLIGFGILMTFMVFITFQD 328


>gi|167042007|gb|ABZ06743.1| putative peptidase family M50 [uncultured marine microorganism
           HF4000_141F21]
          Length = 368

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 110/347 (31%), Positives = 176/347 (50%), Gaps = 23/347 (6%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           ++  + + V ++I+V IHE+GHY  A+   + V  FS+GFG E+ G   +SG RWKV  I
Sbjct: 1   MNYLIPFLVLIMIVVFIHEYGHYYFAKRYGVGVTDFSIGFGREIFGWNDKSGTRWKVCWI 60

Query: 64  PLGGYVSFSED-----------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAI 105
           PLGGYV F  D                 EKD    F   P +++ L V AGPLAN V+AI
Sbjct: 61  PLGGYVKFFGDRNVFSQSEQQEVINKYGEKDRNKLFILKPLYQRSLIVAAGPLANFVLAI 120

Query: 106 LFFTF--FFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN 163
           + F+    F    +   VV  V+  SPA  AG+KK D +IS+D   V +  EV+ ++  +
Sbjct: 121 IIFSMINMFVGKDLTPAVVVEVANNSPAYEAGIKKNDMVISIDNNKVQSILEVSTFITTS 180

Query: 164 PLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG--IKRQVPSVGISFSYDETKLHSRTVL 221
               I   + R +  V  L V P L  + D  G  +K+++  + +S   +E K       
Sbjct: 181 TAEIIEFTVLRNNQEV-TLYVKPNLVQSKDSLGNSVKKRMIGIKLSPLNNEFKKQRLGPS 239

Query: 222 QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLA 281
           ++    + E+  ++   L  L +        +Q+ GP+ IA+I     ++G   +++ +A
Sbjct: 240 KAIYYSIKEVWFVSVTSLKYLGNMLIGSADSSQLGGPIRIAKITGQVAEYGVVPFLSIMA 299

Query: 282 MFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMG 328
             S ++G +NL PIP+LDGGHL+ +  E + G+ L       + R+G
Sbjct: 300 YISISLGLINLFPIPMLDGGHLMFYFFEKVLGRPLSQKTQEGLFRIG 346


>gi|103487437|ref|YP_616998.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Sphingopyxis alaskensis RB2256]
 gi|98977514|gb|ABF53665.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Sphingopyxis
           alaskensis RB2256]
          Length = 361

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 108/349 (30%), Positives = 174/349 (49%), Gaps = 21/349 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED-- 74
           +V +HE+GHY+V R C ++  +FS+GFG +L+G T + G  WK+  +PLGGYV F+ D  
Sbjct: 5   LVFVHEYGHYIVGRWCGVKAETFSIGFGRKLVGWTDKRGTEWKIGWLPLGGYVQFAGDRD 64

Query: 75  --------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VM 118
                         E+   +F     WK+   V AGP+ N + AIL    F +  G  V 
Sbjct: 65  AVSQPDAEWQSLPAEERSHTFPAQPVWKRAAIVAAGPVTNFLFAILILAGFAWVGGKVVT 124

Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178
            PV   +   S A  AG++ GD I+++DG  ++ F ++   V   P   + L + RE   
Sbjct: 125 PPVAGAIEIGSAADEAGLRAGDRIVAIDGRAIATFGDIPMAVAHRPGEVMQLRVLREG-S 183

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
              + + PRL    D FG + +   +G+  +    +L   +++++ + GL +   I R  
Sbjct: 184 ERTVALAPRLITEKDPFGKEYERAIIGL--APPPPQLEPVSLIEAPAIGLHQTWQIVRQT 241

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
             VL         +  ++GPV IA I+      G  + I F+A+ S  +GF+NLLP+P+L
Sbjct: 242 GEVLGQFLTGRRSIKDMNGPVKIAEISGQAATLGVASLIFFIALISINLGFINLLPLPML 301

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           DGGHL+ +  E IR +   + V     R G   ++ L  +   ND+  L
Sbjct: 302 DGGHLLFYAYEAIRRRPAPLRVQEWAFRFGFAAVVTLMLVVTFNDLGSL 350


>gi|217979933|ref|YP_002364080.1| membrane-associated zinc metalloprotease [Methylocella silvestris
           BL2]
 gi|217505309|gb|ACK52718.1| membrane-associated zinc metalloprotease [Methylocella silvestris
           BL2]
          Length = 381

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 184/359 (51%), Gaps = 27/359 (7%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L  +V  HE GH++V R C ++V +FS+GFGPEL     R G RW+++ +PLGGYV F  
Sbjct: 21  LSTVVFFHELGHFLVGRWCGVKVDAFSLGFGPELFAFVDRHGTRWRLAALPLGGYVKFHG 80

Query: 74  D-----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D                 E    SFF     K+   V AGP+AN ++AI+ FT  FY  G
Sbjct: 81  DANGASMTDSAAAASMAPEDRAVSFFAQPVAKRAAIVAAGPIANFILAIVIFTGVFYVNG 140

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+ P+V  VS  S A  AG + GD I+S+DG  + +FE++   V+ +    ++  + R
Sbjct: 141 RAVLSPLVDAVSAGSAAEAAGFQPGDLIVSIDGRKIDSFEDMQRIVQVSSDAMLTFGVDR 200

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKR-QVPSVGISFSYDETKLHSRTVLQSFSRGLDE--- 230
                + L   PR +D    FG  R  V  V      D  ++    +++SF R   E   
Sbjct: 201 AG-KTIELVATPRRRDVSTPFGTTRVGVLGVETRGKPDSWRVERYGLIESFGRATSETWY 259

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
           + + T  +LG L    G+++  +Q+SGP+ IA ++      G  A +   A+ S ++G +
Sbjct: 260 VVARTGSYLGGL--VMGRES-ADQLSGPIRIAEVSGEMAKIGIAALLNLAAVLSISVGLL 316

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           NL+PIP+LDGGHL  + +E IRG++L         ++GL ++  L      NDI  L +
Sbjct: 317 NLMPIPLLDGGHLFYYAVEAIRGRALNEKAQEFGFKIGLTLVAGLMIFATFNDILRLTR 375


>gi|298529654|ref|ZP_07017057.1| membrane-associated zinc metalloprotease [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511090|gb|EFI34993.1| membrane-associated zinc metalloprotease [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 355

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 189/357 (52%), Gaps = 20/357 (5%)

Query: 9   LYTVSLIIIVVI------HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           ++T ++ II+V+      HE GH++VARL  + V +FS+GFGP+L G        +++S 
Sbjct: 1   MFTSAIAIILVLGLLIFFHELGHFLVARLLGVGVSTFSLGFGPKLFGFV-MGKTEYRLSA 59

Query: 63  IPLGGYVSF---SEDEK------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY 113
           +PLGGYV     SED +         SF    PW++IL V AGP+ N V+A   +   F+
Sbjct: 60  VPLGGYVHLVGESEDSELPGGFTSQESFAKRPPWQRILVVAAGPVFNFVLAWFIYWGLFF 119

Query: 114 NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV 171
             G M+  P + +++   PA  AG++ GD ++S++   V  +E++  +++ N    + L 
Sbjct: 120 AHGQMQMLPQIGDLADDGPAMEAGLQSGDLVLSINSHEVQYWEDLVQHIQRNEGEPLDLE 179

Query: 172 LYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
           + R +  +    ++PR+    + FG + + P +GI  S  ET+  S   + +   GL + 
Sbjct: 180 VQR-NSSIKEFTLVPRMAVQENIFGEEIKTPQIGIVAS-GETETISLGFISAGKEGLSQT 237

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
             + +  +  +     +   L+ I GP+ I ++       G    +A  A+ S  +G +N
Sbjct: 238 WMLIKLTVEGIKKLIERIIPLDTIGGPILIGQLVSEQKQEGMVNLLALTALISINLGLIN 297

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLP+P+LDGGH++ + +EMI  + L   + +V TR+G+  IL L    I NDI  L+
Sbjct: 298 LLPVPVLDGGHILFYTIEMITRRPLNERMRQVATRIGILFILSLMAFAIINDILRLV 354


>gi|254561269|ref|YP_003068364.1| membrane-associated zinc metalloprotease [Methylobacterium
           extorquens DM4]
 gi|254268547|emb|CAX24504.1| membrane-associated zinc metalloprotease [Methylobacterium
           extorquens DM4]
          Length = 386

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/360 (33%), Positives = 182/360 (50%), Gaps = 25/360 (6%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + + L I+V +HE GH++V R C + V +FS+GFGPE+IG   R G RWK+S IPLGGYV
Sbjct: 21  FLIVLTIVVFVHEMGHFLVGRWCGVGVTAFSIGFGPEIIGFNDRRGTRWKLSAIPLGGYV 80

Query: 70  SFSED-----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            F  D                  +   SF      K+   V AGP+AN ++AI  F    
Sbjct: 81  KFVGDANGASVPDPEAVARMSPHEQAVSFPTQPVAKRAAIVAAGPIANFILAIAVFAGAI 140

Query: 113 YNTGVMK-PV-VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
           Y +G  + P  V  V P S AA AG + GD I ++DG TV+ F ++   V       +++
Sbjct: 141 YVSGRYETPARVEAVQPNSAAARAGFQPGDVIRTIDGQTVNTFNDMQRVVSAAAGSSLAV 200

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF-SYDETKLHSRTVLQSFSRGLD 229
            + R    V  L  +P + +    FG + +   +GI+  +    KL      +S   G+ 
Sbjct: 201 TVDRGGQ-VQTLTAVPDMIEERTPFG-RHRFGRLGINGPNAGAAKLVHYGPFESLKLGVH 258

Query: 230 EIS-SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFD-HGFNAYIAFLAMFSWAI 287
           E +  + R F  +     G+++  +Q+SGP+GIAR++       G    I  +A+ S +I
Sbjct: 259 ETAFVVERTFDYIGKLVTGRES-ADQLSGPIGIARVSGEVARVGGVGGLIGLVALLSVSI 317

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           G +NL PIP+LDGGHL+ +  E +RG+ L      +  R+GL  +L L      NDI  L
Sbjct: 318 GLLNLFPIPLLDGGHLMFYAFEAVRGRPLSERAQEIGFRIGLAFVLMLMLFAAWNDILNL 377


>gi|116749220|ref|YP_845907.1| putative membrane-associated zinc metalloprotease [Syntrophobacter
           fumaroxidans MPOB]
 gi|116698284|gb|ABK17472.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Syntrophobacter fumaroxidans MPOB]
          Length = 367

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 113/351 (32%), Positives = 194/351 (55%), Gaps = 17/351 (4%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + V L +++ +HE GH++VA+  ++ VL FS+GFGP+L G T R    +++S IPLGGYV
Sbjct: 13  FIVVLGVLIFVHELGHFLVAKWMHVTVLRFSLGFGPKLWGFT-RGDTEYRISWIPLGGYV 71

Query: 70  SF--SEDEKDM------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV 121
                + E+D+      RSF      K++  V+AGPL+N V+AI+ FT  F  +G+ +  
Sbjct: 72  KMLGEDSEEDVTPEQMERSFSSQRVGKRMAIVMAGPLSNFVLAIVIFTLLFAFSGIREIT 131

Query: 122 --VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
             +++V+  SPA  AG+K GD +I++DG  +S + E++  V     H + L+  +     
Sbjct: 132 TDIASVTQGSPAEKAGLKAGDKVIAIDGKPISTWYELSETVEARGEHPL-LIRIQRGTET 190

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGI--SFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
           L + + P + +       K + P +G+  S +Y   K++    L++    L +   +T+ 
Sbjct: 191 LDVAITPYMGEKESELKEKIKTPLIGVVASSNYFIKKINP---LEAGYYSLLQTWHLTKF 247

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
            + V+     +    N + GP+ IA++A    + G    I F+A+ S  +  +NLLPIPI
Sbjct: 248 SITVVIKLIQRALPFNVLGGPILIAQMAGQQAEKGLLELINFIALISVNLAVLNLLPIPI 307

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LDGGH++ FL+E + G+ LGV    +  ++G+ ++L L      NDI  L+
Sbjct: 308 LDGGHIMFFLVEAVLGRPLGVKKIEMAQKVGMLLLLVLMAFVFYNDIMRLL 358


>gi|218530313|ref|YP_002421129.1| membrane-associated zinc metalloprotease [Methylobacterium
           chloromethanicum CM4]
 gi|240138673|ref|YP_002963145.1| membrane-associated zinc metalloprotease [Methylobacterium
           extorquens AM1]
 gi|218522616|gb|ACK83201.1| membrane-associated zinc metalloprotease [Methylobacterium
           chloromethanicum CM4]
 gi|240008642|gb|ACS39868.1| membrane-associated zinc metalloprotease [Methylobacterium
           extorquens AM1]
          Length = 386

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/360 (33%), Positives = 181/360 (50%), Gaps = 25/360 (6%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + + L I+V +HE GH++V R C + V +FS+GFGPE+IG   R G RWK+S IPLGGYV
Sbjct: 21  FLIVLTIVVFVHEMGHFLVGRWCGVGVTAFSIGFGPEIIGFNDRRGTRWKLSAIPLGGYV 80

Query: 70  SFSEDEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            F  D                      SF      K+   V AGP+AN ++AI  F    
Sbjct: 81  KFVGDANGASVPDPEAVARMSPHERAVSFPTQPVAKRAAIVAAGPIANFILAIAVFAGAI 140

Query: 113 YNTGVMK-PV-VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
           Y +G  + P  V  V P S AA AG + GD I ++DG TV+ F ++   V       +++
Sbjct: 141 YVSGRYETPARVEAVQPNSAAARAGFQPGDVIRTIDGQTVNTFNDMQRVVSAAAGSSLAV 200

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF-SYDETKLHSRTVLQSFSRGLD 229
            + R    V  L  +P + +    FG + +   +GI+  +    KL      +S   G+ 
Sbjct: 201 TVDRGGQ-VQTLTAVPDMIEERTPFG-RHRFGRLGINGPNAGAAKLVHYGPFESLKLGVH 258

Query: 230 EIS-SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFD-HGFNAYIAFLAMFSWAI 287
           E +  + R F  +     G+++  +Q+SGP+GIAR++       G    I  +A+ S +I
Sbjct: 259 ETAFVVERTFDYIGKLVTGRES-ADQLSGPIGIARVSGEVARVGGVGGLIGLVALLSVSI 317

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           G +NL PIP+LDGGHL+ +  E +RG+ L      +  R+GL  +L L      NDI  L
Sbjct: 318 GLLNLFPIPLLDGGHLMFYAFEAVRGRPLSERAQEIGFRIGLAFVLMLMLFAAWNDILNL 377


>gi|188581295|ref|YP_001924740.1| membrane-associated zinc metalloprotease [Methylobacterium populi
           BJ001]
 gi|179344793|gb|ACB80205.1| membrane-associated zinc metalloprotease [Methylobacterium populi
           BJ001]
          Length = 386

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 180/356 (50%), Gaps = 25/356 (7%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V +HE GH++V R C + V +FS+GFGPE++G   R G RWK+S IPLGGYV F  
Sbjct: 25  LTIVVFVHEMGHFLVGRWCGVGVTAFSIGFGPEIVGFNDRRGTRWKLSAIPLGGYVKFVG 84

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D                      SF      K+   V AGP+AN ++AI  F    Y +G
Sbjct: 85  DANGASVPDPEAVARMSPHERAVSFPTQPVAKRAAIVAAGPIANFLLAIAVFAGAIYFSG 144

Query: 117 VMK-PV-VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             + P  V  V P S AA AG + GD I ++DG TV+ F ++   V       +++ + R
Sbjct: 145 RYETPARVEAVQPNSAAARAGFQPGDVIRTIDGQTVNTFNDMQRVVSAAAGASLAVTVDR 204

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF-SYDETKLHSRTVLQSFSRGLDEIS- 232
               V  L  +P + +    FG + +   +GI+  +    KL     L+S   G+ E + 
Sbjct: 205 GGQ-VQTLTAVPDMIEERTPFG-RHRFGRLGINGPNASAAKLVHYGPLESLKLGVHETAF 262

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFD-HGFNAYIAFLAMFSWAIGFMN 291
            + R F  +     G+++  +Q+SGP+GIAR++       G    I  +A+ S +IG +N
Sbjct: 263 VVERTFDYIGKLVTGRES-ADQLSGPIGIARVSGEVARVGGVGGLIGLIALLSVSIGLLN 321

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           L PIP+LDGGHL+ +  E +RG+ L      +  R+GL  +L L      NDI  L
Sbjct: 322 LFPIPLLDGGHLLFYAFEAVRGRPLSERAQEIGFRIGLAFVLMLMLFAAWNDILNL 377


>gi|258593201|emb|CBE69540.1| putative Zinc metalloprotease [NC10 bacterium 'Dutch sediment']
          Length = 376

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 118/354 (33%), Positives = 183/354 (51%), Gaps = 14/354 (3%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           LD  L   + L  ++ +HE GH++VA+   +RVL FS+GFGP++IG T R G  + +S I
Sbjct: 25  LDYLLWAILVLGGLIFVHELGHFLVAKRAGVRVLKFSLGFGPKIIGFT-RGGTEYLLSAI 83

Query: 64  PLGGYVSF-----SEDEKDMRSFFCAAP--WKKILTVLAGPLANCVMAI-LFFTFFFYNT 115
           PLGGYV        E+  D    F A P  W+  L +LAGP +N ++AI +F+  F    
Sbjct: 84  PLGGYVKMLGEDPQEEVADPEGSFSAKPVGWRS-LIILAGPGSNFLLAITIFWIVFTLGV 142

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
             +   V  V    PA  AGVK GD I ++DG  +  +EE+A  + ++P   I L + R 
Sbjct: 143 PTLATKVGEVMQDFPAHDAGVKTGDRITAIDGYAIEKWEELASQIHKSPGRPIRLTVERA 202

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSI 234
                 L V P+     + FG +++V  +GI+ +  E  L  RT  + +  + L +   +
Sbjct: 203 G-SRFDLVVAPKATRQKNLFGEEQEVGLLGIAPA--EEFLTERTNPVTALGKALYKTYDL 259

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
           +R  L               I GP+ +A++A      G    + F A+ S  +G +NLLP
Sbjct: 260 SRLILLTFVKLIQGVVPAKTIGGPLLVAQMAGQQARQGVLNLMFFTALLSINLGILNLLP 319

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           IPILDGGHL   L+E +RGK + +    +  ++GL +++ L      NDI+ L+
Sbjct: 320 IPILDGGHLFFALIEAVRGKPVSLQKREMAQQVGLALLVALMIFAFYNDIFRLL 373


>gi|163851506|ref|YP_001639549.1| membrane-associated zinc metalloprotease [Methylobacterium
           extorquens PA1]
 gi|163663111|gb|ABY30478.1| membrane-associated zinc metalloprotease [Methylobacterium
           extorquens PA1]
          Length = 386

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/360 (33%), Positives = 181/360 (50%), Gaps = 25/360 (6%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + + L I+V +HE GH++V R C + V +FS+GFGPE+IG   R G RWK+S IPLGGYV
Sbjct: 21  FLIVLTIVVFVHEMGHFLVGRWCGVGVTAFSIGFGPEIIGFNDRRGTRWKLSAIPLGGYV 80

Query: 70  SFSEDEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            F  D                      SF      K+   V AGP+AN ++AI  F    
Sbjct: 81  KFVGDANGASVPDPEAVARMSPHERAVSFPTQPVAKRAAIVAAGPIANFILAIAVFAGAI 140

Query: 113 YNTGVMK-PV-VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
           Y +G  + P  V  V P S AA AG + GD I ++DG TV+ F ++   V       +++
Sbjct: 141 YVSGRYETPARVEAVQPNSAAARAGFQPGDVIRTIDGQTVNTFNDMQRVVSAAAGSSLAV 200

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF-SYDETKLHSRTVLQSFSRGLD 229
            + R    V  L  +P + +    FG + +   +GI+  +    KL      +S   G+ 
Sbjct: 201 TVDRGGQ-VQTLTAVPDMIEERTPFG-RHRFGRLGINGPNAGAAKLVHYGPFESLKLGVR 258

Query: 230 EIS-SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFD-HGFNAYIAFLAMFSWAI 287
           E +  + R F  +     G+++  +Q+SGP+GIAR++       G    I  +A+ S +I
Sbjct: 259 ETAFVVERTFDYIGKLVTGRES-ADQLSGPIGIARVSGEVARVGGVGGLIGLVALLSVSI 317

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           G +NL PIP+LDGGHL+ +  E +RG+ L      +  R+GL  +L L      NDI  L
Sbjct: 318 GLLNLFPIPLLDGGHLMFYAFEAVRGRPLSERAQEIGFRIGLAFVLMLMLFAAWNDILNL 377


>gi|15892126|ref|NP_359840.1| hypothetical protein RC0203 [Rickettsia conorii str. Malish 7]
 gi|20978825|sp|Q92J66|Y203_RICCN RecName: Full=Putative zinc metalloprotease RC0203
 gi|15619254|gb|AAL02741.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 358

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 112/346 (32%), Positives = 186/346 (53%), Gaps = 18/346 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV------- 69
           +V IHEFGHY +AR  N++V  FS+GFG  LIGIT + GVRWK+ LIPLGGYV       
Sbjct: 14  LVFIHEFGHYCIARYFNVKVEEFSIGFGKALIGITDKKGVRWKICLIPLGGYVKIYGYDR 73

Query: 70  SFSEDEKDMR---SFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGVMKPVVSN 124
           S  +  K++    +F   +  ++ L V AGPL N ++AI+ F  F  ++    + P++ N
Sbjct: 74  SLMDKTKEVNEKVAFDAKSCLERFLIVAAGPLINYLLAIIIFAGFYCYFGKTEIPPIIGN 133

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V  +SPA  A ++ GD I+ ++  +V  F +V   +  N     +L + R+    + + +
Sbjct: 134 VVASSPAERADLRAGDKIVKVNDKSVKDFGDVQREILINGFSSSTLTIERKSEEFI-VNI 192

Query: 185 MPR--LQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITRGFLGV 241
           MP+  +    +   + ++   +GI  + +E+ +H++  +L      ++    ++   L  
Sbjct: 193 MPQEIIISPPEEKQVNKKTLRIGI-IAKNES-IHTKIGILGGLWEAINTTIDMSALTLNA 250

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           +S         ++I GP+ IA+ +      G   Y+ F+AM S  +G +NLLPIP+LDGG
Sbjct: 251 ISQMIVGKRSFDEIGGPIAIAKESGKSIAGGTQMYLLFIAMLSVNLGLLNLLPIPVLDGG 310

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           HL+  L E I GK        ++ ++G  II+FL  + + NDI  L
Sbjct: 311 HLVFILYEAITGKLPHPKTKNILLQLGAIIIIFLIIIAVSNDIQNL 356


>gi|294084081|ref|YP_003550839.1| putative membrane-associated zinc metallopeptidase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663654|gb|ADE38755.1| putative membrane-associated zinc metallopeptidase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 360

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 174/345 (50%), Gaps = 20/345 (5%)

Query: 5   DCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIP 64
           D  + + + +  +V  HE GHY VAR   + V  FS+GFGPEL G T+++G RW+++ IP
Sbjct: 8   DLIIGFLLLITPVVFFHELGHYWVARKAGVIVEVFSIGFGPELYGRTAKNGTRWRIAAIP 67

Query: 65  LGGYVSFSEDEKDMR-----------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY 113
            GG+V    DE               SF  A  + ++  VLAGP+AN ++ IL F   + 
Sbjct: 68  FGGFVKMRGDEDAASTPGQDSAHVEGSFGGAGLYWRMAIVLAGPVANFILGILLFAMVYI 127

Query: 114 NTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV 171
             G  ++   +  V P  PAA AG++ GD I+ +DGI +  F ++   + E+P  ++   
Sbjct: 128 TVGKQILPAEIGEVIPNMPAAEAGLQSGDLILEIDGIKIREFNDMRGLIIESPGKQLDFR 187

Query: 172 LYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSV-GISFSYDETKLHSRTVLQSFSRGLDE 230
           L R+    L L V P+ Q + D+  I   V  V  +  +       S  V+ + S     
Sbjct: 188 LRRDGQ-ELTLPVTPKAQFS-DQLDITVGVLGVRSVPVNARVRMAPSTAVVTATSDAFHM 245

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
              I RG    L  A   + +  ++ GPV IA I+    + G   +I   A+ S  +G +
Sbjct: 246 SIMILRG----LGRAVTGNIQKGEVGGPVRIAEISGTVLNQGIVPFILLTAVISINLGLI 301

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335
           NLLPIP LDGGH+  FL+E + GK L +    ++ R G+ I++ L
Sbjct: 302 NLLPIPALDGGHMAFFLIEAVLGKPLPLHWQAILMRGGIAILMTL 346


>gi|300854495|ref|YP_003779479.1| putative membrane-associated metalloprotease [Clostridium
           ljungdahlii DSM 13528]
 gi|300434610|gb|ADK14377.1| predicted membrane-associated metalloprotease [Clostridium
           ljungdahlii DSM 13528]
          Length = 336

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/347 (30%), Positives = 175/347 (50%), Gaps = 26/347 (7%)

Query: 9   LYTVSLII----IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIP 64
           +Y ++ II    +++IHE GH+ +A+L  ++V  FS+G GP+L GI  +    + + L+P
Sbjct: 1   MYIIAAIIAFGVLIIIHELGHFTMAKLNGVKVEEFSIGMGPKLFGIKGKE-TEYHIRLLP 59

Query: 65  LGGYVSFSEDE---KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV 121
           +GGYV    DE    D R+F   +P +K+  V AGP+ N V+ ++ F       G + P+
Sbjct: 60  IGGYVKMLGDEGESDDPRAFNNKSPLRKLSVVTAGPIMNFVLGVILFAIIASARGYLSPI 119

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE---NPLHEISLVLYREHVG 178
           VS V P  PAA+AG+K GD I  ++   +S +E+    V     NP++    + Y  +  
Sbjct: 120 VSKVMPNQPAALAGIKLGDKITRVNNSKISTWEDFVTEVYTAGGNPIN----ITYERNGN 175

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
              ++V+P      +R+        VGI    + T++   T+ QS S G  E  S+ +  
Sbjct: 176 TNQVRVIPIKDKKENRY-------VVGI----ESTQVTKPTLGQSVSYGFIETKSLIKQT 224

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
                + F     +N + GPV I +I+      G  + +AF A  S  +   N++P P L
Sbjct: 225 FSFFKTLFRGKASMNDVGGPVTIIKISGAAAKAGILSLMAFSAYISIQLAIFNIIPFPAL 284

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           DGG++  FL E+I GK +  +    I  +G  I++ L  L    DI+
Sbjct: 285 DGGYIFLFLFEIITGKKVDENKVGTINYVGFAILMALMVLVTVKDIF 331


>gi|34580843|ref|ZP_00142323.1| hypothetical protein [Rickettsia sibirica 246]
 gi|238650353|ref|YP_002916205.1| M50 family membrane endopeptidase [Rickettsia peacockii str.
           Rustic]
 gi|28262228|gb|EAA25732.1| unknown [Rickettsia sibirica 246]
 gi|238624451|gb|ACR47157.1| M50 family membrane endopeptidase [Rickettsia peacockii str.
           Rustic]
          Length = 357

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 111/345 (32%), Positives = 182/345 (52%), Gaps = 17/345 (4%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF----- 71
           +V IHEFGHY +AR  N++V  FS+GFG  LIGIT + GVRWK+ LIPLGGYV       
Sbjct: 14  LVFIHEFGHYCIARYFNVKVEEFSIGFGKALIGITDKKGVRWKICLIPLGGYVKIYGYDR 73

Query: 72  -----SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGVMKPVVSN 124
                +++  +  +F   +  ++ L V AGPL N ++AI+ F  F  ++    + P++ N
Sbjct: 74  SLMDKTKEVNEKVAFDAKSCLERFLIVAAGPLINYLLAIIIFAGFYCYFGKTEIPPIIGN 133

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V  +SPA  A ++ GD I+ ++  +V  F +V   +  N     +L + R+    + + +
Sbjct: 134 VVASSPAERADLRAGDKIVKVNDKSVKDFGDVQREILINGFSSSTLTIERKSEEFI-VNI 192

Query: 185 MPRLQDTVDRFGIKRQV-PSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITRGFLGVL 242
           MP  Q+ +     ++QV  ++ I        +H++  +L      ++    ++   L  +
Sbjct: 193 MP--QEIIISPPEEKQVKKTLRIGIIAKNEPIHTKIGILGGLWEAINTTIDMSALTLNAI 250

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
           S         ++I GP+ IA+ +      G   Y+ F+AM S  +G +NLLPIP+LDGGH
Sbjct: 251 SQMIVGKRSFDEIGGPIAIAKESGKSIAGGTQMYLLFIAMLSVNLGLLNLLPIPVLDGGH 310

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           L+  L E I GK        ++ ++G  II+FL  + + NDI  L
Sbjct: 311 LVFILYEAITGKLPHPKTKNILLQLGAIIIIFLIIIAVSNDIQNL 355


>gi|254456663|ref|ZP_05070092.1| RIP metalloprotease RseP [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083665|gb|EDZ61091.1| RIP metalloprotease RseP [Candidatus Pelagibacter sp. HTCC7211]
          Length = 370

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 180/360 (50%), Gaps = 23/360 (6%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + + ++++V IHE+GHY  AR   + V  FS+GFG E+ G   +SG RWK+  IPLGGYV
Sbjct: 8   FIILILVVVFIHEYGHYYFARKYGVGVTDFSIGFGKEIFGWNDKSGTRWKICWIPLGGYV 67

Query: 70  SFSED-----------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAI-LFFTF 110
            F  D                 ++D    F   P +++ L V  GPLAN ++AI +FF+ 
Sbjct: 68  KFFGDRNVFSQADHEKILEQYSKEDQDKLFVIKPLYQRALIVFGGPLANFLLAIVIFFSI 127

Query: 111 F-FYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
           + F        V++ V   SPA I G+K+ D I+ +DG  V++  +V+ ++  +    I 
Sbjct: 128 YTFIGKDFTPAVINEVQKDSPAMIGGLKQNDIILEIDGNKVNSIMDVSKFITTSTGDVID 187

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF-SYDETKLHSRT-VLQSFSRG 227
             + R     L LK+ P +  + D  G K     VGI   +Y+    H +    Q+    
Sbjct: 188 FKVERLDQEYL-LKITPNIVLSDDNLGNKINKRMVGIKLGAYNNEINHVKLGPTQALIHS 246

Query: 228 LDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
           + E+  ++   L  + +        +Q+ GP+ IA+I     + G   +I+ +A  S ++
Sbjct: 247 IKEVYFVSAASLKYIGTMIKGTGDSSQLGGPIRIAKITGQVAEIGILPFISIMAYISISL 306

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           G +NL PIP+LDGGHL+ +  E + G+ L         R+G+ +++ L F    ND+  L
Sbjct: 307 GLINLFPIPMLDGGHLMFYAFEKVLGRPLSQKTQEGFFRIGMFLLISLMFFTTFNDLKDL 366


>gi|283856411|ref|YP_162884.2| membrane-associated zinc metalloprotease [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|283775411|gb|AAV89773.2| membrane-associated zinc metalloprotease [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 376

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 106/324 (32%), Positives = 165/324 (50%), Gaps = 41/324 (12%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED-- 74
           +V +HE GHY VAR   ++   FS+GFGPE+ G T R G RW+V+ +P GGYV F+ D  
Sbjct: 21  LVFVHELGHYAVARFFGVKADVFSIGFGPEIFGWTDRLGTRWRVACLPFGGYVRFAGDMD 80

Query: 75  ----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM 118
                           E   ++F     W + L VLAGPL N  +AIL F   F   GV 
Sbjct: 81  PASSGRPSSEWLALSPEDRAKTFQAKKAWHRFLIVLAGPLTNIFVAILLFAAVFSVHGVA 140

Query: 119 K--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           +   VVS + P S A  AG+K GD I +++   V+ F ++ P V+ +P  E+ + L R+ 
Sbjct: 141 RSPSVVSAIVPHSAADTAGLKVGDKITAVNSYKVNYFNDLQPVVQMHPDEEVLIKLVRDG 200

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGI--------SFSYDETKLHSRTVLQS-FSRG 227
              + +KV  + +   DRFG   ++  +GI             E    + + + +     
Sbjct: 201 RA-MDVKVHLKAEHFQDRFGNSSRIGLLGILGGAPVIVRLPLTEIPQAATSAVGTMLHEQ 259

Query: 228 LDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
           +D I  I  G              ++++ GP+ IAR++    + GF  ++ F+A  S  +
Sbjct: 260 IDGIGQIITG-----------RRSMDELGGPIRIARMSGQITELGFLPFVLFMAAISVNL 308

Query: 288 GFMNLLPIPILDGGHLITFLLEMI 311
           GF+NLLP+P+LDGGHL+ + +E+I
Sbjct: 309 GFINLLPVPMLDGGHLLFYAMEII 332


>gi|209885091|ref|YP_002288948.1| RIP metalloprotease RseP [Oligotropha carboxidovorans OM5]
 gi|209873287|gb|ACI93083.1| RIP metalloprotease RseP [Oligotropha carboxidovorans OM5]
          Length = 382

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 172/355 (48%), Gaps = 22/355 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH+MVAR   ++VL+FS+GFGPEL G   R G RWK+S IPLGGYV F  
Sbjct: 26  LTIVVFFHELGHFMVARWTGVKVLTFSLGFGPELFGFFDRHGTRWKLSAIPLGGYVKFYG 85

Query: 74  D----------------EKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYN 114
           D                EK+ R SF      ++   V AGP AN ++AI+ F   F FY 
Sbjct: 86  DASEASTPASEMLASMSEKERRGSFHHKNVARRAAIVAAGPFANFILAIVIFAGLFTFYG 145

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
                  V  V   S AA AG + GD + ++DG  ++ F E+   V       +   + R
Sbjct: 146 KPNTSARVDAVQADSAAAAAGFQAGDVVTAIDGEAIATFVEMQRIVSTRAGEALRFTVKR 205

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEIS 232
                  L   P L++  D F    ++  +GIS S    E  +           G+ E  
Sbjct: 206 GDR-TETLTATPELREVKDNFNNVHKIGVLGISRSAKPGEAAIERVDPATGLWLGVKETW 264

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +T+  +  +   F +    +Q+ GP+ IA+I+      G  A +   A+ S +IG +NL
Sbjct: 265 FVTKSTILYIGDVFTRRAGADQLGGPIRIAQISGQVATIGIAALVHLTAVLSVSIGLLNL 324

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            PIP+LDGGHL+ + +E IRG+ L      +  R+GL ++L L      NDI  L
Sbjct: 325 FPIPMLDGGHLLFYAVEAIRGRPLSERSQEMGYRVGLALVLMLMVFATYNDILHL 379


>gi|260752422|ref|YP_003225315.1| membrane-associated zinc metalloprotease [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258551785|gb|ACV74731.1| membrane-associated zinc metalloprotease [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 376

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 165/316 (52%), Gaps = 25/316 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED-- 74
           +V +HE GHY VAR   ++   FS+GFGPE+ G T R G RW+++ +P GGYV F+ D  
Sbjct: 21  LVFVHELGHYAVARFFGVKADVFSIGFGPEIFGWTDRLGTRWRIACLPFGGYVRFAGDMD 80

Query: 75  ----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM 118
                           E   ++F     W + L VLAGPL N  +AIL F   F   GV 
Sbjct: 81  PASSGRPSSEWLALSPEDRAKTFQAKKAWHRFLIVLAGPLTNIFVAILLFAAVFSVHGVA 140

Query: 119 K--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           +   VVS + P S A  AG+K GD I +++   V+ F ++ P V+ +P  E+ + L R+ 
Sbjct: 141 RSPSVVSAIVPHSAADTAGLKVGDKITAVNSYKVNYFNDLQPVVQMHPDEEVLIKLVRDG 200

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR-GLDEISSIT 235
              + +KV  + +   DRFG   ++  +GI      T +  R  L    +     + ++ 
Sbjct: 201 RA-MDVKVHLKAEHFQDRFGNSSRIGLLGI---LGGTPVIVRLPLTEIPQAATSAVGTML 256

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
              +  +         ++++ GP+ IAR++    + GF  ++ F+A  S  +GF+NLLP+
Sbjct: 257 HEQIDGIGQIITGRRSMDELGGPIRIARMSGQITELGFLPFVLFMAAISVNLGFINLLPV 316

Query: 296 PILDGGHLITFLLEMI 311
           P+LDGGHL+ + +E+I
Sbjct: 317 PMLDGGHLLFYAMEII 332


>gi|307293414|ref|ZP_07573260.1| membrane-associated zinc metalloprotease [Sphingobium
           chlorophenolicum L-1]
 gi|306881480|gb|EFN12696.1| membrane-associated zinc metalloprotease [Sphingobium
           chlorophenolicum L-1]
          Length = 377

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 114/362 (31%), Positives = 189/362 (52%), Gaps = 29/362 (8%)

Query: 7   FLLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           FLL  ++ + +    V +HE GHY+V R C ++  +FS+GFGPE+   T R G RW++  
Sbjct: 7   FLLTVLAFVAVIGPLVFVHELGHYLVGRWCGVKAEAFSIGFGPEIAAWTDRRGTRWRLGA 66

Query: 63  IPLGGYVSFSED-----EKDMR----------SFFCAAP-WKKILTVLAGPLANCVMAIL 106
           +PLGGYV F  D     + D R            F A P W++   V AGP  N + AIL
Sbjct: 67  LPLGGYVRFKGDMNAASQTDPRWLELPAAERAESFPAKPLWQRAAIVAAGPAINFLFAIL 126

Query: 107 FF-TFFFYNTGVMKPVVS-NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
              TF F +     P V+  V P S AA AG+  GD I+SL+G  ++ F+++  + +  P
Sbjct: 127 ILATFAFVHGESRTPAVAGQVQPGSAAAAAGIVAGDRIVSLNGRDMATFDDIRLFAQIRP 186

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQ--DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQ 222
              +++V+ R+  G L  K   R+   +  D FG K ++  +G+  +  E  +   ++++
Sbjct: 187 GEPVAIVIDRQ--GKLFEK-QGRVGAVEEDDGFGNKFRIGRLGL--APGEPVIEPVSLVR 241

Query: 223 SFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
           +    ++    I R  +  L    G    + ++ GP+ IA ++      G  +++ F+A+
Sbjct: 242 APVVAIERTGQIVRTMVETLGQIVGGGRSVKELGGPLKIAEVSGQAATLGMESFVFFMAL 301

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +GF+NLLPIP+LDGGHL+ + +E I+ + +   V     R GL ++L +  L   N
Sbjct: 302 ISINLGFINLLPIPMLDGGHLLFYGVEAIQRRPVSPQVQEWAYRSGLAVLLAMMMLVTFN 361

Query: 343 DI 344
           D+
Sbjct: 362 DL 363


>gi|157828079|ref|YP_001494321.1| hypothetical protein A1G_01155 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932779|ref|YP_001649568.1| M50 family membrane endopeptidase [Rickettsia rickettsii str. Iowa]
 gi|157800560|gb|ABV75813.1| hypothetical protein A1G_01155 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907866|gb|ABY72162.1| membrane endopeptidase, M50 family [Rickettsia rickettsii str.
           Iowa]
          Length = 357

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 110/345 (31%), Positives = 182/345 (52%), Gaps = 17/345 (4%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF----- 71
           +V IHEFGHY +AR  N++V  FS+GFG  LIGIT + GVRWK+ LIPLGGYV       
Sbjct: 14  LVFIHEFGHYCIARYFNVKVEEFSIGFGKALIGITDKKGVRWKICLIPLGGYVKIYGYDR 73

Query: 72  -----SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGVMKPVVSN 124
                +++  +  +F   +  ++ L V AGPL N ++AI+ F  F  ++    + P++ N
Sbjct: 74  SLMDKTKEVNEKVAFDAKSCLERFLIVAAGPLINYLLAIIIFAGFYCYFGKTEIPPIIGN 133

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V  +SPA  A ++ GD I+ ++  +V  F +V   +  N     +L + R+    + + +
Sbjct: 134 VVASSPAERADLRAGDKIVKVNDKSVKDFGDVQREILINGFSSSTLTIERKSEEFI-VNI 192

Query: 185 MPRLQDTVDRFGIKRQV-PSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITRGFLGVL 242
           MP  Q+ +     ++QV  ++ I        +H++  +L      ++    ++   L  +
Sbjct: 193 MP--QEIIISPPEEKQVKKTLRIGIIAKNEPIHTKIGILGGLWEAINTTIDMSALTLNAI 250

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
           S         +++ GP+ IA+ +      G   Y+ F+AM S  +G +NLLPIP+LDGGH
Sbjct: 251 SQMILGKRSFDELGGPIAIAKESGKSIAGGTQMYLLFIAMLSINLGLLNLLPIPVLDGGH 310

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           L+  L E I GK        ++ ++G  II+FL  + + NDI  L
Sbjct: 311 LVFILYEAITGKLPHPKTKNILLQLGAIIIIFLIIIAVSNDIQNL 355


>gi|27379965|ref|NP_771494.1| zinc metallopeptidase [Bradyrhizobium japonicum USDA 110]
 gi|27353118|dbj|BAC50119.1| zinc metallopeptidase [Bradyrhizobium japonicum USDA 110]
          Length = 383

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 172/352 (48%), Gaps = 22/352 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V  HE GH++VAR   +RVL+FS+GFGPEL+G   R G RWK+S IPLGGYV F  
Sbjct: 27  LTIVVFFHELGHFLVARWAGVRVLTFSLGFGPELVGFNDRHGTRWKISAIPLGGYVKFFG 86

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFT--FFFYN 114
           DE +                   SF       +   V AGP+AN ++  L F     +Y 
Sbjct: 87  DESEASTPSAETLAAMTAEERAGSFHHKKVGPRAAIVAAGPIANFILGALIFAGMALYYG 146

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
                  V  V     AA AG K GD ++ +DG  + +F ++   V  N    ++  + R
Sbjct: 147 KPSTIARVDGVVADGAAAAAGFKIGDIVVQIDGKPIESFADMQRIVAMNAGSALAFQVKR 206

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEIS 232
           +   ++ L   P L +  D FG   ++  +G+       E       V ++   G++++ 
Sbjct: 207 DGA-IVSLTATPALLERKDPFGNSHRLGVLGVEHKSQAGEASTAPVGVGEALKIGVEQVW 265

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            I       L S F  +   N++SG +GIA+++      GF   I   A+ S +IG +NL
Sbjct: 266 FIITSTFKFLGSLFVGNGNPNEVSGVLGIAKMSGQAASAGFQFVINLCAVLSVSIGLLNL 325

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            PIP+LDGGHL+ +  E++RG+ L      +  R+GL ++L L      NDI
Sbjct: 326 FPIPLLDGGHLMFYAAEVVRGRPLSERTQEMGFRIGLGLVLMLMVFATYNDI 377


>gi|238019361|ref|ZP_04599787.1| hypothetical protein VEIDISOL_01225 [Veillonella dispar ATCC 17748]
 gi|237864060|gb|EEP65350.1| hypothetical protein VEIDISOL_01225 [Veillonella dispar ATCC 17748]
          Length = 338

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 181/345 (52%), Gaps = 31/345 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +IV IHE GH++ A++  ++V  F++GFGP +  +  +    + + +IPLGG+      S
Sbjct: 13  LIVFIHELGHFITAKMSGMQVDEFAIGFGPAIFKV-QKGETLYSIRIIPLGGFNRIAGMS 71

Query: 73  EDEK-DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM----KPVVSNVSP 127
            DE  + RSF+    WKK + + AG + N ++AI+ F       G +     PV+ N+ P
Sbjct: 72  PDEPLNERSFYTKPAWKKFIVISAGAVFNFLLAIVLFFGLNATVGNLTYTNDPVIGNIIP 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            S A  A ++  D I+++DG  +S ++E+ P ++    H +++V+ R+   V    V+P+
Sbjct: 132 GSAAEQAHLQSNDRILTIDGKKISTWDEIRPSLQGTANHGVTVVVDRDGETV-ETTVIPK 190

Query: 188 LQDTVDRFGI----KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
           ++    + GI     R+  S+G SFS   T+   +T++   S   D I            
Sbjct: 191 MEQDSPKIGIYPSFTRESYSIGESFSLAVTR-TGQTIVAMLSGLYDMI------------ 237

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               + T+  ++SGPVGI+++A      GF   ++F A  S  +G +NLLP+P+LDGGHL
Sbjct: 238 ----RGTQAAELSGPVGISQMAGTIAQSGFAPLLSFAAFLSINLGVINLLPLPVLDGGHL 293

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           I  L E I G+ L       I  +G+ +++ LF      DI+ L+
Sbjct: 294 IIILAEAITGRKLPAKALMYIQMVGVALMVALFLYVTTQDIFRLL 338


>gi|300023422|ref|YP_003756033.1| membrane-associated zinc metalloprotease [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525243|gb|ADJ23712.1| membrane-associated zinc metalloprotease [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 381

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 104/360 (28%), Positives = 181/360 (50%), Gaps = 28/360 (7%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           +++ + L ++V IHE GH++VAR C + V +FS+GFGPE+ G   + G RW+ + IPLGG
Sbjct: 16  IMFLLVLTLVVFIHELGHFLVARWCGVTVKAFSIGFGPEIYGFYDKHGTRWRFAWIPLGG 75

Query: 68  YVSFSEDEK--------------DMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFF 112
           YV F +D+               +    F + P   +   V AGP+AN ++A + +    
Sbjct: 76  YVKFIDDDNASSQGSSTKGLTASERAGAFHSKPVSSRAAVVAAGPIANFLLATVLYAALN 135

Query: 113 YNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
              G  V+  +V  V P SPAA AG + GD +++++   +  FE++   V  +    ++ 
Sbjct: 136 MTVGVRVLPALVDGVVPNSPAAQAGFQPGDQVVAINNTAIEKFEDLQRIVGSSAGEPLAF 195

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFG--IKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
            + R     L L   P + +  D FG   +R +  +  + S D+ +     + Q+   G+
Sbjct: 196 TIERNGEK-LTLNATPNVDEQRDAFGRTFRRGLIGIQRTMSADKVRTVDVGIPQAILLGV 254

Query: 229 DE----ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFS 284
            E    IS    G   +++    +     Q+ GP+ +A +     + G+   + ++A  S
Sbjct: 255 GETYGNISQTIAGLWDIVT----RRQSAEQMGGPIMMAEVTAKVAELGWEPMLRWIAFIS 310

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             IGF+NLLPIP+LDGGHL+ +  E +R K     + ++  ++GL +++ L      NDI
Sbjct: 311 ANIGFLNLLPIPVLDGGHLLFYGYEAVRRKPASERMQQMGFQVGLAVLMMLVVFVNFNDI 370


>gi|94496935|ref|ZP_01303509.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Sphingomonas sp. SKA58]
 gi|94423611|gb|EAT08638.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Sphingomonas sp. SKA58]
          Length = 377

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 113/368 (30%), Positives = 183/368 (49%), Gaps = 29/368 (7%)

Query: 7   FLLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           FLL  ++ + +    V +HE GHY+V R   ++  +FS+GFGPEL     R G RW+V+ 
Sbjct: 7   FLLTVLAFVAVIGPLVFVHELGHYLVGRWFGVKAEAFSIGFGPELFAWVDRRGTRWRVAA 66

Query: 63  IPLGGYVSFSED---------------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAIL 106
           +PLGGYV F  D                 D    F A P W++   V AGP  N + AIL
Sbjct: 67  LPLGGYVRFKGDMNAASMTDPAWLEMSAGDRAESFPAKPLWQRAAIVAAGPAINFLFAIL 126

Query: 107 FF-TFFFYNTGVMKPVVSN-VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
              TF F +     P V+  V   S A  AG+K GD I+S +G T+  + ++  Y R  P
Sbjct: 127 IIATFAFVHGESRTPAVAGIVEQGSAADAAGIKVGDRILSFNGRTMDTYTDMVMYTRIRP 186

Query: 165 LHEISLVLYREHVGV-LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQS 223
              + + + R    + +  K+   ++D  D FG K +V  +GI     E  +   ++L++
Sbjct: 187 GEPVDVAIERNGQRLEVRTKIGAVMED--DGFGQKFRVGRLGI--GAGEPVVERVSLLRA 242

Query: 224 FSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMF 283
               ++    I R  +  L         + ++ GP+ IA+++      G  ++I F+A+ 
Sbjct: 243 PIVAVERTGQIVRTMVETLGQIVSGGRSVKELGGPLKIAQVSGQAATLGLESFIFFVALI 302

Query: 284 SWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
           S  +GF+NLLPIP+LDGGHL+ + +E ++ + +         R GL +++ +  L   ND
Sbjct: 303 SINLGFINLLPIPMLDGGHLLFYGIEAVQRRPVSPQAQEWAYRSGLAVLMAMMLLVTFND 362

Query: 344 I--YGLMQ 349
           +  +GL Q
Sbjct: 363 LSSFGLWQ 370


>gi|294012395|ref|YP_003545855.1| putative metallopeptidase [Sphingobium japonicum UT26S]
 gi|292675725|dbj|BAI97243.1| putative metallopeptidase [Sphingobium japonicum UT26S]
          Length = 377

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 187/362 (51%), Gaps = 29/362 (8%)

Query: 7   FLLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           FLL  V+ + +    V +HE GHY+V R C ++  +FS+GFGPE+   T R G RW++  
Sbjct: 7   FLLTVVAFVAVIGPLVFVHELGHYLVGRWCGVKAEAFSIGFGPEIAAWTDRRGTRWRLGA 66

Query: 63  IPLGGYVSFSED-----EKDMR----------SFFCAAP-WKKILTVLAGPLANCVMAIL 106
           +PLGGYV F  D     + D R            F A P W++   V AGP  N + AIL
Sbjct: 67  LPLGGYVRFKGDMNAASQADPRWLEMPAAERAESFPAKPLWQRAAIVAAGPAINFLFAIL 126

Query: 107 FFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
               F +  G  +   V   V P S AA AG+  GD I+SL+G  ++ F+++  + +  P
Sbjct: 127 ILAAFAFVHGESRTPAVAGQVQPGSAAAAAGIVAGDRIVSLNGREMATFDDIRLFAQIRP 186

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQ--DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQ 222
              +++++ R+  G L  K   R+   +  D FG K ++  +GI  +  E  +   ++++
Sbjct: 187 GEPVTILIDRQ--GRLFEK-QGRVGAVEEDDGFGNKFRIGRLGI--APGEPVIEPVSLIR 241

Query: 223 SFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
           +    ++    I R  +  L    G    + ++ GP+ IA ++      G  +++ F+A+
Sbjct: 242 APVVAIERTGQIIRTMVETLGQIVGGGRSVKELGGPLKIAEVSGQAATLGVESFVFFMAL 301

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +GF+NLLPIP+LDGGHL+ + +E I+ + +   V     R GL ++L +  L   N
Sbjct: 302 ISINLGFINLLPIPMLDGGHLLFYGVEAIQRRPVSPQVQEWAYRSGLAVLLAMMVLVTFN 361

Query: 343 DI 344
           D+
Sbjct: 362 DL 363


>gi|241761999|ref|ZP_04760083.1| membrane-associated zinc metalloprotease [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373465|gb|EER63052.1| membrane-associated zinc metalloprotease [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 376

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/324 (32%), Positives = 165/324 (50%), Gaps = 41/324 (12%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED-- 74
           +V +HE GHY VAR   ++   FS+GFGPE+ G T R G RW+V+ +P GGYV F+ D  
Sbjct: 21  LVFVHELGHYAVARFFGVKADVFSIGFGPEIFGWTDRLGTRWRVACLPFGGYVRFAGDMD 80

Query: 75  ----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM 118
                           E   ++F     W + L VLAGPL N  +AIL F   F   GV 
Sbjct: 81  PASSGRPSSEWLALSPEDRAKTFQAKKAWHRFLIVLAGPLTNIFVAILLFAAVFSVHGVA 140

Query: 119 K--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           +   VVS + P S A  AG+K GD I +++   V+ F ++ P V+ +P  ++ + L R+ 
Sbjct: 141 RSPSVVSAIVPHSAADTAGLKVGDKITAVNSYKVNYFNDLQPVVQMHPDEQVLIKLVRDG 200

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGI--------SFSYDETKLHSRTVLQS-FSRG 227
              + +KV  + +   DRFG   ++  +GI             E    + + + +     
Sbjct: 201 RA-MDVKVHLKAEHFQDRFGNSSRIGLLGILGGAPVIVRLPLTEIPQAATSAVGTMLHEQ 259

Query: 228 LDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
           +D I  I  G              ++++ GP+ IAR++    + GF  ++ F+A  S  +
Sbjct: 260 IDGIGQIITG-----------RRSMDELGGPIRIARMSGQITELGFLPFVLFMAAISVNL 308

Query: 288 GFMNLLPIPILDGGHLITFLLEMI 311
           GF+NLLP+P+LDGGHL+ + +E+I
Sbjct: 309 GFINLLPVPMLDGGHLLFYAMEII 332


>gi|58584316|ref|YP_197889.1| membrane-associated Zn-dependent protease [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58418632|gb|AAW70647.1| Predicted membrane-associated Zn-dependent protease [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 374

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 174/356 (48%), Gaps = 21/356 (5%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL +++ + +IV +HE+GHY++A+   ++V SFS+GFGP + G   +SG RWK+S IPLG
Sbjct: 18  FLSFSLIISVIVFVHEYGHYIIAKAYKVKVESFSIGFGPGIFGFYDKSGTRWKLSAIPLG 77

Query: 67  GYV----------------SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTF 110
           GYV                  +E+EK   S      ++K   V AGP AN + AI+  T 
Sbjct: 78  GYVKMLGDNNAANTPIDQQELTEEEKSY-SLHTKPRYQKAAIVFAGPFANMIFAIIALTV 136

Query: 111 FFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEI 168
           FF   G     PV+  V   S A  AG+  GD I  ++   +  FE+++  +  NP  +I
Sbjct: 137 FFSVVGYYHTPPVIGKVIEGSAAKQAGLLPGDTITQINEYKIKYFEDISRVMMSNPETKI 196

Query: 169 SLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
             + Y  +       + P   +  D FG   +  ++GI+ S +  +L   +   + S  +
Sbjct: 197 E-IKYSRNNEEYSTSLTPLTIEDKDIFGNIIERKTIGIT-SVNIKELRQSSFFGAVSLSV 254

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
            E        +  L         +N+I GP+ IA+ +      GF   + F+A+ S  + 
Sbjct: 255 SETYHTMCLTIKALFQIIVGKRSVNEIGGPIKIAKYSGQSAKKGFIMVLYFMAIISANLA 314

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +NLLPIP+LDGGHL  +++E +  + L +   +     G  ++  L  + I NDI
Sbjct: 315 AINLLPIPLLDGGHLFHYIIEAVIRRDLSLKYQKYAATFGASVLFLLMAIAISNDI 370


>gi|229586403|ref|YP_002844904.1| Putative membrane-associated zinc metalloprotease [Rickettsia
           africae ESF-5]
 gi|228021453|gb|ACP53161.1| Putative membrane-associated zinc metalloprotease [Rickettsia
           africae ESF-5]
          Length = 357

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 112/346 (32%), Positives = 181/346 (52%), Gaps = 19/346 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF----- 71
           +V IHEFGHY +AR  N++V  FS+GFG  LIGIT + GVRWK+ LIPLGGYV       
Sbjct: 14  LVFIHEFGHYCIARYFNVKVEEFSIGFGKALIGITDKKGVRWKICLIPLGGYVKIYGYDR 73

Query: 72  -----SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYNTGVMKPVVSN 124
                +++  +  +F   +  ++ L V AGPL N ++AI+ F  F  ++    + P++ N
Sbjct: 74  NLMDKTKEVNEKVAFDAKSCLERFLIVAAGPLINYLLAIIIFAGFYCYFGKTEIPPIIGN 133

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V  +SPA  A ++ GD I+ ++  +V  F +V   +  N     +L + R+    + + +
Sbjct: 134 VVASSPAERADLRAGDKIVKVNDKSVKDFGDVQREILINGFSSSTLTIERKSEEFI-VNI 192

Query: 185 MPRLQDTVDRFGIKRQVPS---VGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
           MP  Q+ +     ++QV     +GI  + +E       +L      ++    ++   L  
Sbjct: 193 MP--QEIIISPPEEKQVKKTLRIGI-IAKNEPINTKIGILGGLWEAINTTIDMSALTLNA 249

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           +S         ++I GP+ IA+ +      G   Y+ F+AM S  +G +NLLPIP+LDGG
Sbjct: 250 ISQMIVGKRSFDEIGGPIAIAKESGKSIAGGTQMYLLFIAMLSVNLGLLNLLPIPVLDGG 309

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           HL+  L E I GK        ++ ++G  II+FL  + + NDI  L
Sbjct: 310 HLVFILYEAITGKLPHPKTKNILLQLGAIIIIFLIIIAVSNDIQNL 355


>gi|85859437|ref|YP_461639.1| membrane metalloprotease [Syntrophus aciditrophicus SB]
 gi|85722528|gb|ABC77471.1| membrane metalloprotease [Syntrophus aciditrophicus SB]
          Length = 366

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 111/341 (32%), Positives = 183/341 (53%), Gaps = 18/341 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSF--- 71
           +++ +HEFGH++ A+   + VL FS+GFGP+LI  + + G   + +SLIPLGGYV     
Sbjct: 15  VLIFVHEFGHFIAAKYSGVGVLKFSLGFGPKLI--SRKIGETEYLLSLIPLGGYVKLLGE 72

Query: 72  SED-----EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSN 124
           S D     E++ RSF     WK+I+ V AGP+ N ++AIL F    Y TGV  + P V  
Sbjct: 73  SPDDLLSPEQEKRSFLKQPVWKRIIIVAAGPVFNFLLAILIFNIV-YMTGVPVLAPTVGG 131

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           +   S A  AG+K+GD I++++G T+S ++E+A  +  +    + L +         + +
Sbjct: 132 IEQGSAAWKAGIKEGDSILTVNGRTISQWDELAEEIGRSKGKAVKLRIGNGEPP-REVTL 190

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITRGFLGVLS 243
           +P+L    + FG   +V +  I  S     L SRT  L +F   L +  +IT+  +  + 
Sbjct: 191 VPQLMKGTNIFG--EEVENYRIGISASSKILISRTGPLNAFWMSLKQTWTITKLTMVSIV 248

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
                      + GP+ IA+IA      G   ++ F+A+ S  +  +NLLPIP+LDGGHL
Sbjct: 249 KMIEGVVSPKNLGGPILIAQIAGAQVKEGITPFVLFMALLSINLAVLNLLPIPVLDGGHL 308

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           + F++E++ G+ + +       ++GL I++ L       DI
Sbjct: 309 MFFIIELVIGREISIRWREAAQQVGLVILVLLMAFAFAMDI 349


>gi|85708130|ref|ZP_01039196.1| hypothetical protein NAP1_02805 [Erythrobacter sp. NAP1]
 gi|85689664|gb|EAQ29667.1| hypothetical protein NAP1_02805 [Erythrobacter sp. NAP1]
          Length = 365

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/335 (31%), Positives = 163/335 (48%), Gaps = 19/335 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED-- 74
           +V +HE GHY+V R   ++  +FSVGFG E+ G T + G RWK+S +PLGGYV F  D  
Sbjct: 13  LVTVHELGHYLVGRWFGVKAEAFSVGFGKEIAGRTDKHGTRWKLSALPLGGYVQFKGDMN 72

Query: 75  ---------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG---VMKPVV 122
                      +  SF  A+ WK+ L V AGP+ N V+AI      F   G   V  P  
Sbjct: 73  PASVPDPDAPAETGSFQSASLWKRALIVAAGPVTNLVVAIAILAALFSIYGQRVVANPES 132

Query: 123 SN----VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178
           S      S  S A  +G++ GD II++DG  V  F+++   +   P  E+++V  R    
Sbjct: 133 STEIGGFSETSVAQASGMEVGDRIIAIDGQKVETFDDIVREIALYPGREMTIVAERSGDE 192

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
           +       R+ +  D FG    V  +G++ +  E      ++L++      +   +T+  
Sbjct: 193 MAFDVTAARVTEE-DGFGNSHTVGRIGVAPAALEYDFQPVSILKAIPLATWQCWDMTKMM 251

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
           +  +      D  + ++ GP+ IA+ +      G   ++ F A+ S  + F+N LPIP L
Sbjct: 252 VTGIKQILFGDRSIKELGGPIKIAKFSGERLSLGLTEFVFFAALISLNLAFINFLPIPAL 311

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIIL 333
           DGGHL  +  E IR K +G   T    R G+ I+L
Sbjct: 312 DGGHLAFYAAEAIRRKPVGPQATEWAYRTGIAIVL 346


>gi|254995304|ref|ZP_05277494.1| hypothetical protein AmarM_05070 [Anaplasma marginale str.
           Mississippi]
          Length = 361

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 188/347 (54%), Gaps = 35/347 (10%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKD--- 77
           HE+ HY VA+LC +RV +FS+GFGPEL GIT  SG RWK SL+P+GGYV    D ++   
Sbjct: 32  HEY-HYAVAKLCGVRVKTFSLGFGPELFGITDGSGTRWKFSLVPVGGYVKMLGDTQEDNL 90

Query: 78  ---MRSF-FCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNVSPASP 130
               +SF F   P W++     AGPLAN + ++L F   F   G+M   P+V ++ P S 
Sbjct: 91  SEGEKSFAFNEKPLWQRFAVAGAGPLANLLFSVLVFFVLFSTRGIMSPMPIVGSILPGST 150

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH-LKVMPRL- 188
           A   G+  GD I+ +DG  +S FEE+  Y+  +P  E ++V  R+  GV H +K+ P + 
Sbjct: 151 AEKVGLMVGDRIVEVDGHEISWFEEIRHYIAGSPNQEFTVVFLRD--GVQHSIKLSPDVW 208

Query: 189 QDTVDRFGIKRQVPSVGISFSYDETKLHS----RTVLQSFSRGLDEISSITRGFLGVLSS 244
            D   R GI   +       S + T+       R  ++SF R +  I  IT   L V+  
Sbjct: 209 SDDAHRLGIAANI-------SPETTRARRLPVLRAAVESF-RCIFRIVKIT--LLAVVQL 258

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAY-IAFLAMFSWAIGFMNLLPIPILDGGHL 303
             G    ++++ GPV   RIAK+  +   N   + F+ + S  +G +NLLPIP+LDGG++
Sbjct: 259 VTGARG-MDELGGPV---RIAKHSGESIRNKEGLWFVGLISANLGVVNLLPIPMLDGGYM 314

Query: 304 ITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           + + L+ I R K++      V+  +G  +++ +      ND+  +++
Sbjct: 315 LQYALQGIFRRKTINPKYQNVMMAIGFVLLVSMMVFVTFNDVKSILK 361


>gi|317153891|ref|YP_004121939.1| membrane-associated zinc metalloprotease [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944142|gb|ADU63193.1| membrane-associated zinc metalloprotease [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 352

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 117/345 (33%), Positives = 177/345 (51%), Gaps = 21/345 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS---- 72
           ++  HE GH+ VARL  + V SFS+GFGP L G  S     +K+S IPLGGYV  +    
Sbjct: 15  LIFFHELGHFAVARLFGMGVRSFSLGFGPRLAGFRS-GATEYKLSAIPLGGYVQLAGEQG 73

Query: 73  ---EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPVVSNVSP 127
              ED  D + F    PW+++  V AGP+ N ++A L + F       GV+ P V  V P
Sbjct: 74  EEEEDFPDDQLFSKRPPWQRLCVVAAGPIFNFLLAFLIYWFLALAQGQGVVMPTVGEVMP 133

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            SPA  AG+KK D IIS+DG  + ++ E+   +R      +  V+ R     L L V P+
Sbjct: 134 DSPALAAGLKKNDRIISIDGKPIDSWSEMVETIRAGNDTSLRFVVQRGDES-LSLDVTPK 192

Query: 188 LQDTVDRFGIKRQVPSVGIS----FSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
           +    + FG +  VP VGI       Y         +    +  +  +  + +GF+ ++ 
Sbjct: 193 VNTVKNLFGEEVTVPMVGIGQGGVIEYRPVDGVGAQIALVHTWTMSTV--VVKGFVSIIE 250

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               +   +  I GP+ +A++  N    GF   +A +A+ S  +  +NLLPIP+LDGGH+
Sbjct: 251 ----RLIPVESIGGPIMLAQMVHNSAQSGFYDLLAMVAIISINLAIINLLPIPVLDGGHI 306

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           + FLLEMI  + +        TR+G+ I+L L  L I ND+  L+
Sbjct: 307 VYFLLEMIFRRPISDRWKAAATRVGILILLMLMSLAIFNDVRRLL 351


>gi|323137311|ref|ZP_08072389.1| membrane-associated zinc metalloprotease [Methylocystis sp. ATCC
           49242]
 gi|322397298|gb|EFX99821.1| membrane-associated zinc metalloprotease [Methylocystis sp. ATCC
           49242]
          Length = 384

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 114/358 (31%), Positives = 183/358 (51%), Gaps = 33/358 (9%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK--- 76
           IHE+GH++V R C ++V +FS+GFGPEL     R G RW+++ IPLGGYV F  D     
Sbjct: 25  IHEYGHFIVGRWCGVQVDAFSIGFGPELWSRVDRLGTRWRIAAIPLGGYVKFHGDANGAS 84

Query: 77  -------------DMRSFFCAAP-WKKILTVLAGPLANCVMAILFFT--FFFYNTGVMKP 120
                        +    F A P WK+   V AGP AN ++AI  F   F FY   V+ P
Sbjct: 85  VPDPEAVNAMPAAERAVTFAAQPVWKRSAIVFAGPFANFLLAIAIFAALFGFYGRTVLAP 144

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
            V +V        AG + GD ++S+DG  + +F ++   V  +   ++  V+ R +   L
Sbjct: 145 RVGSVVAGGAGQAAGFQPGDLVVSIDGTPIDSFGKMQEIVSVSADRKLIFVI-RRNGAEL 203

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEISSI---T 235
               +P  ++     G K ++  +G+  S     +       LQS +  +DE   +   T
Sbjct: 204 TFPAIPAWREIDSAVG-KVRIGMLGLQASTAAADVREERYGPLQSLAMAVDETWQVVHRT 262

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIA----RIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
             ++G L +  G+++  +Q+SGP+GIA    ++AK     G   ++  +A+ S +IG +N
Sbjct: 263 GVYVGGLIT--GRES-ADQLSGPIGIAQMSGQMAKAATKVGIAPFMNLIAILSVSIGLLN 319

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           L+P+P+LDGGHL+ F +E +RG++L         R+GL ++  L      NDI  L+ 
Sbjct: 320 LMPVPLLDGGHLLFFGIEAVRGRALNERAQEFAFRVGLAMVGALMIFSTYNDIARLIH 377


>gi|148553391|ref|YP_001260973.1| putative membrane-associated zinc metalloprotease [Sphingomonas
           wittichii RW1]
 gi|148498581|gb|ABQ66835.1| putative membrane-associated zinc metalloprotease [Sphingomonas
           wittichii RW1]
          Length = 377

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 179/369 (48%), Gaps = 32/369 (8%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           +F +  FLL    LI +   HE GHY+  R C ++   FS+GFG E+ G T   G RWK+
Sbjct: 8   LFTILAFLLVIGPLIFV---HELGHYLAGRWCGVKADVFSIGFGREIAGYTDSRGTRWKL 64

Query: 61  SLIPLGGYVSFSED----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
             +P+GGYV F+ D                E+  R+F     W++ L V AGP  N V+A
Sbjct: 65  GWMPMGGYVKFAGDMNPASVPTPEWLALPPEERARTFQAKPVWQRFLIVFAGPFTNFVVA 124

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  F  FF  Y       VVS V   SPAA AG++ GD +++++G  +  F+++A  +R 
Sbjct: 125 IGIFMAFFAAYGAPRTPSVVSAVIEGSPAARAGMQPGDRVVAIEGRPIERFDDLADMIRF 184

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD---ETKLHSRT 219
            P   + + L R       L V+P      DRFG + +  ++G+           LH   
Sbjct: 185 RPDERLRIDLVRGSE-TRTLFVVPVANVERDRFGNEFRKGTIGVLSGPQIVVPVPLHELP 243

Query: 220 VLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAF 279
           V  +      +   I R  +  L         + ++ GP+ IA+++      G   ++  
Sbjct: 244 VEAT-----RQTFGIVRMMVDTLGQIVTGRRSVKELGGPIKIAQVSGQQASLGLLNFVML 298

Query: 280 LAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIIL-FLFFL 338
           +A+ S  +GF+NLLPIP+LDGGHL+ +L E I  + +         R GL ++L F+ F+
Sbjct: 299 MALISINLGFINLLPIPMLDGGHLVFYLFEGIARRPVPERAMEWAFRSGLAVLLSFMIFV 358

Query: 339 GIRNDIYGL 347
            + NDI  L
Sbjct: 359 TL-NDILSL 366


>gi|258406068|ref|YP_003198810.1| membrane-associated zinc metalloprotease [Desulfohalobium retbaense
           DSM 5692]
 gi|257798295|gb|ACV69232.1| membrane-associated zinc metalloprotease [Desulfohalobium retbaense
           DSM 5692]
          Length = 356

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 111/344 (32%), Positives = 180/344 (52%), Gaps = 16/344 (4%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSFSED 74
           +++  HE GH+  ARL  + V +FS+GFGP L G   R G   ++++ +PLGGYV    +
Sbjct: 14  LLIFFHELGHFTAARLLGVGVRTFSLGFGPRLTGF--RLGRTDYRIASVPLGGYVQLVGE 71

Query: 75  EKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPVVS 123
             D           SF    PW+++L V AGP+ N ++A+L +   F  Y    M PV+ 
Sbjct: 72  SPDAELPEGFTSQDSFARRPPWQRMLVVAAGPIFNFILAVLIYWIIFASYGQQAMLPVIG 131

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLK 183
            V   SPA  AG++ GD I++++G  V  + +VA  ++ +    + L + RE      L+
Sbjct: 132 EVRDQSPAYEAGLRAGDHILAINGQPVEYWSDVAQRIQAHGTAPLELQILREETQ-RTLR 190

Query: 184 VMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
           + P LQ   + FG K +VP VGI  +   T++     L+SF+    +   + +     L 
Sbjct: 191 MTPTLQTRENIFGEKTEVPIVGIIAAGKTTRI-DMGPLESFTAANQQTWQLVKLTGEGLV 249

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               +   L  + GP+ IA++     + G    +A  A+ S  +G +NLLPIP+LDGGHL
Sbjct: 250 KLVERVIPLETVGGPILIAQMVHQQAEQGLVQLLALTALISINLGLLNLLPIPVLDGGHL 309

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           + +L+E + G+ L      V+ ++GL ++L L  L I ND+  L
Sbjct: 310 LFYLVETVLGRPLDPKWQHVVNKIGLSLLLALMGLAIYNDLQRL 353


>gi|117925144|ref|YP_865761.1| peptidase RseP [Magnetococcus sp. MC-1]
 gi|117608900|gb|ABK44355.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Magnetococcus sp. MC-1]
          Length = 369

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 185/354 (52%), Gaps = 24/354 (6%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSR---SGVRWKVSLIPLGGY 68
           V L I++ +HE GH++VAR   +RVL FS+GFGP+L+    R    G  + +SLIPLGGY
Sbjct: 9   VVLGILIFVHEMGHFLVARWMKVRVLVFSLGFGPKLLSWRGRGGAEGTEYCLSLIPLGGY 68

Query: 69  VS-FSE---------------DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
           V  F E               +E+   SF   +   +   VLAGPL N + AI F  +  
Sbjct: 69  VKMFGEAGVVEDEQNGERALTEEEKQGSFAHKSLQARFAVVLAGPLFNFIFAI-FALWAV 127

Query: 113 YNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
           Y  GV K    V  V    PAA+AGV+ GD II +DG  V  +  +   +R +    I L
Sbjct: 128 YAMGVEKMYADVGKVIEQGPAAMAGVQVGDRIIKVDGEAVEDWMAMRERIRASSHGVIKL 187

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
            + R     L L + P + DTV +FG   +   +GI+ S  ET      V ++F  G+D+
Sbjct: 188 EVLRGDK-QLTLTLNPEMGDTVTKFGEPTKKARIGIAPS-GETFAVEYGVGEAFWLGIDK 245

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
               +      +     ++   +QI GP+ IA++A +  + GF + + F+++ S  +G +
Sbjct: 246 TWEFSTLIFTSIKKMITQEIPADQIGGPIAIAKMAGSTAEMGFASMLMFMSLISVNLGVL 305

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           NLLPIP+LDGGHL+ +++E I+G  +      +  R+GL ++L L  L   ND+
Sbjct: 306 NLLPIPVLDGGHLLFYVMEAIKGGPISEKAQMIAMRIGLSLLLALMVLAFYNDL 359


>gi|170749840|ref|YP_001756100.1| membrane-associated zinc metalloprotease [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656362|gb|ACB25417.1| membrane-associated zinc metalloprotease [Methylobacterium
           radiotolerans JCM 2831]
          Length = 384

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 178/351 (50%), Gaps = 29/351 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED------ 74
           HE GH++V R C + V +FS+GFGPEL G   R G RWKV  IPLGGYV F  D      
Sbjct: 32  HEMGHFLVGRWCGVGVHAFSLGFGPELFGFNDRRGTRWKVCAIPLGGYVKFHGDVNGASM 91

Query: 75  -----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPV 121
                      ++   SF      K+   V AGP+AN ++AIL F    +  G   +   
Sbjct: 92  PDPEAVARMSPQERAISFPTQPVSKRAAIVAAGPVANFILAILLFAGAIWLGGRYELPAR 151

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           VS+V P S AA AG + GD I ++DG  +  F  +   V  +    ++  + R    +  
Sbjct: 152 VSSVEPNSVAAQAGFQPGDVITAIDGEKIGDFNAMYRTVTGSAGTPLTFTVERNDQPIT- 210

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGI-SFSYDETKLHSRTVLQSFSRGLDE---ISSITRG 237
           ++  P   +    FG + ++  +GI S +  E +L     L S + G+ E   +   T  
Sbjct: 211 IQATPATFEEKTPFG-RHRIGRLGIRSPAGSEARLVHYGALDSLNLGVKETYFVVERTFS 269

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFD-HGFNAYIAFLAMFSWAIGFMNLLPIP 296
           +LG L +  G+++  +Q+SGP+GIAR++       G    +  +A+ S +IG +NL P+P
Sbjct: 270 YLGKLVT--GRES-ADQLSGPIGIARVSGEVAKTGGVGGLVGLIALLSVSIGLLNLFPVP 326

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +LDGGHL+ +  E++RG+ L      +  R+GL ++L L      NDI  L
Sbjct: 327 LLDGGHLLFYAFEVVRGRPLSERAQEIGFRIGLALVLMLMLFAAWNDILNL 377


>gi|167042079|gb|ABZ06814.1| putative peptidase family M50 [uncultured marine microorganism
           HF4000_141I21]
          Length = 368

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 107/347 (30%), Positives = 178/347 (51%), Gaps = 23/347 (6%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           ++  + + + ++I+V IHE+GHY  A+   + +  FS+GFG E+ G   +SG RWK+  I
Sbjct: 1   MNYLIPFLILIMIVVFIHEYGHYYFAKRYGVGITDFSIGFGSEIFGWHDKSGTRWKICWI 60

Query: 64  PLGGYVSF---------SEDEK--------DMRSFFCAAP-WKKILTVLAGPLANCVMAI 105
           PLGGYV F         +E +K        D    F   P +++ L V AGPLAN V+AI
Sbjct: 61  PLGGYVKFFGDRNVFSQAEQQKVIDKYSKEDRNKLFILKPLYQRSLIVAAGPLANFVLAI 120

Query: 106 LFFTF--FFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN 163
           + F+    F    +   VV  V+  SPA  AG+KK D IIS+D   V +  EV+ ++  +
Sbjct: 121 IIFSIINMFVGKDMTPSVVVEVAINSPAYEAGIKKNDKIISIDHHKVLSILEVSTFISTS 180

Query: 164 PLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG--IKRQVPSVGISFSYDETKLHSRTVL 221
            +  I   + R +  V  L V P L  + D  G  +K+++  + +S   +E K       
Sbjct: 181 TVEIIEFTVLRNNQEVT-LYVKPNLVQSKDSLGNSVKKRMIGIKLSPLNNEFKKQRLGPS 239

Query: 222 QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLA 281
           ++    + E+  ++   L  L +        +Q+ GP+ IA+I     ++G   +++ +A
Sbjct: 240 KAIYYAIKEVWFVSVTSLKYLGNMLIGSADSSQLGGPIRIAKITGQVAEYGVVPFLSIMA 299

Query: 282 MFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMG 328
             S ++G +NL PIP+LDGGHL+ +  E + G+ L       + R+G
Sbjct: 300 YISISLGLINLFPIPMLDGGHLMFYFFEKVLGRPLSQKTQEGLFRIG 346


>gi|149186830|ref|ZP_01865140.1| hypothetical protein ED21_25367 [Erythrobacter sp. SD-21]
 gi|148829497|gb|EDL47938.1| hypothetical protein ED21_25367 [Erythrobacter sp. SD-21]
          Length = 369

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 117/347 (33%), Positives = 168/347 (48%), Gaps = 37/347 (10%)

Query: 18  VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED--- 74
           V +HE GHY+V R   ++  +FSVGFG E+ G T   G RWK+S IPLGGYV F  D   
Sbjct: 14  VTLHELGHYLVGRWFGVKAEAFSVGFGKEVWGWTDGRGTRWKLSAIPLGGYVQFKGDMDP 73

Query: 75  ---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK 119
                          E+D  SF  A+  K+ L V AGP  N ++ +  F  FF   G  K
Sbjct: 74  ASIPHPDKIDEASAQERD-GSFHHASLGKRALIVFAGPAMNVLVTLAIFASFFAIYG--K 130

Query: 120 PVVSN---------VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
           PV ++          +  S A  AG++ GD +I++DG  V+ F++VA  V   P   I +
Sbjct: 131 PVAADPEETTVITRFAEESAARAAGLEIGDRMIAIDGEPVAEFQDVADQVLMYPGRTIDM 190

Query: 171 VLYREHVGVLHLKVMPRLQD--TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
            + RE      L +  R+ D    DRFG K ++  +GI  S  E  +    + +S     
Sbjct: 191 EIEREGE---RLTLPVRIADIEEADRFGNKSRIGRIGIYSS--ELAVEEVGIGESIGLAF 245

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
            +   +    +  +      D  + ++ GPV I + A      G  A+I F A+ S  + 
Sbjct: 246 VQTGKLVDMMVTGIKQIIVGDRSVKELGGPVTIGKFAGEQLSMGPLAFINFAALISLNLA 305

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335
           F+NLLPIP LDGGHL  +  E +R K LG   T V  R G+ ++L L
Sbjct: 306 FINLLPIPALDGGHLAFYAAEAVRRKPLGPKSTEVAYRAGVALVLAL 352


>gi|269958466|ref|YP_003328253.1| putative protease [Anaplasma centrale str. Israel]
 gi|269848295|gb|ACZ48939.1| putative protease [Anaplasma centrale str. Israel]
          Length = 362

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 112/343 (32%), Positives = 181/343 (52%), Gaps = 26/343 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMR- 79
           HE+GHY VA+LC IR+ +FS+GFGPEL GIT  SG RWK S++P+GGYV    D ++ + 
Sbjct: 32  HEYGHYAVAKLCGIRIKTFSLGFGPELFGITDGSGTRWKFSMVPVGGYVKMLGDAQEDKL 91

Query: 80  -------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNVSPASP 130
                  +F   + W++     AGPLAN + ++L F   F   GVM   P+V +V P S 
Sbjct: 92  TEGEKSFAFNEKSLWQRFAVAGAGPLANLLFSVLVFFILFSTRGVMSPMPIVGSVLPGST 151

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH-LKVMPRLQ 189
           A   G+  GD I+ +DG  V  FEE+  Y+  +   E ++V  R+  GV H +K+ P + 
Sbjct: 152 AERIGLMVGDRIVEVDGREVLWFEEIRHYIAGSTNQEFTMVFLRD--GVSHSVKLSPDVW 209

Query: 190 -DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGK 248
            D   R GI   +       S + T+     VL + +     I  I +  L  +      
Sbjct: 210 LDDARRLGIAADI-------SPETTRNRRLPVLLAAAEAFRCIFRIVKITLVAVVQLVTG 262

Query: 249 DTRLNQISGPVGIARIAKNFFDHGFNAY-IAFLAMFSWAIGFMNLLPIPILDGGHLITFL 307
              ++++ GPV   RIAK+  +   N   + F+ + S  +G +NLLPIP+LDGG+++ + 
Sbjct: 263 ARGVDELGGPV---RIAKHSGESIRNKEGLWFVGLISANLGVVNLLPIPMLDGGYMLQYA 319

Query: 308 LEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           L+ I R +++      V+  +G  +++ +      ND+  +++
Sbjct: 320 LQGIFRRRTINPKYQNVMMAIGFVLLVSMMVFVTFNDVKSILK 362


>gi|219669718|ref|YP_002460153.1| membrane-associated zinc metalloprotease [Desulfitobacterium
           hafniense DCB-2]
 gi|219539978|gb|ACL21717.1| membrane-associated zinc metalloprotease [Desulfitobacterium
           hafniense DCB-2]
          Length = 354

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 173/350 (49%), Gaps = 31/350 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---- 71
           ++V+IHE GH++VARL  I+VL F+ GFGP++IG   +    + + LIPLGG+V      
Sbjct: 13  LLVMIHELGHFIVARLNGIKVLEFAFGFGPKIIGFQGKE-TAYSLRLIPLGGFVKLYGMD 71

Query: 72  -SEDEK---------DMRSFFCAAPWKKILTVLAGPLANCVMAI----LFFTFFFYNTGV 117
              DE          D RSF     W+++  + AGP+ N V+AI    + F +F   T  
Sbjct: 72  AETDENGNQVLAATTDPRSFSNKKVWQRMSVIAAGPIMNLVLAIFLFMIVFAYFGIATAT 131

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
              VV ++    PA  AG++ GD I+S++G+    + ++   +   P  E+ LV+  EH 
Sbjct: 132 NTNVVGSLIEGMPAQAAGIEAGDKIVSVNGVETPTWTDLTQAIHIKPDQEVVLVV--EHQ 189

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
           GV     +   +D     G+      VGIS    E      T+L++   GL++  + TR 
Sbjct: 190 GVQRALTIGTQKDPASGNGL------VGIS---PEVVYQKTTLLEAARYGLEQTINFTRL 240

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
            L  L+     +T+  ++ GPV I +      + G+  Y+ F+ + S  +G +NL PIP 
Sbjct: 241 ILVTLTQMITGETK-AELGGPVAIVQAIDQSAESGWENYLGFIGILSIQLGLLNLFPIPA 299

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           LDG HL+  L+E +RGK +       I  +G   ++ L       DI  L
Sbjct: 300 LDGSHLVFLLIEGLRGKPMNPERQNFIHFLGFVFLMCLMLAVTYQDILKL 349


>gi|255524234|ref|ZP_05391193.1| membrane-associated zinc metalloprotease [Clostridium
           carboxidivorans P7]
 gi|255512059|gb|EET88340.1| membrane-associated zinc metalloprotease [Clostridium
           carboxidivorans P7]
          Length = 336

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/329 (32%), Positives = 162/329 (49%), Gaps = 20/329 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE---KD 77
           HE GH+ +A+L  I+V  F++G GP++  I  +  V + + ++P+GGYV    DE    D
Sbjct: 17  HELGHFTLAKLNGIKVEEFAIGMGPQIFKINRKETV-YSIRILPIGGYVKMLGDEGESTD 75

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
            R+F   +P +K+  VLAGP+ N ++ I+ F       G + P+V  V P  PAA+ G+K
Sbjct: 76  PRAFNNKSPLRKLSVVLAGPVMNFILGIVLFAIIAAGKGYLSPIVDKVVPNQPAAVMGLK 135

Query: 138 KGDCIISLDGITVSAFEE--VAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRF 195
            GD I+ ++G  +  +E+     Y       +I+ V   E   V   KV P      +RF
Sbjct: 136 SGDKIVKVNGSKILTWEDFVTGVYTSAGKTMDITYVRNGETKSV---KVTPVKDPKENRF 192

Query: 196 GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQI 255
                   VG+      T +   T+ QS S G  E +S+ +     L SAF      N  
Sbjct: 193 -------IVGVY----PTAVEKPTMGQSISYGFTETNSLVKQTFSFLKSAFKGKVSKNDF 241

Query: 256 SGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKS 315
            GPV I +++      G  A  AF A  +  +G  NLLPIP LDGG++  FL E+I GK 
Sbjct: 242 GGPVTIIKLSGAAAKAGILALTAFGAYITVQLGIFNLLPIPALDGGYIFLFLFELITGKK 301

Query: 316 LGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +  +   VI  +G  +++ L  L    DI
Sbjct: 302 VDQNKVGVINYVGFALLMGLMVLVTIKDI 330


>gi|282850154|ref|ZP_06259533.1| RIP metalloprotease RseP [Veillonella parvula ATCC 17745]
 gi|282579647|gb|EFB85051.1| RIP metalloprotease RseP [Veillonella parvula ATCC 17745]
          Length = 338

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/345 (29%), Positives = 181/345 (52%), Gaps = 31/345 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +IV IHE GH++ A++  ++V  F++GFGP +  +  +    + + +IPLGG+      +
Sbjct: 13  LIVFIHELGHFITAKMSGMQVDEFAIGFGPAIFKV-QKGETLYSIRIIPLGGFNRIAGMT 71

Query: 73  EDEK-DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM----KPVVSNVSP 127
            DE  + RSF+    WKK + + AG + N ++AI+ F       G +    +PV+ N+  
Sbjct: 72  PDEPLNERSFYNKPAWKKFIVISAGAVFNFILAIVLFFGLNVTVGNLTYTNEPVIGNIIA 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            S A  A ++  D II++DG  +S ++++ P ++    H++++V+ RE    +   V+P+
Sbjct: 132 GSSAEQAHLEANDRIITIDGKKISTWDDIRPSLQGTANHDVTVVVEREG-KTIETTVIPK 190

Query: 188 LQDTVDRFGI----KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
           ++    + GI     R+  S+G S S             + SR    I ++  G   ++ 
Sbjct: 191 MEQDSPKIGIYPSFTRETYSIGESLSL------------AVSRTGQTIVAMVSGIYDMI- 237

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               + T+  ++SGPVGI+++A      GF   ++F A  S  +G +NLLP+P+LDGGHL
Sbjct: 238 ----RGTQAAELSGPVGISQMAGAIAQSGFAPLLSFAAFLSINLGVINLLPLPVLDGGHL 293

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           I  L E I G+ L       I  +G+ +++ LF      DI+ L+
Sbjct: 294 IIILAEAITGRRLPAKALMYIQMVGVALMVALFLYVTTQDIFRLL 338


>gi|224368824|ref|YP_002602985.1| membrane-associated zinc metalloprotease [Desulfobacterium
           autotrophicum HRM2]
 gi|223691540|gb|ACN14823.1| membrane-associated zinc metalloprotease [Desulfobacterium
           autotrophicum HRM2]
          Length = 356

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 189/358 (52%), Gaps = 39/358 (10%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPEL----IGITSRSGVRWKVSLIPL 65
           + V L +++  HE GH++VAR   + V +FS+GFGP++    IG+T      + +S+IPL
Sbjct: 8   FVVVLGVLIFFHELGHFLVARFFGVGVETFSLGFGPKIYRKKIGLT-----EYCLSIIPL 62

Query: 66  GGYVSF-SED------EKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG- 116
           GGYV    ED      +KD   SF     ++K L V AGP+ N V+A+L F   F  +G 
Sbjct: 63  GGYVKMVGEDPSTQIPDKDRSLSFTHKRLYQKSLIVAAGPIFNFVLAVLIFYVLFQVSGS 122

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
             ++PVV  V+  SPA  AGVK GD I ++DG+ V +++E+   +  +   ++  ++ R 
Sbjct: 123 YYVRPVVGTVADDSPALSAGVKPGDLITAIDGVAVESWDEMVALIGNSRAEKLDFLINRS 182

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSR-----TVLQSFSRGLDE 230
               L++ ++P      + FG   + P +GIS + D   +H R      ++QSF R  + 
Sbjct: 183 G-QTLNIPIVPEQTTATNIFGESIKKPMIGISSAGD--VVHERLNPVEALVQSFVRTWEI 239

Query: 231 IS----SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
           I     S+ + F G +S+          + GP+ IA++A    + G      F+AM S  
Sbjct: 240 IKLTLLSVGKIFTGSVSA--------KSLGGPIMIAQMAGQQAEAGMANLAFFIAMLSIN 291

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +G +NL P+P+LDGGHL+ F LE + GK  G  +     + G+ ++L L      NDI
Sbjct: 292 LGIINLFPVPVLDGGHLLFFGLEALTGKPAGERLRERANQFGIVLLLTLMVFVFYNDI 349


>gi|89895284|ref|YP_518771.1| hypothetical protein DSY2538 [Desulfitobacterium hafniense Y51]
 gi|89334732|dbj|BAE84327.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 363

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 173/350 (49%), Gaps = 31/350 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---- 71
           ++V+IHE GH++VARL  I+VL F+ GFGP++IG   +    + + LIPLGG+V      
Sbjct: 22  LLVMIHELGHFIVARLNGIKVLEFAFGFGPKIIGFQGKE-TAYSLRLIPLGGFVKLYGMD 80

Query: 72  -SEDEK---------DMRSFFCAAPWKKILTVLAGPLANCVMAI----LFFTFFFYNTGV 117
              DE          D RSF     W+++  + AGP+ N V+AI    + F +F   T  
Sbjct: 81  AETDENGNQVLAATTDPRSFGNKKVWQRMSVIAAGPIMNLVLAIFLFMIVFAYFGIATAT 140

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
              VV ++    PA  AG++ GD I+S++G+    + ++   +   P  E+ LV+  EH 
Sbjct: 141 NTNVVGSLVEGMPAQAAGIEAGDKIVSVNGVETPTWTDLTQAIHIKPDQEVVLVV--EHQ 198

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
           GV     +   +D     G+      VGIS    E      T+L++   GL++  + TR 
Sbjct: 199 GVQRALTIGTQKDPASGNGL------VGIS---PEVIYQKTTLLEAARYGLEQTINFTRL 249

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
            L  L+     +T+  ++ GPV I +      + G+  Y+ F+ + S  +G +NL PIP 
Sbjct: 250 ILVTLTQMITGETK-AELGGPVAIVQAIDQSAESGWENYLGFIGILSIQLGLLNLFPIPA 308

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           LDG HL+  L+E +RGK +       I  +G   ++ L       DI  L
Sbjct: 309 LDGSHLVFLLIEGLRGKPMNPERQNFIHFLGFVFLMCLMLAVTYQDILKL 358


>gi|294793667|ref|ZP_06758804.1| RIP metalloprotease RseP [Veillonella sp. 3_1_44]
 gi|294455237|gb|EFG23609.1| RIP metalloprotease RseP [Veillonella sp. 3_1_44]
          Length = 338

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/345 (29%), Positives = 181/345 (52%), Gaps = 31/345 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +IV IHE GH++ A++  ++V  F++GFGP +  +  +    + + +IPLGG+      +
Sbjct: 13  LIVFIHELGHFITAKMSGMQVDEFAIGFGPAIFKV-QKGETLYSIRIIPLGGFNRIAGMT 71

Query: 73  EDEK-DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM----KPVVSNVSP 127
            DE  + RSF+    WKK + + AG + N ++AI+ F       G +    +PV+ N+  
Sbjct: 72  PDEPLNERSFYNKPAWKKFIVISAGAVFNFILAIVLFFGLNVTVGNLTYTNEPVIGNIIA 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            S A  A ++  D II++DG  +S ++++ P ++    H +++V+ RE    +   V+P+
Sbjct: 132 GSSAEQAHLEANDRIITIDGKKISTWDDIRPSLQGTANHGVTVVVEREG-KTIETTVIPK 190

Query: 188 LQDTVDRFGI----KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
           ++    + GI     R+  S+G S S             + SR    I ++  G   ++ 
Sbjct: 191 MEQDSPKIGIYPSFTRETYSIGESLSL------------AVSRTGQTIVAMVSGIYDMI- 237

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               + T++ ++SGPVGI+++A      GF   ++F A  S  +G +NLLP+P+LDGGHL
Sbjct: 238 ----RGTQVAELSGPVGISQMAGTIAQSGFAPLLSFAAFLSINLGVINLLPLPVLDGGHL 293

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           I  L E I G+ L       I  +G+ +++ LF      DI+ L+
Sbjct: 294 IIILAEAITGRRLPAKALMYIQMVGVALMVALFLYVTTQDIFRLL 338


>gi|313893422|ref|ZP_07826994.1| RIP metalloprotease RseP [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313442063|gb|EFR60483.1| RIP metalloprotease RseP [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 338

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 179/345 (51%), Gaps = 31/345 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +IV IHE GH++ A++  ++V  F++GFGP +  +  +    + + +IPLGG+      S
Sbjct: 13  LIVFIHELGHFITAKMSGMQVDEFAIGFGPAIFKV-QKGETLYSIRIIPLGGFNRIAGMS 71

Query: 73  EDEK-DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM----KPVVSNVSP 127
            DE  + RSF+    WKK + + AG + N ++AI+ F       G +    +PV+ N+  
Sbjct: 72  PDEPLNERSFYNKPAWKKFIVISAGAVFNFLLAIVIFFGLNVTVGNLTYTNEPVIGNIIS 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            S A  A +K  D II++DG  ++ ++E+ P ++    H +++V+ R+   V    V+P+
Sbjct: 132 GSAAEQAHLKANDRIITIDGKKITTWDEIRPSLQGTANHGVTVVVERDGQSV-ETTVIPK 190

Query: 188 LQDTVDRFGI----KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
            +    + GI     R+  S+G S S             + SR    I ++  G   +L 
Sbjct: 191 YEQDSVKIGIYPSFTRETYSIGESLSL------------AVSRTGQTIVAMVSGLYDML- 237

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               + T+  ++SGPVGI+++A      GF   ++F A  S  +G +NLLP+P+LDGGHL
Sbjct: 238 ----RGTQAAELSGPVGISQMAGTIAQSGFAPLLSFAAFLSINLGVINLLPLPVLDGGHL 293

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           I  L E I G+ L       I  +G+ +++ LF      DI+ L+
Sbjct: 294 IIILAEAITGRRLPAKALMYIQMVGVALMVALFLYVTTQDIFRLL 338


>gi|303245797|ref|ZP_07332080.1| membrane-associated zinc metalloprotease [Desulfovibrio
           fructosovorans JJ]
 gi|302493060|gb|EFL52925.1| membrane-associated zinc metalloprotease [Desulfovibrio
           fructosovorans JJ]
          Length = 359

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 107/342 (31%), Positives = 170/342 (49%), Gaps = 20/342 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           ++  HE GH++ AR   + V +FS+GFGP+L+G T R   R+++S IPLGGYV     + 
Sbjct: 15  LIFFHELGHFLAARTFGMGVATFSLGFGPKLLGFT-RGKTRYQLSAIPLGGYVQLVGQDP 73

Query: 77  D---------MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNV 125
           D            F     W++++ V AGPL N  +A L F       G   M PVV  V
Sbjct: 74  DDPIPDGFAPHEEFKLRPAWQRMIVVAAGPLFNFFLAWLLFWCLLVAEGRFEMLPVVGQV 133

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
              SPA  AG+  GD I +++G  V+ ++E+A  +R      ++L + R+    L   + 
Sbjct: 134 QADSPAEQAGITAGDTITAINGAPVANWDEMARSIRGGGGKPVALTVRRDGKD-LTFTLT 192

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKL---HSRTVLQSFSRGLDEISSITRGFLGVL 242
           P ++   + FG K   P VGI  S     +         ++  +  D ++    G L ++
Sbjct: 193 PVMRTIKNLFGEKESAPLVGIVASGKTRAVPMGAGSAAGEAVRQTWDVVAVTYTGLLKLI 252

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
                +   L+ + GP+ IA++       G    +A  A+ S  +G +NLLPIP+LDGGH
Sbjct: 253 E----RVVPLDSLGGPIMIAQMVSKQAAEGIGNVVALAALISVNLGVLNLLPIPVLDGGH 308

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L+ + LE+I  K +   +  + TR+GL  ++ L  L   NDI
Sbjct: 309 LLFYTLEIIMRKPVSPRMRALTTRLGLAFLIALMLLATVNDI 350


>gi|269797925|ref|YP_003311825.1| membrane-associated zinc metalloprotease [Veillonella parvula DSM
           2008]
 gi|294791806|ref|ZP_06756954.1| RIP metalloprotease RseP [Veillonella sp. 6_1_27]
 gi|269094554|gb|ACZ24545.1| membrane-associated zinc metalloprotease [Veillonella parvula DSM
           2008]
 gi|294457036|gb|EFG25398.1| RIP metalloprotease RseP [Veillonella sp. 6_1_27]
          Length = 338

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/345 (29%), Positives = 180/345 (52%), Gaps = 31/345 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +IV IHE GH++ A++  ++V  F++GFGP +  +  +    + + +IPLGG+      +
Sbjct: 13  LIVFIHELGHFITAKMSGMQVDEFAIGFGPAIFKV-QKGETLYSIRIIPLGGFNRIAGMT 71

Query: 73  EDEK-DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM----KPVVSNVSP 127
            DE  + RSF+    WKK + + AG + N ++AI+ F       G +    +PV+ N+  
Sbjct: 72  PDEPLNERSFYNKPAWKKFIVISAGAVFNFILAIVLFFGLNVTVGNLTYTNEPVIGNIIA 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            S A  A ++  D II++DG  +S ++++ P ++    H +++V+ RE    +   V+P+
Sbjct: 132 GSSAEQAHLEANDRIITIDGKKISTWDDIRPSLQGTANHGVTVVVEREG-QTIETTVIPK 190

Query: 188 LQDTVDRFGI----KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
           ++    + GI     R+  S+G S S             + SR    I ++  G   ++ 
Sbjct: 191 MEQDSPKIGIYPSFTRETYSIGESLSL------------AVSRTGQTIVAMVSGIYDMI- 237

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               + T+  ++SGPVGI+++A      GF   ++F A  S  +G +NLLP+P+LDGGHL
Sbjct: 238 ----RGTQAAELSGPVGISQMAGTIAQSGFAPLLSFAAFLSINLGVINLLPLPVLDGGHL 293

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           I  L E I G+ L       I  +G+ +++ LF      DI+ L+
Sbjct: 294 IIILAEAITGRRLPAKALMYIQMVGVALMVALFLYVTTQDIFRLL 338


>gi|88606695|ref|YP_505742.1| putative membrane-associated zinc metalloprotease [Anaplasma
           phagocytophilum HZ]
 gi|88597758|gb|ABD43228.1| putative membrane-associated zinc metalloprotease [Anaplasma
           phagocytophilum HZ]
          Length = 362

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 186/367 (50%), Gaps = 39/367 (10%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F++  FLL    L ++V IHE+GHY VA+LC ++V +FS+GFGPEL GIT  SG RWK S
Sbjct: 16  FYVASFLLV---LSVVVFIHEYGHYCVAKLCKVKVETFSLGFGPELFGITDGSGTRWKFS 72

Query: 62  LIPLGGYV---------SFSEDEKDMRSFFCAAP----WKKILTVLAGPLANCVMAILFF 108
           L+P+GGYV           SE+EK      CA      W++ L   AGP AN + ++L F
Sbjct: 73  LVPVGGYVKMFGDALDREMSEEEK-----LCALNEKPLWQRFLIAFAGPAANLLFSLLVF 127

Query: 109 TFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
              F   GV+   PVV NV   S A + G++ GD I+S+DG  V+ FEE+  Y+      
Sbjct: 128 FVLFSTRGVLSPMPVVGNVLAGSTAELVGLEAGDRIVSIDGNEVAWFEEIRHYIAGGQGE 187

Query: 167 EISLVLYREHVGVL-HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT--VLQS 223
            +++   R   GVL H+ + P    +  R         +GIS S       SR   VL +
Sbjct: 188 YLTIGFLRS--GVLHHVTIGPEEWSSGAR--------KLGISASSLPMDSQSRRLPVLSA 237

Query: 224 FSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMF 283
            +        I +  L  +         ++++ GPV IA+ + +         + F+ + 
Sbjct: 238 ANEAFLCTYRIVKITLMAVVQLVTGSRSVDELGGPVRIAKHSGDAIRQ--KEGLRFVGLI 295

Query: 284 SWAIGFMNLLPIPILDGGHLITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
           S  +G +NLLP+P+LDGG ++ + L+ I R K+       ++  +G  +++ L      N
Sbjct: 296 SANLGVINLLPLPMLDGGFMLQYALQGIFRRKTFNPRHCSIVMVVGFILLVSLMVFVTFN 355

Query: 343 DIYGLMQ 349
           D+  +++
Sbjct: 356 DVKSILK 362


>gi|283853576|ref|ZP_06370814.1| membrane-associated zinc metalloprotease [Desulfovibrio sp.
           FW1012B]
 gi|283571038|gb|EFC19060.1| membrane-associated zinc metalloprotease [Desulfovibrio sp.
           FW1012B]
          Length = 359

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 108/358 (30%), Positives = 180/358 (50%), Gaps = 26/358 (7%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           ++  L   + L  ++  HE GH++ AR   + V++FS+GFGP+L G T R   R+ +S I
Sbjct: 2   IESILAVALVLGGLIFFHELGHFLAARAFGMGVVTFSLGFGPKLFGFT-RGATRYVLSAI 60

Query: 64  PLGGYVSFSEDEKD---------MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN 114
           PLGGYV     + D            F     W++++ V AGP+ N ++A L F      
Sbjct: 61  PLGGYVQLVAQDPDDPVPDGFPPEAQFRLRPAWQRMIVVAAGPVFNFLLAWLLFWGLLVA 120

Query: 115 TG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
            G   M PVV  V   SPA +AG+K GD ++ ++G+ V+ ++ +A  +R      ++L +
Sbjct: 121 EGRFEMLPVVGQVQKDSPAEVAGIKAGDTVLDVNGVPVANWDALATAIRGGGGKAVTLTV 180

Query: 173 YREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
            RE  G     + P ++   + FG +   P VGI  S       +RTV      GL    
Sbjct: 181 SREG-GQETFSLTPAMRTVKNLFGEEESAPLVGIVASG-----KTRTV--PLGPGLAAGE 232

Query: 233 SITRGFLGVLSSAFG------KDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
           ++ + +  V+ +  G      +   L+ + GP+ IA++       G    +A  A+ S  
Sbjct: 233 AVHQTWNVVVVTYTGLLKLIERVVPLDSLGGPIMIAQMVSKQASEGLGNVVALAALISVN 292

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +G +NLLPIP+LDGGHL+ + +EM+  + +   +  + T++GL  ++ L  L   NDI
Sbjct: 293 LGVLNLLPIPVLDGGHLLFYAIEMVMRRPVSPRMRALTTKLGLAFLIGLMILATVNDI 350


>gi|83858381|ref|ZP_00951903.1| membrane-associated zinc metalloprotease, putative [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853204|gb|EAP91056.1| membrane-associated zinc metalloprotease, putative [Oceanicaulis
           alexandrii HTCC2633]
          Length = 397

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 121/387 (31%), Positives = 173/387 (44%), Gaps = 46/387 (11%)

Query: 3   WLDCFLLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRW 58
           WL    L   + I++    V+IHE GHY   R+C +   +FS+GFGP L   T R G  W
Sbjct: 4   WLGSGTLSIFAFILVMGFVVIIHELGHYWAGRMCGVHADAFSMGFGPTLFSRTDRLGTVW 63

Query: 59  KVSLIPLGGYVSFSEDEK------------------DMRSFFCAAP-WKKILTVLAGPLA 99
           KVS +PLGG+V F  D                    D  S     P  ++   V AGPLA
Sbjct: 64  KVSALPLGGFVQFRGDANAASAPDYETLEELRREHPDPDSVLHFKPVGQRAFIVAAGPLA 123

Query: 100 NCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA 157
           N ++AI+ F       G   ++P+V  V   SPA  AG + GD ++ +D   +  F ++ 
Sbjct: 124 NFLLAIVLFAILGVVQGESRLEPLVGEVMEDSPAQQAGFQPGDVVVRMDNTPIEGFTDMT 183

Query: 158 PYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD-ETKLH 216
            YV       IS+ + R    VL L V P      D  G +R + ++GI  S + E  ++
Sbjct: 184 EYVVTRAGQPISVTVERNGERVL-LTVTPARVMRDDNLGGERPLGTIGIRSSTEAERVIY 242

Query: 217 SRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFF-----DH 271
              + ++   G+      T   +  LS           I+GPVGIA  A         D+
Sbjct: 243 RPAIWEAPIYGVTRTVDTTGTIVSYLSRLVTGRASTEHINGPVGIATTAGQLANLAVSDN 302

Query: 272 GFNAYIAFL--------------AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLG 317
           G    I  L              A+ S  +G MNLLPIP+LDGGHL+ +  E I  +   
Sbjct: 303 GAAQPIGLLVRLERLLIVMIALSALLSVGLGLMNLLPIPVLDGGHLVYYAYEAIAKRPPS 362

Query: 318 VSVTRVITRMGLCIILFLFFLGIRNDI 344
            SV  +  R+GL  IL +F +   ND+
Sbjct: 363 PSVQELGFRLGLGFILAMFVVATWNDL 389


>gi|282882079|ref|ZP_06290720.1| RIP metalloprotease RseP [Peptoniphilus lacrimalis 315-B]
 gi|281298109|gb|EFA90564.1| RIP metalloprotease RseP [Peptoniphilus lacrimalis 315-B]
          Length = 335

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 103/334 (30%), Positives = 174/334 (52%), Gaps = 19/334 (5%)

Query: 15  IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-E 73
           +++V++HEFGH+ VA+L  I+V  FSVG GP++   T +   ++ +  +P+GGYV+   E
Sbjct: 12  LLVVLLHEFGHFSVAKLVGIKVNEFSVGMGPKIFQKT-KGETKYSLRALPIGGYVAMEGE 70

Query: 74  DEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPA 131
           DE+  D RSF   + +K++  VLAG   N ++AI  F   FY  G    ++  V   SPA
Sbjct: 71  DEESFDPRSFNNVSVFKRMAVVLAGVTMNFILAIFCFFILFYFIGFGSNIIDTVIKDSPA 130

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDT 191
             AG+ KGD I+ ++ +      ++   + +N   E++L + R +  + + K+MP+    
Sbjct: 131 DAAGLTKGDKIVGVNYVRTDNLNDIVEEISKNNGKELNLNILRNNESI-NKKIMPKFSKE 189

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
            +R+ I            +  T+   R+ L SFS    +   + +    V S        
Sbjct: 190 ENRYII-----------GFSSTR--QRSFLGSFSLAFKQTGDVVKAIFSVFSLIRDGKFT 236

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
            + ISGP+G+  I       GF   +  LA+ S  +G MNL+PIP LDGG  +  ++E I
Sbjct: 237 SDMISGPIGVISIIGQETSKGFLYLVQILAIISANLGVMNLIPIPGLDGGKFLLLIIESI 296

Query: 312 RGKSLGVSVTRVITRMGLCIIL-FLFFLGIRNDI 344
           RGK++   +   +T +G  I+L  + ++ I ND+
Sbjct: 297 RGKAISEKLEMKLTMIGYGILLTLMIYVTIFNDL 330


>gi|317051933|ref|YP_004113049.1| membrane-associated zinc metalloprotease [Desulfurispirillum
           indicum S5]
 gi|316947017|gb|ADU66493.1| membrane-associated zinc metalloprotease [Desulfurispirillum
           indicum S5]
          Length = 355

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 106/337 (31%), Positives = 179/337 (53%), Gaps = 18/337 (5%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSF------SE 73
           HE GH++VA+ C + V  FS+GFG +L+  + R G   +++S+IPLGGYV          
Sbjct: 17  HELGHFLVAKACKVGVEVFSIGFGRKLL--SFRHGETEYRLSMIPLGGYVKMMGESLEGA 74

Query: 74  DEK----DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSP 127
           DE+      +SF   + W+++  V AGPL N ++AI+  +    N GV  ++P++  V P
Sbjct: 75  DEQAAVPHEKSFAHKSVWQRMAIVAAGPLFNFLLAIVLLSLVHIN-GVPRLEPIIGTVQP 133

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            S A  AG++ GD II+++ + +  ++++   +   P      V+   +  +   ++ PR
Sbjct: 134 DSAAYAAGLQPGDRIITINDMEIHFWDDITRQIHLLP-GVEVRVVVERNDQLASFQITPR 192

Query: 188 LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFG 247
            +   + FG  R+V  +GI+ S ++T       LQS   G+     +T      +     
Sbjct: 193 QRTVQNIFGEDREVGFIGITAS-EQTVNVRYGPLQSLGMGVVRTWELTSLTFQSIVKLIQ 251

Query: 248 KDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFL 307
           +    + I GP+ I ++A     HGFN+ + F A+ S  +  +NLLPIPILDGGHL+ ++
Sbjct: 252 RIIPADNIGGPIMIVQVASEQVSHGFNSVLFFAALISVNLAILNLLPIPILDGGHLMFYI 311

Query: 308 LEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            E IRGK+  +    +  R+G+ ++L L F    NDI
Sbjct: 312 YEAIRGKAPSLKAREIAARIGMALLLCLMFFAFYNDI 348


>gi|297717848|gb|ADI50067.1| membrane-associated zinc metalloprotease [Candidatus Odyssella
           thessalonicensis L13]
          Length = 377

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 182/366 (49%), Gaps = 36/366 (9%)

Query: 3   WLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           +L  FLL    L ++V IHE GHY+VAR   +++  FS+GFGPE+ G T ++  RWK SL
Sbjct: 11  YLPPFLLV---LTVLVFIHELGHYLVARWNGVKIEVFSIGFGPEIFGWTDKANTRWKFSL 67

Query: 63  IPLGGYVSFSED-----------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAI 105
           IPLGGYV    D                 E+   +       ++I  V AGP+AN ++AI
Sbjct: 68  IPLGGYVKMYGDADASSKPDEAAKSTMTLEERALTLQGKTVAQRIAVVAAGPIANYLLAI 127

Query: 106 LFFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN 163
           +    F+   G     P +  +S +S A   G+  GD +++ +G  +S F+E+   +   
Sbjct: 128 VLLAAFYTFKGAPTFLPTIGGISESSVAQSIGLLPGDKVLTFNGQHISNFDELRHLIPAT 187

Query: 164 PLHEISLVLYR----EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT 219
              EI+L + R    E VG    ++  + Q   D     +   S+GI  S ++T      
Sbjct: 188 AGQEINLTVERKKSPEEVGS---EISLKGQMVKD----GQPTASLGIVPSGEQT-YKKYG 239

Query: 220 VLQSFSRGLDEISSITRGFL-GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA 278
           +L+S +  +     I+R  L G+     GK +   ++ G   IA +AK   D G+ A I 
Sbjct: 240 ILESITASVSRCYVISRETLKGIGQMLVGKRSS-EELGGLFTIASLAKQSADQGWVALIL 298

Query: 279 FLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
             A  S  +G +NLLPIP+LDGGH++ + +E IRGK + V        +GL I+L L  +
Sbjct: 299 LTAALSINLGLINLLPIPVLDGGHIVFYSIEAIRGKPVSVKAQEFAYMIGLFIVLGLMLI 358

Query: 339 GIRNDI 344
              ND+
Sbjct: 359 SNWNDL 364


>gi|153954049|ref|YP_001394814.1| protease [Clostridium kluyveri DSM 555]
 gi|219854662|ref|YP_002471784.1| hypothetical protein CKR_1319 [Clostridium kluyveri NBRC 12016]
 gi|146346930|gb|EDK33466.1| Predicted protease [Clostridium kluyveri DSM 555]
 gi|219568386|dbj|BAH06370.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 336

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 97/341 (28%), Positives = 176/341 (51%), Gaps = 16/341 (4%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           +L  ++  ++++IHE GH+++A+L  ++V  FS+G GP+L GI  +    + + L+P+GG
Sbjct: 4   ILAIIAFGVLIIIHELGHFILAKLNGVKVEEFSIGMGPKLFGIKGKE-TEYLIKLLPIGG 62

Query: 68  YVSFSEDE---KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSN 124
           YV    DE    D R+F   +  +K+  V AGP+ N ++ I+ F+      G + PVVS 
Sbjct: 63  YVKMLGDEGKSDDPRAFNNKSAVRKLSIVAAGPIMNFILGIILFSIIASARGYLSPVVSK 122

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
                PAA+AG+K GD I  ++   +S +E+    +     + I++   R+ +    + V
Sbjct: 123 TISNGPAAMAGIKSGDKITKVNDSKISTWEDFVTEIYTTAGNPINISYERKGI-TNQVNV 181

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSS 244
            P   +  +R+        VGI    + T++ + T+ QS S G+ E  S+ +       +
Sbjct: 182 TPIKDEKENRY-------IVGI----EGTQVTNPTLAQSMSYGVIETKSLIKQTFSFFKT 230

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
            F     +N + GP+ I +I+      G  + +AF A  S  +   N++P P LDGG+++
Sbjct: 231 LFKGKASMNDVGGPLTIIKISGAAAKAGILSLLAFSAYISIQLAIFNIIPFPALDGGYIL 290

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
            FL E++ G+ +  +   +I  +G  I++ L  L    DI+
Sbjct: 291 LFLFEIVTGRKVDDNKVGIINYVGFAILMALMVLVTVKDIF 331


>gi|240142158|ref|YP_002966668.1| putative membrane-associated zinc metallopeptidase
           [Methylobacterium extorquens AM1]
 gi|240012102|gb|ACS43327.1| putative membrane-associated zinc metallopeptidase
           [Methylobacterium extorquens AM1]
          Length = 364

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 108/351 (30%), Positives = 171/351 (48%), Gaps = 20/351 (5%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           Y + +  +V IHE GHY+ AR   I+ + FS+GFG  L   T   G RW    IP+GGYV
Sbjct: 11  YVLLISTVVGIHELGHYLAARALGIQPVEFSIGFGRLLFSWTDARGCRWSFRAIPMGGYV 70

Query: 70  SFSED-------------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
            F  D             ++  R+   A P  +     AGP AN V+  +  T  +   G
Sbjct: 71  KFLGDGDAASSTSVDVAPDQRRRTLAGAGPGARAAVAFAGPFANLVLTFVVLTGLYSGIG 130

Query: 117 VM--KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
            +    VV  V P S A  AG + GD I+++ G+ ++ FE++   V        ++ + R
Sbjct: 131 RLYTPTVVEGVLPGSAAEAAGFRPGDRIVAIGGVAIARFEDMQALVVARAGMPTTVEILR 190

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISS 233
               ++ L   P      D FG +R++  +G+      T +  R  V  +FS GL ++  
Sbjct: 191 GGAPIV-LTATPAAAQVEDNFGRRREIGRIGLK---GGTPVFERVPVASAFSHGLGDMIF 246

Query: 234 ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
           + R    +L      +  ++Q++GP  IA  A +    G+   +  +A FS  +G MNLL
Sbjct: 247 LARQIGQILRETVVGERPVDQLAGPARIAEAAGDAMRSGWPNLLFLVAFFSINLGLMNLL 306

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           PIPI+DGG +    +E++RG+ LG    RV+T MGL ++  L  + + ND+
Sbjct: 307 PIPIMDGGLIALCGVEVLRGRPLGERAQRVVTAMGLAMVGCLMLVVVVNDV 357


>gi|308270383|emb|CBX26995.1| hypothetical protein N47_A10240 [uncultured Desulfobacterium sp.]
          Length = 356

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 191/357 (53%), Gaps = 37/357 (10%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPEL----IGITSRSGVRWKVSLIPL 65
           + + L +++  HE GH++VARL  + V  FS+GFGP L    IGIT      + +S +PL
Sbjct: 8   FIIVLGVLIFFHELGHFLVARLFGVGVEKFSLGFGPRLFGKKIGITD-----YCISAVPL 62

Query: 66  GGYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV 117
           GGYV    +E D          SF      KKIL V AGP+ N ++A++ F   F  +G+
Sbjct: 63  GGYVKMIGEEVDSEVDPADIHLSFNHKHVLKKILIVAAGPVFNLLLAVIIFLIIFLISGI 122

Query: 118 M--KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
              KPVV NV   SPA IAG++KGD I+S++   VS++E +A ++  +   +++  + R 
Sbjct: 123 FIFKPVVGNVEKDSPARIAGLEKGDLIVSINETAVSSWENMAEFISGSNGKKLAFSIKRN 182

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFS--YDETKLHS-----RTVLQSFSRGL 228
              VL L ++P L+ T + FG      ++GI+ +  Y   KL+       ++ Q++ R +
Sbjct: 183 G-DVLKLDIVPELKITKNIFGEDTNRYAIGITSAGEYYAKKLNPVEALFESIRQTY-RIV 240

Query: 229 D-EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
           D  + S+ +   G LS+          + GP+ IA +A      G   ++ F+++ S  +
Sbjct: 241 DLTVMSVVKLIQGTLSA--------KTLGGPIMIAEMAGQQAREGAANFVFFISLISINL 292

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             +N LPIP+LDGGHL+ F +E + GK +   +  +  ++G+ I++ L      NDI
Sbjct: 293 AVLNFLPIPVLDGGHLLFFFIEALIGKPVNTKIREIAQQVGIFILIVLMIFVFYNDI 349


>gi|152992350|ref|YP_001358071.1| membrane-associated zinc metalloprotease [Sulfurovum sp. NBC37-1]
 gi|151424211|dbj|BAF71714.1| membrane-associated zinc metalloprotease [Sulfurovum sp. NBC37-1]
          Length = 350

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 179/348 (51%), Gaps = 35/348 (10%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSFSEDEK--- 76
           HE GH+  AR   +++  FS+GFG  L   T + G   W +S IPLGGYV     +    
Sbjct: 17  HELGHFTAARFFGVQIDVFSIGFGKRLW--TKKIGKTEWSISAIPLGGYVRMKGQDDTDP 74

Query: 77  -----DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNVSPAS 129
                D  S+    PW++I+ +LAGP AN +MA L +    Y  GV K  P V  V+  S
Sbjct: 75  TKVSYDEDSYNTKKPWQRIVILLAGPFANFLMAFLLYLAIAY-MGVPKLLPYVDKVTKDS 133

Query: 130 PAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM---P 186
           PA  AG++K D I+ ++GI +  +E++   +  +   ++++++ R+H    HLK +   P
Sbjct: 134 PAYQAGLQKKDKILQINGINIRFWEDIGKQINASQ-GKLTMIIERDH----HLKTLTLKP 188

Query: 187 RLQDTVDRFG--IKRQVPSVGISFSYDETKLHSRTVLQSFSRGL----DEISSITRGFLG 240
           ++ +  + FG  +KR++  +GI+    +T     TV+  F+ G     DE    +     
Sbjct: 189 KVIEDKNVFGEMVKRRI--IGITPLPKQT-----TVIYGFTEGWKYAWDETVKASTLIFK 241

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
            +      +   +Q+ G + I  +       G  A   F A+ S  +G +NL+PIP LDG
Sbjct: 242 SVQKLITGEVSTDQLGGIITIVDVTAQASHAGILALFFFTALISVNLGVLNLMPIPALDG 301

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           GH++  L EM+RGK+   +V   +T  G  ++  L FLGI NDI+ LM
Sbjct: 302 GHIMFNLYEMLRGKAPSENVMYYMTVTGWVLLAGLMFLGIYNDIHRLM 349


>gi|313682055|ref|YP_004059793.1| membrane-associated zinc metalloprotease [Sulfuricurvum kujiense
           DSM 16994]
 gi|313154915|gb|ADR33593.1| membrane-associated zinc metalloprotease [Sulfuricurvum kujiense
           DSM 16994]
          Length = 350

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 176/340 (51%), Gaps = 17/340 (5%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK---- 76
           HE GH+  AR   + V  FS+GFG  L+     +  RW++S IPLGGYV     +     
Sbjct: 17  HELGHFAAARAFGVYVEVFSIGFGKRLVSFQWLN-TRWQISAIPLGGYVKMKGQDDLDPG 75

Query: 77  ----DMRSFFCAAPWKKILTVLAGPLANCVMAILFF-TFFFYNTGVMKPVVSNVSPASPA 131
               D  S+ C  PW++I+ +L+GPLAN  +A  FF          + PV+ NV   SPA
Sbjct: 76  AISCDTDSYNCKKPWQRIIILLSGPLANFALAWFFFYALALGGPQALSPVIGNVLHESPA 135

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR-EHVGVLH-LKVMPRLQ 189
            IAG++KGD ++S++   ++ + E++  V+ +    I  + +R E    +H L V P++ 
Sbjct: 136 NIAGLQKGDLVLSINEERITQWNEISDAVKSS----IGTLTFRIERGNTVHILTVNPKIS 191

Query: 190 DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKD 249
           +T + F    Q   +GI+ S D   L   T L + S   +E  + +      +       
Sbjct: 192 ETQNIFKETIQQRMIGIAPSGDTHTLQ-FTPLTALSYATEETYTSSLLIFQSVQKLLSGI 250

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
               ++ G V IA+I  +  ++G+ +   F A+ S  +G +NLLPIP LDGGH++  L E
Sbjct: 251 VPAKEVGGVVSIAKITADAAEYGWMSLFFFSALISVNLGVLNLLPIPALDGGHIMFNLYE 310

Query: 310 MIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           MIR K+   +V   +T  G  ++L L  LG+ NDI  LMQ
Sbjct: 311 MIRRKAPSEAVITQLTIGGWVLLLGLMSLGLYNDITRLMQ 350


>gi|254294072|ref|YP_003060095.1| peptidase M50 [Hirschia baltica ATCC 49814]
 gi|254042603|gb|ACT59398.1| peptidase M50 [Hirschia baltica ATCC 49814]
          Length = 398

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/363 (31%), Positives = 178/363 (49%), Gaps = 39/363 (10%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF-SED 74
           ++V IHE GHY   R     V SF+ GFG  +  ++ +   RW+++ +PLGG+V F  E 
Sbjct: 27  VVVTIHELGHYYAGRAFGAAVESFAFGFGKSIFEVSDKRNTRWRLNWLPLGGFVKFVGEQ 86

Query: 75  EKDM-----------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV-- 121
           E D            R +   A W++++  +AGP+AN ++AIL +   F      KP+  
Sbjct: 87  EGDNSISDNPKKPKGRYYKDLAAWQRVIVSMAGPVANFILAILIYAVIFSQG---KPLYG 143

Query: 122 ---VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178
              V NV   S A  AGV  GD I++ D   VS+  +V   V  +    + L L R    
Sbjct: 144 DVTVENVLENSAAYEAGVLDGDIIVAADDRAVSSAGDVIEAVAYSADEPVKLSLLRNGEE 203

Query: 179 VLHLKVMPRLQDTV-DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
           +  L V+PR +  + +R GI+ ++  +G+S S     +   +  ++ S G D+ +++ R 
Sbjct: 204 I-DLIVIPRREMFINERLGIEDEIGRIGVSMSSKLIAIEDVSTFEAVSLGADQTANVIRK 262

Query: 238 FLGVLSS-AFGKDTRLNQISGPVGIARIAKNFFDH-------GFNAYIA--------FLA 281
            L VL+   FGKD   +++ GP+G+  IA    D        GF   ++         +A
Sbjct: 263 TLKVLNRLIFGKDN-FDKMRGPLGMGDIADRVVDSNMKRTDIGFKERLSGTFWQMLELIA 321

Query: 282 MFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIR 341
           MFS +IGF NLLPIP+LDG   +  L E + G  + +     + R GL ++   F     
Sbjct: 322 MFSVSIGFFNLLPIPMLDGYSALLGLYETVVGSEVSLKFQEYLLRGGLAVVGVFFIAVTW 381

Query: 342 NDI 344
           NDI
Sbjct: 382 NDI 384


>gi|218887998|ref|YP_002437319.1| membrane-associated zinc metalloprotease [Desulfovibrio vulgaris
           str. 'Miyazaki F']
 gi|218758952|gb|ACL09851.1| membrane-associated zinc metalloprotease [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 354

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 112/341 (32%), Positives = 177/341 (51%), Gaps = 16/341 (4%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSF---SEDEK 76
           HE GH+++ARL  I V +FS+GFGP L G   R G   +++SL+PLGGYVS    SE+ +
Sbjct: 18  HELGHFLIARLFGIGVQTFSLGFGPRLFGW--RGGQTDYRLSLVPLGGYVSLVGESEEAE 75

Query: 77  -----DMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPA 128
                + R  F   P W+++L + AGP+ N ++A   +   F+  G   + P V  V P 
Sbjct: 76  LPEGFEKRHSFTLRPAWQRLLVIAAGPVFNLLLAWFIYWGLFWAHGQFQLAPEVGRVQPE 135

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRL 188
           SPAAIAGV  GD ++S+ G  V  +++VA  +  +   E+++ + R     L L V P +
Sbjct: 136 SPAAIAGVAPGDRVVSIGGKPVQWWDDVAGSIVASEGRELAIAIDRNGT-ALTLNVKPEV 194

Query: 189 QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGK 248
           +     FG   +   +GI  S     L       +   GLD+   +       +   F +
Sbjct: 195 RTRKTIFGEDERTWLIGIQASGRTVSLPLDGT-SAMKAGLDQTWRMIVITGQSVQKIFER 253

Query: 249 DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLL 308
              L+ + GP+ IA++       G ++ +A  A+ S  +G +NLLPIP+LDGGH+I   +
Sbjct: 254 VVPLDSVGGPIMIAQMVSEQSRQGLDSVLALTALISINLGLLNLLPIPVLDGGHIIFLTM 313

Query: 309 EMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           EM+  + +   +  + TR+GL  +L L  L   NDI   +Q
Sbjct: 314 EMVMRRPVNARLREITTRIGLAFLLALMLLATYNDIVRNLQ 354


>gi|319899038|ref|YP_004159131.1| enzyme [Bartonella clarridgeiae 73]
 gi|319403002|emb|CBI76557.1| putative enzyme [Bartonella clarridgeiae 73]
          Length = 378

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 110/335 (32%), Positives = 174/335 (51%), Gaps = 30/335 (8%)

Query: 13  SLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS 72
           ++++IV +HE GHY++ R C I+   FS+GFGP+L+    + G +W++ L  LGGYV F 
Sbjct: 28  AIVVIVFVHEIGHYLIGRWCGIKASVFSIGFGPKLLNYKDKRGTQWRLGLFLLGGYVKFV 87

Query: 73  EDEKDM-----------RSFFCAAPWKKILTVLAGPLANCVMAI--LFFTFFFYNTGVMK 119
           ED   +            SF  A  WK+ +TV AGPL N + AI  L F FFFY   V++
Sbjct: 88  EDGDGIIPSSKSSSLIHGSFMGAHAWKRAVTVFAGPLFNGLFAIVVLTFFFFFYGRVVVE 147

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR-EHVG 178
           PVV  V   SPA  AG+  GD  + +DG  + +FE++  YV    LH    + ++ E +G
Sbjct: 148 PVVGYVEKDSPAIQAGLIPGDRFVEMDGKRIESFEDLIAYV---TLHGGDPIEFKIERMG 204

Query: 179 -VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET------KLHSRTVLQSFSRGLDEI 231
            VL + + P++    D FG + +   +G+    +        + + + +  ++   ++E 
Sbjct: 205 QVLKVVITPKVIKRDDGFGNQIRSGMIGVRAPVERNNPERLDQAYKKHIYYNWVESIEES 264

Query: 232 SS-----ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
                  ITR  +   S   G      Q++GP    +IA    + GF + + F A FS  
Sbjct: 265 LKCATWIITRT-ISFFSRLIGGQGDHCQLNGPSKTFKIAWKISEAGFTSMLYFTAFFSVC 323

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVT 321
           IGF+NL P+P LDGGHL+ ++ E + GK +   + 
Sbjct: 324 IGFINLFPLPPLDGGHLLLYITEAMIGKPVPAKIQ 358


>gi|222085863|ref|YP_002544394.1| zinc metallopeptidase protein [Agrobacterium radiobacter K84]
 gi|221723311|gb|ACM26467.1| zinc metallopeptidase protein [Agrobacterium radiobacter K84]
          Length = 557

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 127/226 (56%), Gaps = 20/226 (8%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F  +  + +   L ++V +HE GHY+V R   IR+++FS+GFGPE+ G T R G RWK+S
Sbjct: 10  FLTNNVITFVFVLSLLVFVHEMGHYLVGRWSGIRIMAFSIGFGPEIAGFTDRHGTRWKLS 69

Query: 62  LIPLGGYVSF--SED---------------EKDMRSFFCAAPWKKILTVLAGPLANCVMA 104
           LIPLGGYV F   ED               E+  +SF  A  WK+  TV AGP+AN ++A
Sbjct: 70  LIPLGGYVRFFGDEDASSKTDTDQLAAMTEEERAQSFAGAKLWKRAATVAAGPIANFILA 129

Query: 105 ILFFTFFF--YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           I  F   F  Y   V  PVV+ V+    AA AG++ GD ++++DG  ++ F+EV  YV  
Sbjct: 130 IAIFAVLFGAYGRTVADPVVAMVTRGGAAAEAGIEPGDRLVAIDGNKIATFDEVQRYVGM 189

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF 208
            P   I L + R+        +MP+L +  D+FG K ++  +GI+ 
Sbjct: 190 RPGRNIVLSVERDGQ-KRDFNIMPKLAEDTDQFGNKMEMGRIGIAL 234



 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 128/230 (55%), Gaps = 5/230 (2%)

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           + P+V+ ++  SPAA AG+  GD I+S+DG  + +  EV  YV      + ++VL  +H 
Sbjct: 325 VDPLVATIAQDSPAAGAGITLGDRILSVDGRAIGSIGEVQRYVASR--ADKAVVLSVQHD 382

Query: 178 GVLH-LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTV--LQSFSRGLDEISSI 234
           GV   +KV P++    D FG + +  S+GIS      KL  +    LQ+ S G+ +  +I
Sbjct: 383 GVTRDVKVTPKMAAEPDAFGNETETGSIGISDGQKPIKLRYQAYGPLQALSEGVKQTGNI 442

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
             G    L +  G   + +Q+ GP+ +A+++      GF+A + F A+ S +IG +NL+P
Sbjct: 443 ISGTFEYLGNVIGGYMKADQLGGPIRVAQLSGQMATLGFSAVLQFAAILSVSIGLLNLMP 502

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +P+LDGGHL+ + +E +RGK LG     +  R+G  ++L L      NDI
Sbjct: 503 VPVLDGGHLMFYAIEAVRGKPLGARAQDIAFRIGFAMVLSLMVFATWNDI 552



 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           ++ P V+ V P  PAA AG++ GD ++++DG  V+ + ++  Y+ + P   + L + R  
Sbjct: 234 LVDPQVTAVEPGGPAARAGIQAGDRLVAVDGNNVATYYDIVRYIGDRPGKSVVLTVERNG 293

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGIS 207
             +    ++P      D  G K+ V SVGIS
Sbjct: 294 Q-IRDFPMVPAALAETDSSGNKKDVGSVGIS 323


>gi|320352949|ref|YP_004194288.1| site-2 protease [Desulfobulbus propionicus DSM 2032]
 gi|320121451|gb|ADW16997.1| site-2 protease [Desulfobulbus propionicus DSM 2032]
          Length = 361

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/361 (28%), Positives = 190/361 (52%), Gaps = 20/361 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           ++  L + + L +++ +HE GH+++A+   +RVL FS+GFG +L+G        + +S  
Sbjct: 1   MNSVLSFILVLGVLIFVHELGHFLLAKAFGVRVLKFSLGFGNKLVG-KKWGETEYLISAF 59

Query: 64  PLGGYVSFSEDEKD--------MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT 115
           PLGGYV    ++++         RSF     W++   V  GPL N + A+  F   F   
Sbjct: 60  PLGGYVKMYGEQQEEEVLPEDRHRSFSHKPVWQRFGIVFGGPLFNLLFAVGLFFLLFVVA 119

Query: 116 GVMKPV----VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV 171
           G+ +PV    +  V+P S AA AG+K GD ++S++G   +++E V+  +R++  +E++LV
Sbjct: 120 GMPEPVDSTKIGEVNPESAAAQAGLKAGDAVLSINGKPTTSWEHVSEAIRDSQGNEVTLV 179

Query: 172 LYREHVGVLHLKVMPRLQDTVDRFG-IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
           + RE    L +   P +++  + FG    +   +GI  S +E +    ++ +S    +  
Sbjct: 180 VLREG-QELTIGAKPTIREVKNLFGETTGERYMLGIVRS-EEIRYVDASIAESAKAAV-- 235

Query: 231 ISSITRGFLGVLS--SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           + +   G+L V+       +    +++ GP+ IA +A    + G+   + F+ + S  +G
Sbjct: 236 VQTWNLGYLTVMGIVKMIQRVIPASELGGPIRIAELAGQQLEAGWMNLLYFMGLLSVNLG 295

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            +NLLPIP+LDGGHL+   LE +R + L      +  R+G+ I+  L      NDI  L+
Sbjct: 296 ILNLLPIPVLDGGHLVFLSLEAVRRRPLSERTMEISQRVGIAILGTLMIFVFYNDILRLV 355

Query: 349 Q 349
           +
Sbjct: 356 K 356


>gi|58040248|ref|YP_192212.1| putative membrane metalloprotease [Gluconobacter oxydans 621H]
 gi|58002662|gb|AAW61556.1| Putative membrane metalloprotease [Gluconobacter oxydans 621H]
          Length = 366

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 113/358 (31%), Positives = 176/358 (49%), Gaps = 27/358 (7%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L Y + L I+V IHE GHY+ AR   ++V +FS+GFGP L     RSG  W++S I
Sbjct: 5   LRTILAYVLILGILVFIHELGHYLAARWRGVKVDTFSIGFGPALHRWHDRSGTEWRISAI 64

Query: 64  PLGGYV-----SFSEDEKDM--------RSFFCAAPWKKILTVLAGPLANCVMAILFFTF 110
           PLGG+V        ED  D         R+F       + + +L GP+ N + AIL FT 
Sbjct: 65  PLGGFVKPHGFEGPEDATDEQKAAWIPGRTFHDKPVGSRAIVILMGPVFNFIFAILAFTV 124

Query: 111 FFYNTGVMKPV----VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
            F   G  KP     +S V+  SPA  AGVK GD I  +    +   E+V   V  +P  
Sbjct: 125 LFAVVG--KPEIHGDISQVTAGSPADRAGVKPGDVITRIGNTHILGVEDVMATVASHPGQ 182

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
           +  L ++R   G   L  +P   DT+   G    + S+G++F+    +    ++  +F  
Sbjct: 183 QTVLGIHR---GTEDLS-LPVTLDTLKNGG--HDMGSLGVAFAISRGR--PVSLPSAFIM 234

Query: 227 GLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
           G+ E    +   L  +           ++ G + IA+++     +G  + I+F+A+ S  
Sbjct: 235 GMQETWDKSVMTLQGVWQILSGQRSAKELGGTIRIAQLSGQVASYGLASIISFMALLSIN 294

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +G +NL PIP+LDGG L+ ++ E IRG+ +   V  V  ++G+ +I  LF     ND+
Sbjct: 295 LGLINLFPIPVLDGGRLVFYVCEAIRGRPVSRRVQEVSMQVGMALIGALFLFSTVNDL 352


>gi|300813725|ref|ZP_07094045.1| RIP metalloprotease RseP [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300512182|gb|EFK39362.1| RIP metalloprotease RseP [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 335

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/334 (30%), Positives = 173/334 (51%), Gaps = 19/334 (5%)

Query: 15  IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-E 73
           +++V++HEFGH+ VA+L  I+V  FSVG GP++   T +   ++ +  +P+GG+V+   E
Sbjct: 12  LLVVLLHEFGHFSVAKLVGIKVNEFSVGMGPKIFQKT-KGETKYSLRALPIGGFVAMEGE 70

Query: 74  DEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPA 131
           DE+  D RSF   + +K++  VLAG   N ++AI  F   FY  G    ++  V   SPA
Sbjct: 71  DEESFDPRSFNNVSVFKRMAVVLAGVTMNFILAIFCFFILFYFIGFGSNIIDTVIKDSPA 130

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDT 191
             AG+ KGD I+ ++ +      ++   + +N   E++L + R +  + + K+MP+    
Sbjct: 131 DAAGLTKGDKIVGVNYVRTDNLNDIVEEISKNNGKELNLNILRNNESI-NKKIMPKFSKE 189

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
            +R+ I            +  T+   R+ L SFS    +   + +    V S        
Sbjct: 190 ENRYII-----------GFSSTR--QRSFLGSFSLAFKQTGEVVKAIFSVFSLIRDGKFT 236

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
            + ISGP+G+  I       GF   +  LA+ S  +G MNL+PIP LDGG     ++E I
Sbjct: 237 SDMISGPIGVISIIGQETSKGFLYLVQILAIISANLGVMNLIPIPGLDGGKFFLLIIESI 296

Query: 312 RGKSLGVSVTRVITRMGLCIIL-FLFFLGIRNDI 344
           RGK++   +   +T +G  I+L  + ++ I ND+
Sbjct: 297 RGKAISEKLEMKLTMIGYGILLTLMIYVTIFNDL 330


>gi|182677293|ref|YP_001831439.1| membrane-associated zinc metalloprotease [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182633176|gb|ACB93950.1| membrane-associated zinc metalloprotease [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 381

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 175/351 (49%), Gaps = 21/351 (5%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +IV  HEFGH+++ RLC ++V +FS+GFGPEL     R G RW+++ +PLGGYV F  
Sbjct: 21  LSLIVFFHEFGHFLIGRLCGVQVDAFSLGFGPELFAFVDRYGTRWRLAALPLGGYVKFHG 80

Query: 74  DEKDMR-----------------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           D                      SFF    WK+   V+AGPLAN ++AI+ FT  FY  G
Sbjct: 81  DANGASMTDEAAAASMPAAERAVSFFAQKVWKRAAIVVAGPLANFILAIVLFTGIFYVNG 140

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             ++ P V  VS  S A  AG + GD I+S+DG  + +FE +   V+      ++  + R
Sbjct: 141 RNILLPYVDGVSAGSAAEAAGFQPGDLILSIDGQPIDSFEAMQRLVQTTRDQSLTFTIAR 200

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKR-QVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS 233
           +    L L   PR++D V   G  R  V  V      +  ++    +  S    + E   
Sbjct: 201 QG-KELTLNATPRVRDIVTPLGTTRVGVLGVEAKGKPENWRVEHYGLADSAHLAVSETWY 259

Query: 234 ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
           +       +   F       Q+SG VGIA+ +      G  A +   A+ S ++G +NLL
Sbjct: 260 VIARTGDYVVGLFSGKESAAQMSGVVGIAQASGEMAKIGIAAVLHLAAILSISVGILNLL 319

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           PIP+LDGGHL  + +E I+G++L   V +   R+G+ ++  L      ND+
Sbjct: 320 PIPLLDGGHLFFYAIEAIQGRALNERVQQFGFRVGMTLVAALMIFATYNDV 370


>gi|302383601|ref|YP_003819424.1| membrane-associated zinc metalloprotease [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194229|gb|ADL01801.1| membrane-associated zinc metalloprotease [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 405

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 119/377 (31%), Positives = 180/377 (47%), Gaps = 44/377 (11%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +IV IHE GH++VAR   ++V  F++GFG  L   T R G+ W+V  +PLGGYV FS 
Sbjct: 19  LTVIVTIHELGHFLVARAFGVKVDRFAIGFGKALFSRTDRHGIEWRVGWLPLGGYVKFSG 78

Query: 74  D---------------------EKDM---RSFFCAAP-WKKILTVLAGPLANCVMAILFF 108
           D                     E+ +   R +F   P W+++L ++AGP++N V+AI+ F
Sbjct: 79  DMDASSVPDSRGLDTLKREIVAEQGVGAERDYFHFKPIWQRMLIIVAGPVSNFVLAIVIF 138

Query: 109 TFFFYNTGV-MKPV-VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           T  F   GV ++P  V+ V P SPAA AG + GD I  ++G  V    EV   V  +   
Sbjct: 139 TVLFSLVGVELRPARVAQVVPGSPAAAAGFRDGDLISEMNGKPVEDAGEVVRKVNLSSGD 198

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGI--SFSYDETKLHSRTVLQSF 224
            I   + R    V  +   P      D    +  V ++G+  S +  ET+      L++ 
Sbjct: 199 PIRFTVERAGRPV-EIVATPARVTREDPVAGRVSVGTIGLMLSSTAAETRQIRYNPLEAV 257

Query: 225 SRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNA--------- 275
            +G+ +   I    L  L   F      +Q+SGP+GIA+ +    +    A         
Sbjct: 258 GQGVRQTGDILGTTLSYLGRIFTGRENGDQLSGPLGIAKASGALTNAAVAANPDPLAMTI 317

Query: 276 -----YIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLC 330
                  +F A+ S  IGF+NLLPIP+LDGGHL+ +  E +  K +  +V     R+GL 
Sbjct: 318 NLLLTMTSFAAILSIGIGFLNLLPIPVLDGGHLVFYAYEAVARKPVAANVQEAGYRVGLA 377

Query: 331 IILFLFFLGIRNDIYGL 347
           ++  L      ND+  L
Sbjct: 378 LLAGLMLFATWNDLQKL 394


>gi|187778982|ref|ZP_02995455.1| hypothetical protein CLOSPO_02577 [Clostridium sporogenes ATCC
           15579]
 gi|187772607|gb|EDU36409.1| hypothetical protein CLOSPO_02577 [Clostridium sporogenes ATCC
           15579]
          Length = 336

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 94/332 (28%), Positives = 170/332 (51%), Gaps = 16/332 (4%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           I+V++HEFGH+++A+   I+V  FS+G GP+LIGI  +    + + L+P+GGYV    DE
Sbjct: 12  ILVLVHEFGHFIMAKANGIKVEEFSIGMGPKLIGIKGKE-TEYLIKLLPIGGYVKMLGDE 70

Query: 76  K---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           +   D R+F   +P +K+  V+AGP  N V++++ F       G   P+V  V P  PAA
Sbjct: 71  EKSTDERAFNNKSPLRKLSVVVAGPFMNLVLSVVLFAILASQRGYWAPIVEKVVPNGPAA 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
           +AG   GD I+ ++   ++ +++    +       +++   R++V   ++K+ P ++DT 
Sbjct: 131 VAGFMPGDKIVKVNDKKITTWDDFVAVIYSGDGTPLNVKFTRDNVEN-NIKLTP-IKDTK 188

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
           +   +    P++  + S+ E          S  +G  +  S+ +  +G   + F      
Sbjct: 189 ENRYMIGIYPTLIENLSFKE----------SVKQGFTQTGSLVKQTVGFFKTLFQGKVSK 238

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
           N + GP+ I +++      G  + +AF A  S  +   N++P P LDGG++  FL E I 
Sbjct: 239 NDVGGPLTIIKVSGKVAKEGVMSLMAFTAYISLQLAIFNIIPFPALDGGYIFLFLFEAIT 298

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GK +  +    +  +G  I++ L  L    DI
Sbjct: 299 GKRVDENKVGFVNYIGFAILMGLMVLVTIKDI 330


>gi|326405030|ref|YP_004285112.1| putative peptidase M50 [Acidiphilium multivorum AIU301]
 gi|325051892|dbj|BAJ82230.1| putative peptidase M50 [Acidiphilium multivorum AIU301]
          Length = 353

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 120/350 (34%), Positives = 179/350 (51%), Gaps = 29/350 (8%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L + V L ++V +HE GHY+VAR   + V +FS+GFGP L   T R G  WK+S I
Sbjct: 5   LRSALGFIVVLGVLVTVHELGHYLVARWRGVTVEAFSLGFGPALFSRTDRHGTVWKISAI 64

Query: 64  PLGGYV------SFSEDEK---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN 114
           PLGGYV       F  ++    D  SF       +   V AGP AN ++AI+ F+  F  
Sbjct: 65  PLGGYVRMKGWAEFGAEQAGATDPGSFGSKRLSARAAVVAAGPAANFLLAIVLFSGVFAT 124

Query: 115 TGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
            GV  + PVVS V   SPAA AG+ KGD I+S++G  +  F++++  V  +P   I+L  
Sbjct: 125 AGVPTVLPVVSKVMAGSPAAAAGLAKGDRIMSMNGQPIRTFDQLSAVVAAHPDGRIALSY 184

Query: 173 YRE---HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            R    H   L L       +T+ R GI+             + ++   +  Q+  RG+ 
Sbjct: 185 TRSGETHSLNLTLGTAKIDGNTIGRLGIEGA-----------DVEMRRLSPPQAIVRGVA 233

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
                T   L  L     +   LNQ+ GPV IA+I+     HG    ++F+A+ S  +G 
Sbjct: 234 VTWQATAATLHGLWQLIDQHKGLNQLGGPVRIAQISGQAVAHGLADLVSFMALLSVNLGL 293

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMG----LCIILFL 335
           +NL+PIP+LDGGHL+ +  E   G++L   V  +  + G    +C+I+F+
Sbjct: 294 INLVPIPVLDGGHLLFYAAEAAAGRALPRRVQEIALQFGAALLVCLIIFV 343


>gi|221234930|ref|YP_002517366.1| membrane endopeptidase MmpA [Caulobacter crescentus NA1000]
 gi|220964102|gb|ACL95458.1| membrane endopeptidase MmpA [Caulobacter crescentus NA1000]
          Length = 425

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 117/383 (30%), Positives = 171/383 (44%), Gaps = 47/383 (12%)

Query: 7   FLLYTVSLI----IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           FL+  VSL+    ++V +HE GHY  AR C + +  FS+GFG  LI    + GV W V+ 
Sbjct: 31  FLIMLVSLLFVLSVVVTVHELGHYWAARACGVAIERFSIGFGAPLISWRDKRGVEWCVAS 90

Query: 63  IPLGGYVSFSEDEKD-----------MRS-------------FFCAAP-WKKILTVLAGP 97
           IPLGGYV F+ DE             MR+             +F   P W++    +AGP
Sbjct: 91  IPLGGYVRFAGDENAASVPDQNDLDAMRNEIRRREGDDAVNRYFHFKPVWQRAFIAVAGP 150

Query: 98  LANCVMAILFFTFFFYNTGVMKP--VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEE 155
           +AN ++AIL F     + G  K    V  V   +PAA AG K GD I+  D   + +F++
Sbjct: 151 MANFILAILVFAVILVSFGAQKTSTTVGEVVAGTPAAAAGFKPGDVILKADNRQIRSFQD 210

Query: 156 VAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKL 215
           +  YV       I   + R+   V HL   PRL +  +    + +V  +G+  S    + 
Sbjct: 211 IQGYVALRANMPIDFAVERDGRTV-HLTATPRLVERQNEISGRVKVGELGLR-SAPGGRF 268

Query: 216 HSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIA----KNFFDH 271
              ++L +      E+  + +     L          +QISG +GI   A        + 
Sbjct: 269 ERSSLLSAIPDATVEVWDMIKTIAFYLGRLLMGQLPADQISGIIGIGHTAGAVTNGVVEQ 328

Query: 272 GFNA--------YIAF--LAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVT 321
             N         Y  F  +A  S +IGFMNLLPIP+LDGGHL+ +  E +  + L     
Sbjct: 329 APNGKALAIGLIYSQFWLIASLSVSIGFMNLLPIPVLDGGHLVMYAYEAVAKRPLRAEFQ 388

Query: 322 RVITRMGLCIILFLFFLGIRNDI 344
               R GL +IL        ND+
Sbjct: 389 AAGFRAGLALILGFMLFAAWNDL 411


>gi|16126159|ref|NP_420723.1| membrane-associated zinc metalloprotease [Caulobacter crescentus
           CB15]
 gi|20978837|sp|Q9A710|MMPA_CAUCR RecName: Full=Metalloprotease mmpA; AltName: Full=Membrane
           metalloprotease A
 gi|13423369|gb|AAK23891.1| membrane-associated zinc metalloprotease, putative [Caulobacter
           crescentus CB15]
          Length = 398

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 117/383 (30%), Positives = 171/383 (44%), Gaps = 47/383 (12%)

Query: 7   FLLYTVSLI----IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           FL+  VSL+    ++V +HE GHY  AR C + +  FS+GFG  LI    + GV W V+ 
Sbjct: 4   FLIMLVSLLFVLSVVVTVHELGHYWAARACGVAIERFSIGFGAPLISWRDKRGVEWCVAS 63

Query: 63  IPLGGYVSFSEDEKD-----------MRS-------------FFCAAP-WKKILTVLAGP 97
           IPLGGYV F+ DE             MR+             +F   P W++    +AGP
Sbjct: 64  IPLGGYVRFAGDENAASVPDQNDLDAMRNEIRRREGDDAVNRYFHFKPVWQRAFIAVAGP 123

Query: 98  LANCVMAILFFTFFFYNTGVMKP--VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEE 155
           +AN ++AIL F     + G  K    V  V   +PAA AG K GD I+  D   + +F++
Sbjct: 124 MANFILAILVFAVILVSFGAQKTSTTVGEVVAGTPAAAAGFKPGDVILKADNRQIRSFQD 183

Query: 156 VAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKL 215
           +  YV       I   + R+   V HL   PRL +  +    + +V  +G+  S    + 
Sbjct: 184 IQGYVALRANMPIDFAVERDGRTV-HLTATPRLVERQNEISGRVKVGELGLR-SAPGGRF 241

Query: 216 HSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIA----KNFFDH 271
              ++L +      E+  + +     L          +QISG +GI   A        + 
Sbjct: 242 ERSSLLSAIPDATVEVWDMIKTIAFYLGRLLMGQLPADQISGIIGIGHTAGAVTNGVVEQ 301

Query: 272 GFNA--------YIAF--LAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVT 321
             N         Y  F  +A  S +IGFMNLLPIP+LDGGHL+ +  E +  + L     
Sbjct: 302 APNGKALAIGLIYSQFWLIASLSVSIGFMNLLPIPVLDGGHLVMYAYEAVAKRPLRAEFQ 361

Query: 322 RVITRMGLCIILFLFFLGIRNDI 344
               R GL +IL        ND+
Sbjct: 362 AAGFRAGLALILGFMLFAAWNDL 384


>gi|301059172|ref|ZP_07200112.1| RIP metalloprotease RseP [delta proteobacterium NaphS2]
 gi|300446720|gb|EFK10545.1| RIP metalloprotease RseP [delta proteobacterium NaphS2]
          Length = 360

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 117/362 (32%), Positives = 187/362 (51%), Gaps = 30/362 (8%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           L + V L +++  HE GH++VA+   I VL FS+GFGP+LIG        + VS IPLGG
Sbjct: 9   LPFLVVLGVLIFFHELGHFLVAKYFGITVLKFSLGFGPKLIG-KKIGETEYLVSAIPLGG 67

Query: 68  YVSF-------SED----EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFF--TFFFYN 114
           YV          ED    E + +SF    P ++I  V AGP+ N ++A+L F  +F F  
Sbjct: 68  YVKMLGENDDEEEDPIPPEDEEKSFSHKPPIQRIAVVGAGPVFNLLLALLIFCASFGFSG 127

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+   +  V   SPA  AG+KKGD I+S+D +    + ++  +V+EN    I L L R
Sbjct: 128 MQVLTTEIGQVREGSPADQAGLKKGDLIVSIDNMDTDTWPQLKEFVQENQGEPIKLTLLR 187

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGI--SFSYDETKLHSRTVLQSFSRGLDEIS 232
               +  + V+P +    + FG   + P +G+  + S+ E KL     L+       EI 
Sbjct: 188 NGQPI-TVTVIPEMSVVKNIFGEDIKTPLLGVVSAGSFKEIKLGFLGALKEGVLKTWEII 246

Query: 233 SIT-----RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
            +T     + F G++S        +  + GP+ I ++     +  ++  I F A+ S  +
Sbjct: 247 KLTCLTVVKLFQGIVS--------IKTLGGPILIGQMTGQLAEQSWSYLIPFTAVISINL 298

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           G +NLLP+PILDGG ++  L+E+I G+ L V       ++G+ +++ L  + I NDI  L
Sbjct: 299 GILNLLPVPILDGGFIVFLLIELIIGRPLNVKKREFAQKLGIGLLILLMIVVIYNDISRL 358

Query: 348 MQ 349
           +Q
Sbjct: 359 LQ 360


>gi|296185355|ref|ZP_06853765.1| RIP metalloprotease RseP [Clostridium carboxidivorans P7]
 gi|296050189|gb|EFG89613.1| RIP metalloprotease RseP [Clostridium carboxidivorans P7]
          Length = 312

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 153/310 (49%), Gaps = 20/310 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE---KD 77
           HE GH+ +A+L  I+V  F++G GP++  I  +  V + + ++P+GGYV    DE    D
Sbjct: 17  HELGHFTLAKLNGIKVEEFAIGMGPQIFKINRKETV-YSIRILPIGGYVKMLGDEGESTD 75

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
            R+F   +P +K+  VLAGP+ N ++ I+ F       G + P+V  V P  PAA+ G+K
Sbjct: 76  PRAFNNKSPLRKLSVVLAGPVMNFILGIVLFAIIAAGKGYLSPIVDKVVPNQPAAVMGLK 135

Query: 138 KGDCIISLDGITVSAFEE--VAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRF 195
            GD I+ ++G  +  +E+     Y       +I+ V   E   V   KV P      +RF
Sbjct: 136 SGDKIVKVNGSKILTWEDFVTGVYTSAGKTMDITYVRNGETKSV---KVTPVKDPKENRF 192

Query: 196 GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQI 255
                   VG+      T +   T+ QS S G  E +S+ +     L SAF      N  
Sbjct: 193 -------IVGVY----PTAVEKPTMGQSISYGFTETNSLVKQTFSFLKSAFKGKVSKNDF 241

Query: 256 SGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKS 315
            GPV I +++      G  A  AF A  +  +G  NLLPIP LDGG++  FL E+I GK 
Sbjct: 242 GGPVTIIKLSGAAAKAGILALTAFGAYITVQLGIFNLLPIPALDGGYIFLFLFELITGKK 301

Query: 316 LGVSVTRVIT 325
           +  +   VI 
Sbjct: 302 VDQNKVGVIN 311


>gi|39997012|ref|NP_952963.1| membrane-associated zinc metalloprotease [Geobacter sulfurreducens
           PCA]
 gi|39983900|gb|AAR35290.1| membrane-associated zinc metalloprotease, putative [Geobacter
           sulfurreducens PCA]
 gi|298506029|gb|ADI84752.1| membrane-associated zinc metalloprotease, putative [Geobacter
           sulfurreducens KN400]
          Length = 355

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 107/339 (31%), Positives = 174/339 (51%), Gaps = 14/339 (4%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV------ 69
           I++ +HE GH++ A+L  + V  FS+GFGP+LIG        + +S  PLGGYV      
Sbjct: 13  ILIFVHELGHFIFAKLFGVGVEKFSLGFGPKLIG-KKVGETEYLISAFPLGGYVKMVGEG 71

Query: 70  ---SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNV 125
                SE++K  RSF   +P K+I  V+AGP  N + A I+F   F      +   +  V
Sbjct: 72  AEGELSEEDK-ARSFAEKSPLKRIGIVVAGPGFNLIFAWIVFIAIFMIGVPSVTSKIGEV 130

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
               PAA AG+   D I  ++G  VS ++E+A  +       + + + R  V +   +V 
Sbjct: 131 VKDKPAAKAGIMANDIITGVNGKAVSRWDEMAAEISAGKGAPLVVEVKRGEV-IKTFRVT 189

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           P  +   +  G     P +G+  S  ET + +    ++  RG  +  ++ R  +  L   
Sbjct: 190 PETRTGKNLLGETVTTPVIGVVAS-GETVIDTYPAGEALQRGTVQTGNVIRLTVVSLVKI 248

Query: 246 FGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLIT 305
             +   L+ I GP+ IA++A    + G  +++AF+A+ S  +G +NLLPIPILDGGHLI 
Sbjct: 249 VERAVPLDTIGGPIMIAKMAGQQAEAGGVSFLAFMALLSINLGVLNLLPIPILDGGHLIF 308

Query: 306 FLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +L E+I  K + +    +  ++GL +++ L  L   NDI
Sbjct: 309 YLWELIFRKPVSMRAREIAQQVGLALLIGLMVLAFYNDI 347


>gi|332703781|ref|ZP_08423869.1| membrane-associated zinc metalloprotease [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553930|gb|EGJ50974.1| membrane-associated zinc metalloprotease [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 358

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/343 (32%), Positives = 185/343 (53%), Gaps = 22/343 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           ++  HE GH++VARL  + V +FS+GFGP L G+  R+   +KVS IPLGGYV    ++ 
Sbjct: 15  LIFFHELGHFIVARLFGVGVTTFSLGFGPRLFGV-RRNHTDYKVSAIPLGGYVHMVGEQP 73

Query: 77  DM--------RSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNV 125
                     +  F A P W++++ V AGP  N  +AIL +   F++ G  ++ P V  +
Sbjct: 74  GQELPEGFSRKESFTARPAWQRMIIVAAGPFFNFFLAILIYWGIFWSQGQLILVPEVGRI 133

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
              SPA  AG+++GD I S+ G  +  +E++   V +    E+SL L R+      + + 
Sbjct: 134 LADSPAMEAGLREGDLIRSVGGQAIDNWEDLLQIVSQAEGRELSLTLERDGQN-QTVTLT 192

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI----TRGFLGV 241
           PRL    + FG + +VP +G++ S  +T+        +F+  +++  ++      G + +
Sbjct: 193 PRLLTRTNIFGEESRVPMIGVAAS-GKTRAVPLGGGSAFTAAVEQTWNVLVLTVEGVIKM 251

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           +      +T    I GP+ IA++     + G    +A  A+ S  +GF+NLLPIP+LDGG
Sbjct: 252 IERVIPVET----IGGPIMIAQMVSQQAEQGLVNVLALAALISINLGFLNLLPIPVLDGG 307

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           H++ F +E + GK L      +  R+GL ++L L FL I ND+
Sbjct: 308 HILFFAIETVTGKPLSERWQAITIRIGLALLLGLMFLAIYNDV 350


>gi|313673944|ref|YP_004052055.1| site-2 protease [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940700|gb|ADR19892.1| site-2 protease [Calditerrivibrio nitroreducens DSM 19672]
          Length = 352

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/350 (29%), Positives = 180/350 (51%), Gaps = 20/350 (5%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           L+  ++  ++V IHE GH++ A++  + V  FS+GFGP++ G        + +S +PLGG
Sbjct: 4   LIAVIAFGVLVFIHELGHFIFAKIFGVYVEKFSIGFGPKVFG-KKIGETEYLLSAVPLGG 62

Query: 68  YVSFSEDEKDM--------RSFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNTGVM 118
           YV    +  D         ++F     ++K L V AGPL N + AIL F F F      +
Sbjct: 63  YVKMYGENPDETVQDSLKDKAFNHKKLYQKSLIVFAGPLFNYIFAILLFWFVFIIGVPTL 122

Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR---ENPLHEISLVLYRE 175
           KPV+  V    PAA+A +K GD I++++G+ + +++++A  ++     PL    L+  + 
Sbjct: 123 KPVIGEVQKDMPAAMADIKSGDVIVNINGLEIKSWDDMAKIIKVSANKPL----LIKIKR 178

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
              +L   V+P+   + + FG    +  +GI  S  E+ +H    ++SF +  ++   I 
Sbjct: 179 GEDILEKTVIPQTAKSKNIFGEDIDIGLLGIKPS-GESFIHRFGPVESFVKANEKCYEIV 237

Query: 236 R-GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
               LG+L   F +    + I GP+ I ++ K+    G    + F+A+ S  +  +NLLP
Sbjct: 238 ELTILGILK-MFQRVVPADNIGGPIMIFQMTKDAAQFGLTPLLTFVALISINLAILNLLP 296

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           IP+LDGGHL+ + +E I  + L      +  R+G+  ++ L      NDI
Sbjct: 297 IPVLDGGHLLIYAIEAIIRRPLSEKAKSIAIRIGMSFLIGLMVFAFYNDI 346


>gi|148261541|ref|YP_001235668.1| putative membrane-associated zinc metalloprotease [Acidiphilium
           cryptum JF-5]
 gi|146403222|gb|ABQ31749.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Acidiphilium cryptum JF-5]
          Length = 353

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/350 (34%), Positives = 178/350 (50%), Gaps = 29/350 (8%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L + V L ++V +HE GHY+VAR   + V +FS+GFGP L   T R G  WK+S I
Sbjct: 5   LRSALGFIVVLGVLVTVHELGHYLVARWRGVTVEAFSLGFGPALFSRTDRHGTVWKISAI 64

Query: 64  PLGGYV------SFSEDEK---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN 114
           PLGGYV       F  ++    D  SF       +   V AGP AN ++AI+ F+  F  
Sbjct: 65  PLGGYVRMKGWAEFGAEQAGAADPGSFGSKRLSARAAVVAAGPAANFLLAIVLFSGVFAT 124

Query: 115 TGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
            GV  + PV+S V   SPAA AG+ KGD ++S++G  +  F++++  V  +P   I+L  
Sbjct: 125 AGVPTVLPVISKVMAGSPAAAAGLAKGDRVVSMNGQPIGTFDQLSAVVAAHPDGRIALSY 184

Query: 173 YRE---HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            R    H   L L        T+ R GI+             + ++   +  Q+  RG+ 
Sbjct: 185 TRSGETHSLNLTLGTAKIDGKTIGRLGIEGA-----------DVEMRRLSPPQAIVRGVA 233

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
                T   L  L     +   LNQ+ GPV IA+I+     HG    ++F+A+ S  +G 
Sbjct: 234 VTWQATAATLHGLWQLIDQHKGLNQLGGPVRIAQISGQAVAHGLADLVSFMALLSVNLGL 293

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMG----LCIILFL 335
           +NL+PIP+LDGGHL+ +  E   G++L   V  V  + G    +C+I+F+
Sbjct: 294 INLVPIPVLDGGHLLFYAAEAAAGRALPRRVQEVALQFGAALLVCLIIFV 343


>gi|317484670|ref|ZP_07943571.1| RIP metalloprotease RseP [Bilophila wadsworthia 3_1_6]
 gi|316924026|gb|EFV45211.1| RIP metalloprotease RseP [Bilophila wadsworthia 3_1_6]
          Length = 373

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 177/347 (51%), Gaps = 29/347 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--EDEKDM 78
           HE GH+ VARL  I V +FS+GFGP+L+ +  R    + +SLIPLGGYV+ +  EDE + 
Sbjct: 28  HELGHFAVARLFRIGVRTFSLGFGPKLLKL-RRGKTDYCLSLIPLGGYVALAGEEDEAEQ 86

Query: 79  ---------------RSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKP 120
                             +   P W ++L VLAGP+AN V+A++ +    +  G   + P
Sbjct: 87  PDPKGKEIDGVLFAPEELYSGRPAWHRLLVVLAGPVANFVLALIIYCGIAWAQGQTYLLP 146

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
            V +V+P +PAA AG+  GD ++S+DG  +  +  VA  +       +++VL R    V 
Sbjct: 147 EVGDVTPGTPAATAGILPGDRVLSIDGKPIENWNAVAEGIGAGNGKPVTIVLSRGGSEVT 206

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLH---SRTVLQSFSRGLDEISSITRG 237
            L + P  +   + FG ++    +GI  S     L       +   F +  D I+     
Sbjct: 207 -LSLTPEAKTRANIFGEEKPAWLIGIRASTATGHLPLGPVEAIGAGFRQTWDMIAFTCES 265

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
           F+ +      +   L+ + GP+ IA++     + G +A +   A+ S  +G +NLLPIPI
Sbjct: 266 FVKLAQ----RVVPLDNVGGPILIAQMVGQQAEQGLSAVLLLAALISVNLGILNLLPIPI 321

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LDGGH++ F LEMI G+ +  +      ++G+ ++L L  L   ND+
Sbjct: 322 LDGGHIVFFTLEMIMGRPVSATAREWSAKVGMALLLGLMILATWNDL 368


>gi|206603803|gb|EDZ40283.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Leptospirillum sp. Group II '5-way CG']
          Length = 354

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/354 (28%), Positives = 182/354 (51%), Gaps = 14/354 (3%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           ++  L + + + +++V+HE GH++VAR   +++  FS+GFGP++   T      ++++ I
Sbjct: 1   MEAVLSFILVIGVLIVVHEMGHFLVARKFGVKIEKFSIGFGPKIFSRTVGE-TEYRLAWI 59

Query: 64  PLGGYVSF---------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY- 113
           PLGGYV           S +E+D RSF      K++    AGP+AN ++A   FT  F+ 
Sbjct: 60  PLGGYVKMLGENDPEQVSPEERD-RSFSALPVSKRMAIAAAGPVANFILAFFLFTAVFWV 118

Query: 114 NTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V++PVV  V P SPA +AG+  GD I+S++GI +S++ ++   +       + +++ 
Sbjct: 119 GIPVLEPVVGKVLPKSPAQMAGLMPGDKILSVNGIPLSSWNDLRKQIETRAGKTLHVIVK 178

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS 233
           R +V  L ++++PR +   D +G K     +G++    E +     +     +G  +  +
Sbjct: 179 RGNVA-LPVEIVPRSEIGSDLYGEKVPQGKIGVA-PQGEIRQVRYGLFDGLGKGFLKTVN 236

Query: 234 ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
           +TR     L            + GP+ IA+++      G    + F+   S  +G MNLL
Sbjct: 237 VTRITFVSLYKILTGAISSKNLGGPILIAQMSAKAAKSGVVNLLIFMGFISVTLGVMNLL 296

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           P+P+LDGGH++    E I  + L + V  +  ++G  I+L +      ND+  L
Sbjct: 297 PVPVLDGGHMLFLAAEGILRRPLSIRVRELSMQVGFVILLTIMVFAFYNDLMRL 350


>gi|296536121|ref|ZP_06898251.1| RIP metalloprotease RseP [Roseomonas cervicalis ATCC 49957]
 gi|296263554|gb|EFH10049.1| RIP metalloprotease RseP [Roseomonas cervicalis ATCC 49957]
          Length = 369

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 106/359 (29%), Positives = 175/359 (48%), Gaps = 27/359 (7%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L + + L ++V IHE GHY+ AR   + V +FS+GFG  L   T R G  W++SL+PL
Sbjct: 10  SILAFILVLGVLVFIHELGHYLAARWRGVHVEAFSIGFGRVLKSWTDRRGTEWRLSLLPL 69

Query: 66  GGYVSFSEDE-KDMRSFFCAAPWK------------KILTVLAGPLANCVMAILFFTFFF 112
           GGYV     E  D  +    A W+            + + + AGP AN  +A + F   +
Sbjct: 70  GGYVKLHGQEGPDDATPEQRAAWRPGQTYHEKPVGDRAIIIAAGPFANFALAAVLFAGLY 129

Query: 113 YNTGVMKP--VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
              G  +P   +  V   S A  AG++ GD I+ LDG  V+ FE+V  +++      I L
Sbjct: 130 MTIGQPQPSATIGAVVAGSAAERAGLQAGDRIVMLDGREVTRFEQVQAHIQPRAGQSIEL 189

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDE-TKLHSRTVLQSFS-RGL 228
            + R+       +V+    D  +  G+   V  +G+S    E T+L+  + L + + +  
Sbjct: 190 RIRRDG----REEVLRATPDARESQGVTTGV--LGVSGGAQEFTRLNPVSALVAGTVQTW 243

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           D  +    G   +++ + G +    ++ GP+ IA+++      G  + ++F+A+ S  +G
Sbjct: 244 DVTAQTMAGLWQMITGSRGTE----ELGGPLRIAQLSGQVAQLGIASLVSFMAILSVNLG 299

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            +NL PIP+LDGGHL+    E IRG+ L         R G  +++ LF     ND+  L
Sbjct: 300 LINLFPIPVLDGGHLVFQAAEAIRGRPLPPRAVEYGFRAGFAVLIMLFIFATWNDLSNL 358


>gi|224372990|ref|YP_002607362.1| putative membrane-associated zinc metalloprotease [Nautilia
           profundicola AmH]
 gi|223589112|gb|ACM92848.1| putative membrane-associated zinc metalloprotease [Nautilia
           profundicola AmH]
          Length = 347

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 110/345 (31%), Positives = 185/345 (53%), Gaps = 23/345 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-EDE 75
           ++  HE GH+++ARL  ++V  FS+GFG +LI         W +S IPLGGYV    +D+
Sbjct: 11  LIFFHELGHFLMARLVGVKVEVFSIGFGKKLI-CKKFGDTNWCLSAIPLGGYVQMKGQDD 69

Query: 76  -------KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNVS 126
                   D  S+    PW++IL +L GP  N ++A L + F  + TG  K  PV+    
Sbjct: 70  TNPNLKNNDPDSYNSKTPWQRILILLGGPGFNFLLAFLIYLFIAF-TGWTKLAPVIGKTI 128

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
           P +PAA   +K GD I+ ++G+ + +++E++P +++  +  +++   + ++ V  LK   
Sbjct: 129 PNTPAAKV-LKPGDKIVKINGVEIKSWDEISPLIQKYDVLHLTVERNKRYLSV-DLKPKI 186

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHS---RTVLQSFSRGLDEISSITRGFLGVLS 243
            LQ  +    IKR++  VGI  S D  K+H      V  ++ + + +   I +G   +++
Sbjct: 187 ELQKNIFGEEIKRKI--VGIIPSGDVIKVHYSPVEAVKIAWDKFVFDSMLIIKGVQKLIT 244

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
            A G    LN +SGP+GI  I     D+G+   +   A+ S  +G +NLLPIP LDGGH+
Sbjct: 245 GAVG----LNTLSGPIGIVDITAKVADYGWQPLLLLAALLSVNLGVLNLLPIPALDGGHI 300

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +  L E I  + +   +   +T  G  I+  L  +GI ND++ L+
Sbjct: 301 MFNLYEAIFKREVSEEIMVKLTIGGWIILGSLMLIGIYNDLHRLI 345


>gi|148380381|ref|YP_001254922.1| putative membrane-associated zinc metalloprotease [Clostridium
           botulinum A str. ATCC 3502]
 gi|153934239|ref|YP_001384600.1| putative membrane-associated zinc metalloprotease [Clostridium
           botulinum A str. ATCC 19397]
 gi|153937005|ref|YP_001388116.1| putative membrane-associated zinc metalloprotease [Clostridium
           botulinum A str. Hall]
 gi|153940499|ref|YP_001391723.1| putative membrane-associated zinc metalloprotease [Clostridium
           botulinum F str. Langeland]
 gi|168180695|ref|ZP_02615359.1| putative membrane-associated zinc metalloprotease [Clostridium
           botulinum NCTC 2916]
 gi|170756743|ref|YP_001781968.1| putative membrane-associated zinc metalloprotease [Clostridium
           botulinum B1 str. Okra]
 gi|226949778|ref|YP_002804869.1| RIP metalloprotease RseP [Clostridium botulinum A2 str. Kyoto]
 gi|148289865|emb|CAL83973.1| putative membrane-associated protease [Clostridium botulinum A str.
           ATCC 3502]
 gi|152930283|gb|ABS35783.1| RIP metalloprotease RseP [Clostridium botulinum A str. ATCC 19397]
 gi|152932919|gb|ABS38418.1| RIP metalloprotease RseP [Clostridium botulinum A str. Hall]
 gi|152936395|gb|ABS41893.1| RIP metalloprotease RseP [Clostridium botulinum F str. Langeland]
 gi|169121955|gb|ACA45791.1| RIP metalloprotease RseP [Clostridium botulinum B1 str. Okra]
 gi|182668635|gb|EDT80614.1| putative membrane-associated zinc metalloprotease [Clostridium
           botulinum NCTC 2916]
 gi|226844402|gb|ACO87068.1| RIP metalloprotease RseP [Clostridium botulinum A2 str. Kyoto]
 gi|295319749|gb|ADG00127.1| RIP metalloprotease RseP [Clostridium botulinum F str. 230613]
 gi|322806691|emb|CBZ04260.1| membrane-associated zinc metalloprotease [Clostridium botulinum
           H04402 065]
          Length = 336

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/343 (28%), Positives = 174/343 (50%), Gaps = 20/343 (5%)

Query: 9   LYTVSLI----IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIP 64
           +Y V+ I    I+V++HEFGH+++A+   I+V  FS+G GP+LIGI  +    + + L+P
Sbjct: 1   MYIVAAILAFGILVLVHEFGHFIMAKANGIKVEEFSIGMGPKLIGIKGKE-TEYLIKLLP 59

Query: 65  LGGYVSFSEDEK---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV 121
           +GGYV    DE+   D R+F   +P +K+  V+AGP  N V++++ F       G   P+
Sbjct: 60  IGGYVKMLGDEEKSTDERAFNNKSPLRKLSVVVAGPFMNLVLSVVLFAIIASQRGYWAPI 119

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V  V P  PAA+AG   GD I+ ++   ++ +++    +       +++   R +V   +
Sbjct: 120 VEKVVPNGPAAVAGFMPGDKIVKVNDKKITTWDDFVTVIYSGDGAPLNINFTRNNVEN-N 178

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
           +K+ P ++DT +   +    P++  + S+ E          S  +G  +  S+ +  +G 
Sbjct: 179 IKLTP-IKDTKENRYMIGIYPTLIENISFKE----------SVKQGFTQTGSLVKQTVGF 227

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
             + F      N + GP+ I +++      G  + +AF A  S  +   N++P P LDGG
Sbjct: 228 FKTLFQGKVSKNDVGGPLTIIKVSGKAAKAGITSLMAFAAYISLQLAIFNIIPFPALDGG 287

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           ++  FL E I GK +  +    +  +G  I++ L  L    DI
Sbjct: 288 YIFLFLFEAITGKRVDENKLGFVNYIGFVILMGLMVLVTIKDI 330


>gi|114327603|ref|YP_744760.1| M50 family membrane endopeptidase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315777|gb|ABI61837.1| membrane endopeptidase, M50 family [Granulibacter bethesdensis
           CGDNIH1]
          Length = 376

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 104/348 (29%), Positives = 165/348 (47%), Gaps = 32/348 (9%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-------- 72
           HE GHY+ AR+  I + +FS+GFG  L+    R G  W++  +PLGGYV           
Sbjct: 23  HEMGHYLAARISGIYIEAFSIGFGKPLVKWRDRRGCEWRLCWLPLGGYVKMYGMERPGDN 82

Query: 73  --------------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
                         +  +   +FF  +   +   V AGPLAN ++AI+ F   F   G  
Sbjct: 83  PGADQPVNTGSPPVQPPRPGMAFFEKSVGSRAFVVAAGPLANALLAIVLFAALFMTAGRQ 142

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           +  PVV  V P S AA AG++  D I+++DG+ VS FE++   V  +P   + L + R  
Sbjct: 143 IPLPVVGEVLPQSAAAEAGLQHDDRIVAIDGMQVSRFEDIQHSVVGHPNQRLVLSVERGG 202

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +  + V P  +   D  G+   V  +G      E     + ++Q  ++   E  +I  
Sbjct: 203 KEIT-IPVTPHAK-VAD--GLTIGVLGIGAGAVTVERMAPGQAIVQGVAQTWTETGNILS 258

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
           G   +++          ++ GP+ IARI+      G  + I+ +A+ S  +G +NL PIP
Sbjct: 259 GVWQMMTG----QRSAKELGGPLAIARISGQVAQLGIPSLISLMALLSINLGLINLFPIP 314

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           ILDGGHL+ FL+E IRG+ +         + G  ++  LF     ND+
Sbjct: 315 ILDGGHLVFFLIEAIRGRPMSPHAQEYGLKAGFLLLATLFIFVTWNDL 362


>gi|124515075|gb|EAY56586.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Leptospirillum rubarum]
          Length = 354

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/354 (27%), Positives = 181/354 (51%), Gaps = 14/354 (3%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           ++  L + + + +++V+HE GH++VAR   +++  FS+GFGP++   T      ++++ I
Sbjct: 1   MEAVLSFILVIGVLIVVHEMGHFLVARKFGVKIEKFSIGFGPKIFSRTVGE-TEYRLAWI 59

Query: 64  PLGGYVSF---------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY- 113
           PLGGYV           S +E+D RSF      K++    AGP+AN ++A   FT  F+ 
Sbjct: 60  PLGGYVKMLGENDPEQVSPEERD-RSFSALPVSKRMAIAAAGPVANFILAFFLFTAVFWI 118

Query: 114 NTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V++PVV  V P SPA +AG+  GD I+S++G  +S++ ++   +       + +++ 
Sbjct: 119 GIPVLEPVVGKVLPKSPAQMAGLMPGDKILSVNGTPLSSWNDLRKQIETRAGKTLHVIVK 178

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS 233
           R +V  L ++++PR +   D +G K     +G++    E +     +     +G  +  +
Sbjct: 179 RGNVA-LPIEIVPRTEIGSDIYGEKVPQGKIGVA-PQGEIRQVRYGIFDGLGKGFLKTVN 236

Query: 234 ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
           +TR     L            + GP+ IA+++      G    + F+   S  +G MNLL
Sbjct: 237 VTRITFVSLYKILTGAISSKNLGGPILIAQMSAKAAKSGVVNLLIFMGFISVTLGVMNLL 296

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           P+P+LDGGH++    E I  + L + V  +  ++G  I+L +      ND+  L
Sbjct: 297 PVPVLDGGHMLFLTAEGILRRPLSIRVRELSMQVGFVILLTIMVFAFYNDLMRL 350


>gi|168184632|ref|ZP_02619296.1| RIP metalloprotease RseP [Clostridium botulinum Bf]
 gi|237795861|ref|YP_002863413.1| RIP metalloprotease RseP [Clostridium botulinum Ba4 str. 657]
 gi|182672313|gb|EDT84274.1| RIP metalloprotease RseP [Clostridium botulinum Bf]
 gi|229262143|gb|ACQ53176.1| RIP metalloprotease RseP [Clostridium botulinum Ba4 str. 657]
          Length = 336

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 98/343 (28%), Positives = 174/343 (50%), Gaps = 20/343 (5%)

Query: 9   LYTVSLI----IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIP 64
           +Y V+ I    I+V++HEFGH+++A+   I+V  FS+G GP+LIGI  +    + + L+P
Sbjct: 1   MYIVAAILAFGILVLVHEFGHFIMAKANGIKVEEFSIGMGPKLIGIKGKE-TEYLIKLLP 59

Query: 65  LGGYVSFSEDEK---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV 121
           +GGYV    DE+   D R+F   +P +K+  V+AGP  N V++++ F       G   P+
Sbjct: 60  IGGYVKMLGDEEKSTDERAFNNKSPLRKLSVVVAGPFMNLVLSVVLFAIIASQRGYWAPI 119

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V  V P  PAA+AG   GD I+ ++   ++ +++    +       +++   R +V   +
Sbjct: 120 VEKVVPNGPAAVAGFMPGDKIVKVNDKKITTWDDFVAVIYSGDGAPLNINFTRNNVEN-N 178

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
           +K+ P ++DT      K     +GI      T + + +  +S  +G  +  S+ +  +G 
Sbjct: 179 IKLTP-IKDT------KENRYMIGIY----PTLIENLSFKESVKQGFTQTGSLVKQTVGF 227

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
             + F      N + GP+ I +++      G  + +AF A  S  +   N++P P LDGG
Sbjct: 228 FKTLFQGKVSKNDVGGPLTIIKVSGKAAKAGIMSLMAFAAYISLQLAIFNIIPFPALDGG 287

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           ++  FL E I GK +  +    +  +G  I++ L  L    DI
Sbjct: 288 YIFLFLFEAITGKRVDENKLGFVNYIGFAILMGLMVLVTIKDI 330


>gi|307721257|ref|YP_003892397.1| membrane-associated zinc metalloprotease [Sulfurimonas autotrophica
           DSM 16294]
 gi|306979350|gb|ADN09385.1| membrane-associated zinc metalloprotease [Sulfurimonas autotrophica
           DSM 16294]
          Length = 350

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 176/338 (52%), Gaps = 23/338 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRS-GVRWKVSLIPLGGYVSF-------- 71
           HE GH+ VARL  + V  FS+GFG  L   T R+    W +S IPLGGYV          
Sbjct: 17  HELGHFTVARLMGVYVEVFSIGFGKRLF--TFRAFNTDWSISAIPLGGYVKMKGQDDADP 74

Query: 72  SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNVSPASP 130
           S+   D  S+    P +KIL +LAGP AN V+A IL+F     N  V+ P+V  V   SP
Sbjct: 75  SKKSYDADSYNTKTPLQKILILLAGPAANFVLAFILYFIIALGNPQVLAPIVGTVVKDSP 134

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL-KVMPRLQ 189
           A +AG++  D I++++G  ++ ++E+A  + E    + S+ L  +  G L L K+ P+LQ
Sbjct: 135 AFVAGLESNDTIMNINGKKITTWKEMAHMISE---AKGSIALQVDRNGYLKLIKLEPKLQ 191

Query: 190 DTVDRFG--IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE-ISSITRGFLGVLSSAF 246
           D  + +G  +KR++  +  +    E KL     +       D+ + + T  F GV     
Sbjct: 192 DAKNMYGENVKRKMIGISAAGVMHEQKLG---FIDKLKYATDQTVFASTLIFTGVKKLIM 248

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
           G D   +++ G + I ++  +    G+ + + F A+ S  +G +NLLPIP LDGGH++  
Sbjct: 249 G-DVPASEMGGVISIVKLTSDATAVGWMSVLFFAALISVNLGVLNLLPIPALDGGHIMFN 307

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L EM+  +     V   +T  G  I+  L  LGI NDI
Sbjct: 308 LYEMLFRREPSEKVVIKLTIAGWVILFGLMGLGIFNDI 345


>gi|170759137|ref|YP_001787736.1| putative membrane-associated zinc metalloprotease [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169406126|gb|ACA54537.1| RIP metalloprotease RseP [Clostridium botulinum A3 str. Loch Maree]
          Length = 336

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 98/343 (28%), Positives = 174/343 (50%), Gaps = 20/343 (5%)

Query: 9   LYTVSLI----IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIP 64
           +Y V+ I    I+V++HEFGH+++A+   I+V  FS+G GP+LIGI  +    + + L+P
Sbjct: 1   MYIVAAILAFGILVLVHEFGHFIMAKANGIKVEEFSIGMGPKLIGIKGKE-TEYLIKLLP 59

Query: 65  LGGYVSFSEDEK---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV 121
           +GGYV    DE+   D R+F   +P +K+  V+AGP  N V++I+ F       G   P+
Sbjct: 60  IGGYVKMLGDEEKSTDERAFNNKSPLRKLSVVVAGPFMNLVLSIVLFAIIASQRGYWAPI 119

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V  V P  PAA+AG   GD I+ ++   ++ +++    +       +++   R +V   +
Sbjct: 120 VEKVVPNGPAAVAGFIPGDKIVKVNDKKITTWDDFVTVIYSGDGAPLNINFTRNNVEN-N 178

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
           +K+ P ++DT +   +    P++  + S+ E          S  +G  +  S+ +  +G 
Sbjct: 179 IKLTP-IKDTKENRYMIGIYPTLIENISFKE----------SVKQGFTQTGSLVKQTVGF 227

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
             + F      N + GP+ I +++      G  + +AF A  S  +   N++P P LDGG
Sbjct: 228 FKTLFQGKVSKNDVGGPLTIIKVSGKAAKAGIMSLMAFAAYISLQLAIFNIIPFPALDGG 287

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           ++  FL E I GK +  +    +  +G  I++ L  L    DI
Sbjct: 288 YIFLFLFEAITGKRVDENKLGFVNYIGFVILMGLMVLVTIKDI 330


>gi|329850623|ref|ZP_08265468.1| RIP metalloprotease RseP [Asticcacaulis biprosthecum C19]
 gi|328840938|gb|EGF90509.1| RIP metalloprotease RseP [Asticcacaulis biprosthecum C19]
          Length = 400

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 119/379 (31%), Positives = 175/379 (46%), Gaps = 47/379 (12%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +IV  HEFGHY VARL   R+  FSVGFG  L+    + G  W +S +PLGGYV F+ DE
Sbjct: 17  LIVTFHEFGHYSVARLFGTRIERFSVGFGKILLRRKDKRGTEWCISALPLGGYVKFAGDE 76

Query: 76  K-------------------------DMRSFFCAAP-WKKILTVLAGPLANCVMAILFFT 109
                                      +  +F   P W++ L VLAGP+AN ++AI  FT
Sbjct: 77  NVTSMMPSAEELEASREAITQREGTAAVSEYFHFKPLWQRFLVVLAGPVANFILAIAIFT 136

Query: 110 FFFYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE 167
           F F   G  V+   VS V   SPAA+AG + GD I  +DG +V++  E    +       
Sbjct: 137 FIFATGGERVIPSKVSQVEAGSPAAVAGFQAGDIIRFIDGKSVNSETEARMLIMLRGATA 196

Query: 168 ISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSR-TVLQSFSR 226
              V+ R    V  L   PR + +VD  G   ++    +     E  +  R   +++  R
Sbjct: 197 TRFVVERAGANV-ELTATPR-RVSVDPKGPNPELKVGQLGIIMGEPAVRVRYNPIEALVR 254

Query: 227 GLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIAR------IAKNFFDHGFN------ 274
           G +E        L  ++  F      NQI G VG+ +      +A   ++   +      
Sbjct: 255 GNNETWRALDTNLTYIARIFTGKENGNQIGGIVGMTKTTGDVTVALTQYEAPVHIKVLNL 314

Query: 275 --AYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCII 332
              Y+ ++A  S A+GF+NLLPIP LDGGHL  FL + +  K +   +     R+ + ++
Sbjct: 315 LYTYLQYMAYISIAVGFLNLLPIPALDGGHLAFFLWQGVTRKPISPEIQSAAFRIAVVLV 374

Query: 333 LFLFFLGIRNDI--YGLMQ 349
           L L      NDI  +GL +
Sbjct: 375 LGLMTFAFWNDINNHGLTK 393


>gi|255003482|ref|ZP_05278446.1| hypothetical protein AmarPR_04535 [Anaplasma marginale str. Puerto
           Rico]
          Length = 321

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 113/337 (33%), Positives = 180/337 (53%), Gaps = 34/337 (10%)

Query: 31  LCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKD------MRSF-FC 83
           +C +RV +FS+GFGPEL GIT  SG RWK SL+P+GGYV    D ++       +SF F 
Sbjct: 1   MCGVRVKTFSLGFGPELFGITDGSGTRWKFSLVPVGGYVKMLGDTQEDNLSEGEKSFAFN 60

Query: 84  AAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGD 140
             P W++     AGPLAN + ++L F   F   G+M   P+V ++ P S A   G+  GD
Sbjct: 61  EKPLWQRFAVAGAGPLANLLFSVLVFFVLFSTRGIMSPMPIVGSILPGSTAEKVGLMVGD 120

Query: 141 CIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH-LKVMPRL-QDTVDRFGIK 198
            I+ +DG  +S FEE+  Y+  +P  E ++V  R+  GV H +K+ P +  D   R GI 
Sbjct: 121 RIVEVDGHEISWFEEIRHYIAGSPNQEFTMVFLRD--GVQHSIKLSPDVWSDDAHRLGIA 178

Query: 199 RQVPSVGISFSYDETKLHS----RTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQ 254
             +       S + T+       R  ++SF R +  I  IT   L V+    G    +++
Sbjct: 179 ANI-------SPETTRARRLPVLRAAVESF-RCIFRIVKIT--LLAVVQLVTGARG-MDE 227

Query: 255 ISGPVGIARIAKNFFDHGFNAY-IAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI-R 312
           + GPV   RIAK+  +   N   + F+ + S  +G +NLLPIP+LDGG+++ + L+ I R
Sbjct: 228 LGGPV---RIAKHSGESIRNKEGLWFVGLISANLGVVNLLPIPMLDGGYMLQYALQGIFR 284

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
            K++      V+  +G  +++ +      ND+  +++
Sbjct: 285 RKTINPKYQNVMMAIGFVLLVSMMVFVTFNDVKSILK 321


>gi|88807544|ref|ZP_01123056.1| hypothetical protein WH7805_13373 [Synechococcus sp. WH 7805]
 gi|88788758|gb|EAR19913.1| hypothetical protein WH7805_13373 [Synechococcus sp. WH 7805]
          Length = 361

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 163/320 (50%), Gaps = 33/320 (10%)

Query: 18  VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKD 77
           +VIHE GH++ ARL  IRV  FSVGFGP ++  T R+G+ + + L+PLGG+VSF +D+ +
Sbjct: 14  IVIHEAGHFLAARLQGIRVNGFSVGFGPAVL-KTERNGITYALRLLPLGGFVSFPDDDDN 72

Query: 78  MRSFFCAAP--------WKKILTVLAGPLANCVMAILFFTFFFYNTGVM-KP----VVSN 124
            +S     P         +++L + AG LAN ++A L        TGV   P    VV  
Sbjct: 73  DQSIPLDDPDLLRNRPIPQRVLVISAGVLANLLLAWLVLVGHTAATGVPGDPAPGVVVMT 132

Query: 125 VSPASPAAIAGVKKGDCIISLD----GITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           V   +PA  AG+K GD I+S+D    G    A       +R +P   + L +      V 
Sbjct: 133 VQDGAPADRAGLKPGDRILSIDSKPLGSGDPAVRAAVDPIRRSPGQTLELEVQHAEA-VR 191

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI----SSITR 236
            L++ P  Q+   R G + QV  VG +          R+ L++ S G  +     S    
Sbjct: 192 MLRLTPDDQNGTGRIGAQLQVAMVGATRPV-------RSPLEALSAGSSQFAGLFSRTVA 244

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
           G+ G+L+  FG   +  Q+SGPV I  +       G +    FLA+ S  +G +N LP+P
Sbjct: 245 GYAGLLTD-FGSTAQ--QVSGPVKIVEMGAQLSSQGGSGLALFLALISINLGVLNALPLP 301

Query: 297 ILDGGHLITFLLEMIRGKSL 316
           +LDGG L+  L+E +RG+ L
Sbjct: 302 LLDGGQLVFLLIEGVRGRPL 321


>gi|257066103|ref|YP_003152359.1| membrane-associated zinc metalloprotease [Anaerococcus prevotii DSM
           20548]
 gi|256797983|gb|ACV28638.1| membrane-associated zinc metalloprotease [Anaerococcus prevotii DSM
           20548]
          Length = 337

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 166/344 (48%), Gaps = 24/344 (6%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           V  + +++IHEFGH+++A+   I+V  F++G GP +        + + + LIP+GGY + 
Sbjct: 9   VMFLFLILIHEFGHFLLAKASGIKVNEFAIGMGPAIFKKQGEETL-YSLRLIPIGGYCAM 67

Query: 72  S-EDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPA 128
             ED++  D RS+  A    K LT+LAGPL N ++A+L F     NTGV    +   S  
Sbjct: 68  EGEDDESSDPRSYDRAPAKSKFLTILAGPLMNLLLAVLIFFVVALNTGVATKTIGGFSKD 127

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEEVAP-----YVRENPLHEISLVLYREHVGVLHLK 183
           SPA  AGVK GD ++ L G  V++F +++P     Y   +   +ISL +   +    + K
Sbjct: 128 SPAEAAGVKLGDEVVRLAGKDVTSFTDISPILNEYYKNRDKDEDISLEVLSGNESKTY-K 186

Query: 184 VMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
           + P  ++     GI              E+KL    V ++   G  E          VL 
Sbjct: 187 ISPMEENGSYYLGI--------------ESKLRKAGVFEAIKLGFVETGKNIALIFVVLG 232

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
             F      + +SGPVG+ +   N   +G  + + FL   S  +G  NLLPIP LDG  +
Sbjct: 233 RLFTGKIAFSALSGPVGVVKELGNQAQNGLMSLLYFLGYISVNLGVFNLLPIPALDGSKI 292

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           ++ L EM+ GK +       IT  G  I+L L  +    DI  L
Sbjct: 293 VSALYEMVTGKRVNKKFEEKITVAGFVILLGLILVISIKDIINL 336


>gi|239905023|ref|YP_002951762.1| putative zinc metallopeptidase [Desulfovibrio magneticus RS-1]
 gi|239794887|dbj|BAH73876.1| putative zinc metallopeptidase [Desulfovibrio magneticus RS-1]
          Length = 359

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/340 (31%), Positives = 173/340 (50%), Gaps = 24/340 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRS 80
           HE GH++ AR   + V +FS+GFGP++ G T R   R+ +S IPLGGYV     + D  +
Sbjct: 19  HELGHFIAARAFGMGVTTFSLGFGPKIFGFT-RGKTRYILSAIPLGGYVQLVAQDPDDTA 77

Query: 81  ---------FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNVSPAS 129
                    F     W++++ V AGP+ N V+A L F       G   M P++  V   S
Sbjct: 78  PDDFPPETHFRLRPAWQRMVVVAAGPIFNFVLAWLLFWGLLAADGRFEMLPIIGQVQKDS 137

Query: 130 PAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQ 189
           PAA+AG+  GD + SL+G  V+ ++ ++  +R +    + L + R+      + + P L+
Sbjct: 138 PAAVAGLAPGDVVTSLNGGPVANWDALSTAIRGSNGQPVKLTVSRDGKDETFV-LTPTLR 196

Query: 190 DTVDRFGIKRQVPSVGISFSYDETKLHSRTV-LQSFSRGLDEISS----ITRGFLGVLSS 244
              + FG +  VP VGI  S       +RTV L + S   + +      +   + G+L  
Sbjct: 197 TVKNLFGEEETVPLVGIVASG-----KTRTVPLGAGSAAAEAVKQTWNVVVVTYTGILK- 250

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
              +   L+ I GP+ IA++       G    +A  A+ S  +G +NLLPIP+LDGGHL+
Sbjct: 251 LIERVVPLDSIGGPIMIAQMVSKQAGEGLGNVVALAALISVNLGVLNLLPIPVLDGGHLL 310

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            + +E++  K +   +  + T++GL  ++ L  L   NDI
Sbjct: 311 FYAIEIVMRKPVSPRMRVLTTKIGLAFLIGLMLLATVNDI 350


>gi|256830150|ref|YP_003158878.1| membrane-associated zinc metalloprotease [Desulfomicrobium
           baculatum DSM 4028]
 gi|256579326|gb|ACU90462.1| membrane-associated zinc metalloprotease [Desulfomicrobium
           baculatum DSM 4028]
          Length = 355

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 105/341 (30%), Positives = 178/341 (52%), Gaps = 18/341 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           ++  HE GH++VAR   + V  FS+GFG  L G T R    ++V   PLGGYV    +  
Sbjct: 15  LIFFHELGHFVVARGMGMGVSVFSLGFGTRLFGFT-RGKTDYRVCAFPLGGYVQLVGESV 73

Query: 77  DMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK--PVVSNV 125
           D           SF    PW+++L VLAGP+ N ++A   F    Y+ GV +  PV+  V
Sbjct: 74  DAELPEGFGPEESFSRRPPWQRMLVVLAGPVFNFILAWFIFWGLAYSQGVQELLPVIGQV 133

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
           + +S A  AG+  GD II +DG+ ++ ++++   +  N    + L + R+   +  ++V 
Sbjct: 134 TNSSAAEEAGIVPGDHIIEIDGVQIAIWDDLVERIEANEGGPMLLTVQRD-TALFSVQVT 192

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT--VLQSFSRGLDEISSITRGFLGVLS 243
           PRLQ+  + FG  + +P +GI+    + +L SR   ++ +  +G  +I  ++   +  + 
Sbjct: 193 PRLQEKRNLFGEVKTMPMLGIA---PKGELLSRELGIVDAAVQGARQIWEVSGLMVMGIV 249

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               +   ++ + G + I  +      +G    +A  A+ S  +G +NLLPIP+LDGGH+
Sbjct: 250 KLIERVIPVSDMGGVILITEMIHKEAQNGMVNLLALTALISINLGILNLLPIPVLDGGHI 309

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           + F LE I GK L   V  +  ++G+ ++L L  L   NDI
Sbjct: 310 LFFFLETITGKPLSPQVQHIALKIGMMLLLMLMVLATFNDI 350


>gi|120603160|ref|YP_967560.1| membrane-associated zinc metalloprotease [Desulfovibrio vulgaris
           DP4]
 gi|120563389|gb|ABM29133.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Desulfovibrio vulgaris DP4]
          Length = 354

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 183/345 (53%), Gaps = 16/345 (4%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSFSEDE 75
           ++  HE GHY+ AR+  I V +FS+GFGP + G   RSG   +++SLIPLGGYVS + + 
Sbjct: 14  LIFFHELGHYLAARVLGIGVHTFSLGFGPRIFGW--RSGQTDYRLSLIPLGGYVSLAGES 71

Query: 76  KD-------MRSFFCAAP-WKKILTVLAGPLANCVMA--ILFFTFFFYNTGVMKPVVSNV 125
            D           F A P W +++ + AGP+ N ++A  I +   F +   ++ P V  V
Sbjct: 72  DDEIPEGFTKGQMFSARPAWHRLIVIAAGPVFNLLLAWFIYWGLTFVHGQFIVLPEVGKV 131

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
               PAA AGV+ GD I+++DG+++  +++V+  +  +    ++L L R   G   L+++
Sbjct: 132 LEGGPAAAAGVQSGDRIVAIDGVSIERWDQVSDAIAASKGAPVTLSLTRNE-GQHELRIV 190

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           P  +     FG +     +GI  S     L    V  + +      + I     GV+   
Sbjct: 191 PEHRTRKTIFGDEEDAFLIGIQASGATMTLPQTPVEAAVTGARQTWTMIAMTGKGVVK-L 249

Query: 246 FGKDTRLNQISGPVGIAR-IAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
           F +   L+ + GP+ IA+ +++   D G +  +A  A+ S  +G +NLLPIP+LDGGH+I
Sbjct: 250 FERVVPLDTVGGPIMIAQMVSREAKDSGISGVLALAALISINLGLLNLLPIPVLDGGHII 309

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
              LEM+  + +   V  V TRMGL ++L L FL   NDI  + Q
Sbjct: 310 FLGLEMLFRRPVPQKVQEVTTRMGLVLLLGLMFLATYNDIVRIGQ 354


>gi|323697426|ref|ZP_08109338.1| membrane-associated zinc metalloprotease [Desulfovibrio sp. ND132]
 gi|323457358|gb|EGB13223.1| membrane-associated zinc metalloprotease [Desulfovibrio
           desulfuricans ND132]
          Length = 352

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/345 (32%), Positives = 182/345 (52%), Gaps = 21/345 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS---- 72
           ++  HE GH++VAR+  + V +FS+GFGP+++G TS     +K+S IPLGGYV+ +    
Sbjct: 15  LIFFHELGHFVVARIFGMGVKAFSLGFGPKMVGFTSGK-TDYKISWIPLGGYVALAGEQG 73

Query: 73  EDEKDM--RSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPVVSNVSP 127
           E+E D      F   P W+++  V AGP  N ++A L + F       GV+ P+V  V P
Sbjct: 74  EEETDFPDDKLFSHRPAWQRLCVVAAGPFFNFLLAFLIYWFLALAQGQGVVLPLVGGVLP 133

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            SPAA AG  KGD I ++DG  V+++  +   +R      + + + R     L L V P+
Sbjct: 134 DSPAAAAGFVKGDMITTIDGAPVNSWTRMVEIIRAAEGKPLQVAVDRAGEK-LTLTVTPQ 192

Query: 188 LQDTVDRFGIKRQVPSVGISFS----YDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
           +    D FG    VP VGI+ S    Y+  +          +  + E+  + +GFL ++ 
Sbjct: 193 VNTFKDLFGKDVTVPMVGINQSGQMRYEPIEGIGAWPALRQTWYMSEV--VVKGFLSIIE 250

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
               +   +  + GP+ +A++      +G  A +  +A+ S  +  +NLLPIP+LDGGH+
Sbjct: 251 ----RLIPVESVGGPIMLAQMVHESAQNGLFALLGMMAIISINLAIINLLPIPVLDGGHI 306

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           + F LE++  + L      +  R+GL I+L +  L I ND+  L+
Sbjct: 307 LFFALEIVFRRPLNERWKAMSMRVGLLILLLIMSLAIFNDVRRLL 351


>gi|46579278|ref|YP_010086.1| membrane-associated zinc metalloprotease [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|46448692|gb|AAS95345.1| membrane-associated zinc metalloprotease, putative [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311233106|gb|ADP85960.1| membrane-associated zinc metalloprotease [Desulfovibrio vulgaris
           RCH1]
          Length = 354

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 182/345 (52%), Gaps = 16/345 (4%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSFSEDE 75
           ++  HE GHY+ AR+  I V +FS+GFGP + G   RSG   +++SLIPLGGYVS + + 
Sbjct: 14  LIFFHELGHYLAARVLGIGVHTFSLGFGPRIFGW--RSGQTDYRLSLIPLGGYVSLAGES 71

Query: 76  KD-------MRSFFCAAP-WKKILTVLAGPLANCVMA--ILFFTFFFYNTGVMKPVVSNV 125
            D           F A P W +++ + AGP+ N ++A  I +   F +   ++ P V  V
Sbjct: 72  DDEIPEGFTKGQMFSARPAWHRLIVIAAGPVFNLLLAWFIYWGLTFVHGQFIVLPEVGKV 131

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
               PAA AGV+ GD I+++DG+++  +++V+  +  +    ++L L R   G   L+++
Sbjct: 132 LEGGPAAAAGVQSGDRIVAIDGVSIERWDQVSDAIAASKGAPVTLSLTRNE-GQHELRIV 190

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           P  +     FG +     +GI  S     L    V  + +      + I     GV+   
Sbjct: 191 PEHRTRKTIFGDEEDAFLIGIQASGATMTLPQTPVEAAVTGARQTWTMIAMTGKGVVK-L 249

Query: 246 FGKDTRLNQISGPVGIAR-IAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
           F +   L+ + GP+ IA+ +++   D G    +A  A+ S  +G +NLLPIP+LDGGH+I
Sbjct: 250 FERVVPLDTVGGPIMIAQMVSREAKDSGITGVLALAALISINLGLLNLLPIPVLDGGHII 309

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
              LEM+  + +   V  V TRMGL ++L L FL   NDI  + Q
Sbjct: 310 FLGLEMLFRRPVPQKVQEVTTRMGLVLLLGLMFLATYNDIVRIGQ 354


>gi|291286438|ref|YP_003503254.1| membrane-associated zinc metalloprotease [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290883598|gb|ADD67298.1| membrane-associated zinc metalloprotease [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 352

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 170/338 (50%), Gaps = 11/338 (3%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV------ 69
           I++ IHE GH++VA+   + V  FS+GFGP++     +    + +S IPLGG+V      
Sbjct: 12  ILIFIHELGHFLVAKYNGVLVEKFSIGFGPKIFS-RKKGETEYALSAIPLGGFVKMYGES 70

Query: 70  --SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFT-FFFYNTGVMKPVVSNVS 126
             S  +D    RSF       +   V AGPL N ++A+L +T  F   T      V  V 
Sbjct: 71  VDSDVDDSLRNRSFAHKPLKARFAIVFAGPLFNFILAVLIYTSIFMIGTPRFLSSVGEVM 130

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
             +PA  AG+  GD + SLDG  +  ++E++ Y+ E P   ++  + R    +L + V P
Sbjct: 131 EGTPAQSAGLMDGDVVKSLDGQPMRYWDEMSSYISEKPGEPVAFQVERGG-ELLTINVTP 189

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF 246
            +    + FG    +  +G+          +    ++  +G  +  +++   +  +   F
Sbjct: 190 EIVKDKNIFGEDMTIGRIGVQRGELTETFRTLNPAKALYKGAVQTYNVSELMVMGVVKIF 249

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
            K    + + GP+ I ++AK+  + G  ++++F+A+ S  +G +NLLPIP+LDGGHL+ F
Sbjct: 250 QKVVPADNLGGPIMIVKMAKDSAETGIISFLSFMAIISINLGILNLLPIPVLDGGHLMFF 309

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +E I  + + + +       GL +++F+ F    NDI
Sbjct: 310 TIEGIIRRPVSIKIREYANMAGLSLLMFIMFFAFYNDI 347


>gi|197105236|ref|YP_002130613.1| membrane-associated zinc metalloprotease [Phenylobacterium zucineum
           HLK1]
 gi|196478656|gb|ACG78184.1| membrane-associated zinc metalloprotease [Phenylobacterium zucineum
           HLK1]
          Length = 404

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 186/405 (45%), Gaps = 70/405 (17%)

Query: 1   MFWLDCFLLYTVSLIIIVVI----HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGV 56
           M +L   LLY +  ++++ +    HE GH++ A+    ++  FS+GFG  L     R GV
Sbjct: 1   MQFLQTVLLYVIPFLLVLGVVVTVHELGHFLAAKWLGTKIDRFSIGFGKALASWRDRQGV 60

Query: 57  RWKVSLIPLGGYVSFSEDE---------------KD---------MRSFFCAAP-WKKIL 91
            W+V+ +PLGGYV F+ DE               KD         +  +F   P W++ +
Sbjct: 61  EWRVAWLPLGGYVRFAGDENMASIPDADDLAAMRKDLVKREGEGALTQYFHFKPLWERAI 120

Query: 92  TVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGIT 149
            V AGP AN  +AI+ F     + G  V+   V+ V+P S AA AG + GD I+  +G  
Sbjct: 121 IVAAGPFANFALAIVIFAALLMSFGEMVLPFRVAQVNPDSAAAAAGFRPGDLIVEANGRP 180

Query: 150 VSAFEEVAPYVRENPLHEISLVLYR--EHVGVLHLKVMPRLQDTVD------RFG----I 197
           V  F+EV   VR         V+ R  E V    L   PR +   D      R G    +
Sbjct: 181 VRRFDEVQQLVRVRAEVPTRFVVERGGERVA---LTATPRWETQTDAVAGEQRVGVLGLV 237

Query: 198 KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG-VLSSAFGKDTRLNQIS 256
             Q P   +   YD  K  +  V ++++     +   +  +LG +++   G D    Q+ 
Sbjct: 238 PAQRPEDFVRVRYDPIKALAGGVQRTWN-----VLETSVYYLGRMVTGQVGTD----QLR 288

Query: 257 GPVGIARIAKNFFDHGF-NA-------------YIAFLAMFSWAIGFMNLLPIPILDGGH 302
           GP+GIA + KN    G  NA              +   A+ S +IGFMNLLP+P+LDGGH
Sbjct: 289 GPLGIASVTKNVAQLGAENAPSLGHMLMGVGLNLVQLAALISVSIGFMNLLPVPVLDGGH 348

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           L+ +  E +  + L   V     R+GL ++L L      ND+  L
Sbjct: 349 LLFYAYEAVARRPLAAKVQAAGYRVGLALVLGLMLFATWNDLQRL 393


>gi|121533723|ref|ZP_01665550.1| putative membrane-associated zinc metalloprotease [Thermosinus
           carboxydivorans Nor1]
 gi|121307714|gb|EAX48629.1| putative membrane-associated zinc metalloprotease [Thermosinus
           carboxydivorans Nor1]
          Length = 343

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/340 (29%), Positives = 174/340 (51%), Gaps = 27/340 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           +++  HE GH++ A++  +RV  F++GFGP+L        V + + +IPLGG+   +   
Sbjct: 14  LLIFFHELGHFITAKMVGMRVHEFAIGFGPKLWSCKKGETV-YSLRVIPLGGFNKIAGMD 72

Query: 73  -EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP----VVSNVSP 127
            ++E+D RSF     W ++L ++AG   N V+ +L F   F  TG+  P    ++ +V P
Sbjct: 73  PDEEQDERSFHAKPIWARMLVIVAGSAMNFVLPVLLFMLVFIFTGIDTPSDEAIIGSVFP 132

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH-LKVMP 186
             PAA +G+  GD I++++   VS++ +    V+ N   E  L++  E  G  H ++V+P
Sbjct: 133 DRPAAQSGLAPGDRILAVNNQEVSSWRQFVSLVQPNAGKE--LIIKFERNGQSHEIRVVP 190

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT-VLQSFSRGLDEISSITRGFL-GVLSS 244
                 +R GI   VP +          L+ R  V +SF   + +   +    L G+   
Sbjct: 191 EYDAKANR-GIIGVVPQI----------LNYRPGVAESFGLAVKQTYMVASNMLAGIGQM 239

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
             GK      ++GP+G+A++A      G    + F A  S  +G +NL P+P+LDGGH++
Sbjct: 240 ITGKAPA--DVAGPIGVAQMAGQVAQLGVTPLLQFAAFLSINLGLINLFPVPVLDGGHVV 297

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           T  +E IRGK L  +  + I  +G  +++ L  +    DI
Sbjct: 298 TLAVEAIRGKPLNRNSLQFIQMIGFTLLMLLLIVATFKDI 337


>gi|253700117|ref|YP_003021306.1| membrane-associated zinc metalloprotease [Geobacter sp. M21]
 gi|251774967|gb|ACT17548.1| membrane-associated zinc metalloprotease [Geobacter sp. M21]
          Length = 354

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 104/348 (29%), Positives = 177/348 (50%), Gaps = 12/348 (3%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L   ++L  ++  HE GH++ A+   + V  FS+GFGP++ G        + +S +PL
Sbjct: 2   SILFAIIALGALIFFHELGHFLFAKAFGVGVEKFSLGFGPKIYG-KKVGETEYLLSALPL 60

Query: 66  GGYVSF---SED----EKDMRSFFCAAP-WKKILTVLAGPLANCVMA-ILFFTFFFYNTG 116
           GGYV      ED    E+D    F   P  ++I+ V AGP+ N + A ILF   F     
Sbjct: 61  GGYVKMVGEGEDAEISEEDRARSFAEKPVLQRIVIVAAGPIFNLLFAYILFIVIFMIGVP 120

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
            +   V +V    PAA AGVK GD I S++G  V+ +++ A  + E  L  + + + R  
Sbjct: 121 AVTTKVGDVVADKPAAKAGVKAGDTIRSVNGKPVARWDDFAKIIAEGKLAPVEVEVERGQ 180

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
              +   ++P  + + +  G     P +G+  +  ET +      ++ +RG  +  ++ R
Sbjct: 181 TA-MKFTMVPESRTSKNLLGDTVTQPVIGV-VAAGETVIDHFPPGEAIARGSAQCWNVIR 238

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             +  L     +   L+ I GP+ I ++A      G  +++AF+A+ S  +G +NLLP+P
Sbjct: 239 LTVLSLVRLVERAIPLDNIGGPIMIVKMAGEQAAAGGVSFLAFVALLSVNLGVLNLLPVP 298

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           ILDGGHL  FL+E++ G+ +G     +  ++GL +++ L  L   NDI
Sbjct: 299 ILDGGHLAFFLIELVTGRPVGKRAREIAQQVGLVLLIGLMMLAFYNDI 346


>gi|15895072|ref|NP_348421.1| membrane-associated Zn-dependent protease [Clostridium
           acetobutylicum ATCC 824]
 gi|20978827|sp|Q97I57|Y1796_CLOAB RecName: Full=Putative zinc metalloprotease CA_C1796
 gi|15024768|gb|AAK79761.1|AE007688_10 Predicted membrane-associated Zn-dependent protease [Clostridium
           acetobutylicum ATCC 824]
 gi|325509210|gb|ADZ20846.1| membrane-associated Zn-dependent protease [Clostridium
           acetobutylicum EA 2018]
          Length = 339

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 175/333 (52%), Gaps = 18/333 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           ++++IHE GH+++A+L +++V  F++G GP+L+GI  +   ++ +  +P+GGYV    DE
Sbjct: 15  VLILIHELGHFVLAKLNDVKVEEFAIGMGPKLLGIKGKE-TQYSIRALPIGGYVKMLGDE 73

Query: 76  K---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
               D R+F   +  +++  V+AGP+ N ++A + F     + G+  P V  +S  SPA 
Sbjct: 74  SKSDDPRAFNNKSSARRLSIVIAGPIMNLILAAVLFCIVGMSEGIALPTVGKISANSPAQ 133

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
             G+K GD I+ ++  +V  +E+++  +  N    I L L + +  +  + ++P+     
Sbjct: 134 KIGIKAGDTIVKINNYSVHTWEDISFNMALNKGEGIKLAL-KNNGTIKKVTLVPQ----- 187

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE-ISSITRGFLGVLSSAFGKDTR 251
             +  K ++  +GIS  +    +   T+++    G  E ++ I   +L +     GK + 
Sbjct: 188 --YSKKEKMYLIGISPKF----IDKPTIIEGAKYGTSETVTMIKTVYLSLKMMVTGKASA 241

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
              +SGPV I ++     + GF   + F+A  S  +G MNLLPIP LDGG +  FL +MI
Sbjct: 242 -KDVSGPVSIIKVTGAAANAGFIRLVNFIAFISAQLGVMNLLPIPALDGGFVFLFLFQMI 300

Query: 312 RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            GK +       +  +G  +++ L  +    D+
Sbjct: 301 TGKKVDDDKVGFVNTIGFALLMILMIVVTIKDV 333


>gi|295689591|ref|YP_003593284.1| membrane-associated zinc metalloprotease [Caulobacter segnis ATCC
           21756]
 gi|295431494|gb|ADG10666.1| membrane-associated zinc metalloprotease [Caulobacter segnis ATCC
           21756]
          Length = 398

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 108/372 (29%), Positives = 165/372 (44%), Gaps = 43/372 (11%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L I+V IHE GH+ VAR C + +  FS+GFG  L+    + GV W+++ IPLGGYV FS 
Sbjct: 15  LSIVVTIHELGHFWVARACGVAIDCFSIGFGRALVSWRDKQGVEWRIAAIPLGGYVRFSG 74

Query: 74  DEKDM-------------------------RSFFCAAPWKKILTVLAGPLANCVMAILFF 108
           DE                            R F     W++ L  +AGP+AN ++AIL  
Sbjct: 75  DENAASVPDQNDLSAMKRAIIEREGEAAVNRYFHFKPVWQRALIAVAGPMANFILAILIM 134

Query: 109 TFFFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
             F    G  +    V  V P SPAA AG+  GD ++  D   +    +V+ Y+      
Sbjct: 135 AVFLVVIGNPRGQASVREVQPNSPAAQAGLLPGDILLRADKTPLRGAGDVSAYISLRAKM 194

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
            I L + R    + H+ V+P L ++ D    + +   +G+  +   +KL   +++ +   
Sbjct: 195 PIDLTIERAGR-IQHVTVVPALAESRDDIRGRVKEGRMGVVLA-SVSKLEKSSLISAIPD 252

Query: 227 GLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHG-------------- 272
              E+ ++ +     L          +QISG +GI   A                     
Sbjct: 253 ATVEVWNMVKTIGFYLGRLVTGQMPADQISGIIGIGHTAGAVTKASAAGAPDMATMALRV 312

Query: 273 FNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCII 332
           F + +  +A  S +IGFMNLLPIP+LDGGHL+ +  E +  + L         R GL +I
Sbjct: 313 FVSSMLLIASLSVSIGFMNLLPIPVLDGGHLLMYAYEAVARRPLRADFQAAGFRAGLALI 372

Query: 333 LFLFFLGIRNDI 344
           L        ND+
Sbjct: 373 LGFMLFAAWNDL 384


>gi|85373589|ref|YP_457651.1| hypothetical protein ELI_03810 [Erythrobacter litoralis HTCC2594]
 gi|84786672|gb|ABC62854.1| hypothetical protein ELI_03810 [Erythrobacter litoralis HTCC2594]
          Length = 393

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 104/368 (28%), Positives = 169/368 (45%), Gaps = 44/368 (11%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED------ 74
           HE GHY+V R   +   +FS+GFG E+IG T R G RWK+S +PLGGYV F  D      
Sbjct: 25  HELGHYLVGRWFGVGAQAFSIGFGKEMIGWTDRWGTRWKISALPLGGYVQFKGDMNPASV 84

Query: 75  ---------------------EKDMRS-----FFCAAPWKKILTVLAGPLANCVMAILFF 108
                                E D R+     F  A+  K+ L V AGP+AN ++ +  F
Sbjct: 85  GAAGDAHDDTTFGVGTDEALAEDDDRAVVGAPFHHASLGKRALIVAAGPVANIIVTLAIF 144

Query: 109 TFFFYNTGVMKPVVSNV---------SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPY 159
             FF   G  +P   +V         +  S A  AG+  GD I++++G  ++   ++   
Sbjct: 145 AGFFMAIG--EPTARDVDEQLTVAEFTEESAAQRAGIAIGDRIVAVEGEPMATLRDLQQA 202

Query: 160 VRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT 219
           V   P   + + + R+      + V  R  +  DRFG   ++  +G+  +  E     R 
Sbjct: 203 VMPYPGRTLDVTVLRDG-DEQTIPVQVRGVEMEDRFGNPSKIGLIGVQAAGAEYDFEPRG 261

Query: 220 VLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAF 279
            ++S    ++    +    +  ++     +  + ++ GP+ IA+ +      G+ A+I F
Sbjct: 262 PIESVGLAVESTLDMADLMVTGVAQIVTGERSVKELGGPIKIAKYSGEQLSLGWLAFINF 321

Query: 280 LAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLG 339
            A+ S  + F+NLLPIP LDGGHL  +  E +R K +G     +  R G+ ++L L    
Sbjct: 322 AALISLNLAFINLLPIPALDGGHLAFYAAEAVRRKPVGPRGMELAYRTGVGLVLVLMLFV 381

Query: 340 IRNDIYGL 347
             ND+  L
Sbjct: 382 TFNDLASL 389


>gi|319957194|ref|YP_004168457.1| membrane-associated zinc metalloprotease [Nitratifractor salsuginis
           DSM 16511]
 gi|319419598|gb|ADV46708.1| membrane-associated zinc metalloprotease [Nitratifractor salsuginis
           DSM 16511]
          Length = 365

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 108/352 (30%), Positives = 174/352 (49%), Gaps = 20/352 (5%)

Query: 13  SLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS 72
           +L ++V  HE GH+ VARL  +++  FS+GFG +++      G  W  S +PLGGYV   
Sbjct: 13  ALSVLVFFHELGHFTVARLMGVKIERFSIGFG-KILTRKRCCGTEWAFSAVPLGGYVKMK 71

Query: 73  -EDEKDMR-------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM------ 118
            +D+ D         S+    PW++IL +LAGP AN V+A   + F   +   +      
Sbjct: 72  GQDDSDPTVRSSDPDSYNAKKPWQRILILLAGPGANFVLAFFLYLFIALHGAPLIAARDY 131

Query: 119 -KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
             PVV  V+P +PAA AG++ GD I+++DG  V  + ++   +++ P  E  LV    H 
Sbjct: 132 IPPVVGQVAPDTPAAKAGLQPGDRILAIDGTPVRYWYQIGEAIQKAP--EPILVTILRHG 189

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
             L LK+  ++ +  + F  K +   +GIS    +  +      ++     +E    T  
Sbjct: 190 KELTLKLHTKIVEGENEFKEKIKRRIIGISPKVSKDTIIRFAPSEALFYAWNETKKATLL 249

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
               +      +     + GP+ I  I   F   GF   +  +A+ S  +G +NLLPIP 
Sbjct: 250 IATGVKKMSTGEVGTENVGGPITIFDIMMKFAQAGFVYLLFIMALISVNLGVLNLLPIPA 309

Query: 298 LDGGHLITFLLEMI-RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LDGGH++  L EMI R +   V+  R +T +G  ++  + FLG+ ND   LM
Sbjct: 310 LDGGHIMFNLYEMITRHEPSEVAYYR-LTVLGWVLLGGIMFLGLFNDFQRLM 360


>gi|171463278|ref|YP_001797391.1| membrane-associated zinc metalloprotease [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|171192816|gb|ACB43777.1| membrane-associated zinc metalloprotease [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 377

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 103/371 (27%), Positives = 176/371 (47%), Gaps = 37/371 (9%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
            F  + ++L ++V  HEFGH++ AR C +RVL F++GFG  +    +++   W ++ IPL
Sbjct: 6   TFAAFLLTLGVLVSFHEFGHFLAARCCGVRVLRFAIGFGKPIYTYRAKNKTEWVLASIPL 65

Query: 66  GGYVSFSEDEKDMRSFFCAAP----------WKKILTVLAGPLANCVMAILFFTFFFYNT 115
           GGYV    D +D +     A           W++ L V AGP AN  +A++FF   + + 
Sbjct: 66  GGYVKLL-DGRDRQQVISPADEAEAFDRKPLWQRSLVVAAGPFANFFLAVIFFALIYLSG 124

Query: 116 GVMKP-VVSNVSPASPAAIAGVKKGDCIISLDGITVSA--------FEEVAPY------- 159
               P V+ N    S AA  G+ +GD +I    +            FE V  +       
Sbjct: 125 APQLPAVLQNPPENSVAANLGIAEGDQVIGWQDLGSQTENMLLFGEFELVPSWNALRWSL 184

Query: 160 -----VRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETK 214
                  +    E+       HV   + K +P++    D       +P+      + E K
Sbjct: 185 MDALTAEDGFALELQTPAGGRHVKTFYAKDLPKISSDKDVMKALGLLPAPTPLDHWQELK 244

Query: 215 LHSRTVLQSFSRGLDEISSIT-RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGF 273
           L     L   S+ +  I+ ++ R   G+L+ +    T L Q+ GP+ IA +A      G+
Sbjct: 245 LGPIDALTFASQRVWVITKVSARMMAGLLTGS----TSLKQLGGPLSIADMAGKTAQVGW 300

Query: 274 NAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIIL 333
             ++AFLA+ S +IG +NLLP P+LDGG L+    E++ GK + +S+   + ++G  +++
Sbjct: 301 QPFLAFLALMSISIGLLNLLPFPMLDGGQLLYDAWELVAGKRISISMQEQLQKLGFILLI 360

Query: 334 FLFFLGIRNDI 344
            +  L + ND+
Sbjct: 361 SMSLLALFNDL 371


>gi|148284253|ref|YP_001248343.1| putative membrane-associated zinc-dependent metalloprotease
           [Orientia tsutsugamushi str. Boryong]
 gi|146739692|emb|CAM79502.1| putative membrane-associated zinc-dependent metalloprotease
           [Orientia tsutsugamushi str. Boryong]
          Length = 353

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 119/361 (32%), Positives = 190/361 (52%), Gaps = 24/361 (6%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           MF +   L + ++  +++ +HE GHY  ARLC + V  FS+GFG EL     ++  RWK+
Sbjct: 1   MFLVTTILSFVITTGLLIFVHELGHYFCARLCGVYVQEFSIGFGKELFAFIDKNLTRWKI 60

Query: 61  SLIPLGGYVSF---SEDE-KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYN 114
            + PLGG+V     S+D   D RS+       ++L VLAGP AN + AI+  TF   FY 
Sbjct: 61  CIFPLGGFVRMQHHSQDSTSDRRSYNNQPIINRMLIVLAGPAANFIFAIVALTFLNGFYG 120

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             ++  VV +V   S A  AG+ K D I  + G+ V  F ++   V   P   I LV+ R
Sbjct: 121 KYIISSVVDHVVSESAAEKAGIMKSDIITEVAGVKVRDFLDLVHVVFNYPEVPIELVVER 180

Query: 175 EHVGVLHLKVMP-----RLQDTVDRFG-IKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
           E+  ++ + V+P     RL D+  R G +  +   + I  S+ ++ L S     +++ G+
Sbjct: 181 EN-KLMKINVVPHAKLYRLNDSEIRLGDLGVRGKLIRIKSSFIDSILES----VNYTFGV 235

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
            ++       + +     GKD  + +I G VGIA+ +        ++++ FL   S ++G
Sbjct: 236 SKLI-----LIALWQKLTGKDA-IAEIVGVVGIAQESSKAMCQSIDSFLLFLVNLSISLG 289

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGK-SLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            MNLLPI  LDGG  +  + EMI GK S+ + V  +  ++G+ II+FL  + I NDI  L
Sbjct: 290 VMNLLPILPLDGGRFLYLVYEMIVGKGSINLMVYNIAMKIGIAIIIFLIVISISNDIKNL 349

Query: 348 M 348
           +
Sbjct: 350 L 350


>gi|254420976|ref|ZP_05034700.1| RIP metalloprotease RseP [Brevundimonas sp. BAL3]
 gi|196187153|gb|EDX82129.1| RIP metalloprotease RseP [Brevundimonas sp. BAL3]
          Length = 405

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/395 (29%), Positives = 182/395 (46%), Gaps = 56/395 (14%)

Query: 4   LDCFLLYTVSLII----IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWK 59
           L   L+Y V  ++    IV IHE GH++VAR   ++V  F++GFG  +   T R G+ W+
Sbjct: 5   LGQILIYIVPFLLVLTFIVTIHELGHFLVARAFGVKVDRFAIGFGKAIFSRTDRHGIEWR 64

Query: 60  VSLIPLGGYVSFSED------------------------EKDMRSFFCAAP-WKKILTVL 94
           +  +PLGGYV FS D                            R +F   P W++ L V+
Sbjct: 65  LGWMPLGGYVKFSGDLDASSVPDQAGLAELRQRVIAEGGPGAERDYFHFKPVWQRALIVV 124

Query: 95  AGPLANCVMAILFFTFFFYNTGV-MKPV-VSNVSPASPAAIAGVKKGDCIISLDGITVSA 152
           AGP AN ++AI  F   F + G  ++P  V+ V   SPAA AG + GD I  ++G  +  
Sbjct: 125 AGPAANFLLAITIFAIVFMSVGTQLRPARVAQVQAGSPAAAAGFQVGDLITGVNGKAIKD 184

Query: 153 FEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDE 212
             EV   V  +    +   + R    V+ L  +P  ++  D    + +V  +G+  +   
Sbjct: 185 GGEVTRTVMLSTGDPVRFTVERAQQ-VVELTAVPERREENDPIAGRVKVGRIGLGLAPAP 243

Query: 213 TKL-HSR-----TVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAK 266
             L H R      V++   +  D + S T  +LG L++  G+++  +Q SGP+GIA+   
Sbjct: 244 GDLRHVRYGPVDAVVEGVRQTRDVVGS-TLTYLGRLAT--GRESG-DQFSGPLGIAKATG 299

Query: 267 NFFDHGFNAYIA--------------FLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
           +       A  A              F A+ S  IGF+NLLPIP+LDGGHL+ +  E I 
Sbjct: 300 SLTTAAVEANPAPEAIAINLLLTLTTFAAILSIGIGFLNLLPIPVLDGGHLLFYGYEAIV 359

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            + +      +  R GL ++         ND+  L
Sbjct: 360 RRPVAARYQEMGYRAGLALLAGFMLFATWNDLQKL 394


>gi|152990445|ref|YP_001356167.1| membrane-associated zinc metalloprotease [Nitratiruptor sp.
           SB155-2]
 gi|151422306|dbj|BAF69810.1| membrane-associated zinc metalloprotease [Nitratiruptor sp.
           SB155-2]
          Length = 354

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/337 (29%), Positives = 164/337 (48%), Gaps = 13/337 (3%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK---- 76
           HE GH++ AR   + V  FS+GFGP ++      G  W +S IPLGGYV     +     
Sbjct: 17  HELGHFLAARFFGVTVERFSIGFGP-ILTKKRCCGTEWAISAIPLGGYVKMKGQDDTDPT 75

Query: 77  ----DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF-FYNTGVMKPVVSNVSPASPA 131
               D  S+    PW++I+ + AGP AN  +A L + +       V+ P V  V P SPA
Sbjct: 76  AKSFDPDSYTTKKPWQRIIILFAGPFANFFLAFLLYLYIALSGYDVLAPKVGQVLPDSPA 135

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDT 191
           A A ++KGD I++++G  +  +E+++  +  +  H    +L   +     + + P++  T
Sbjct: 136 AKAHLQKGDTILAINGQKIKTWEDLSRIIAHS--HAPLKLLIDRNGKKEIVTLQPKIMKT 193

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
            + FG + Q P +GI+ +    K+H  + L++     D+    ++  L  +         
Sbjct: 194 KNIFGEEVQRPMIGIAPANAYIKVH-YSPLEAIQVAYDKTIEASKFILLGIEKMIEGVVS 252

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
             +I G + I  +       G  A ++F A+ S  +G +NLLPIP LDGGH++  L EMI
Sbjct: 253 PKEIGGVLTIMDVTAKASQAGLVALLSFTALISVNLGILNLLPIPALDGGHIMINLYEMI 312

Query: 312 RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
              +        IT  G   ++ L  LG+ NDI  L+
Sbjct: 313 TKHAPSEETLYKITLAGWIFLIGLMGLGLYNDINRLL 349


>gi|197119122|ref|YP_002139549.1| membrane-associated zinc metalloprotease [Geobacter bemidjiensis
           Bem]
 gi|197088482|gb|ACH39753.1| membrane-associated zinc metalloprotease, putative [Geobacter
           bemidjiensis Bem]
          Length = 354

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 105/348 (30%), Positives = 176/348 (50%), Gaps = 12/348 (3%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L   ++L  ++  HE GH++ A+   + V  FS+GFGP++ G        + +S +PL
Sbjct: 2   SILFAIIALGALIFFHELGHFLFAKAFGVGVEKFSLGFGPKIYG-RKIGETEYLLSALPL 60

Query: 66  GGYVSF---SED----EKDMRSFFCAAP-WKKILTVLAGPLANCVMA-ILFFTFFFYNTG 116
           GGYV      ED    E+D    F   P  ++I+ V AGP+ N + A ILF   F     
Sbjct: 61  GGYVKMVGEGEDVEISEEDRARSFAEKPVLQRIVIVAAGPIFNLLFAYILFIIIFMVGVP 120

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
            +   V +V    PAA AGVK GD I S++G  V+ +++ A  + E  L  + + + R  
Sbjct: 121 AVTTKVGDVVADKPAAKAGVKAGDTIRSVNGKPVARWDDFAKIIAEGKLAPVEVEVQRGQ 180

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
              L   ++P  + + +  G     P +G+  +  ET +      ++ +RG  +  ++ R
Sbjct: 181 TP-LKFTMVPESRTSKNLLGDTVTQPVIGV-VAAGETVIDHFPPGEAITRGSAQCWNVIR 238

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             +  L     +   L+ I GP+ I ++A      G  +++AF+A+ S  +G +NLLP+P
Sbjct: 239 LTVLSLVRLVERAIPLDNIGGPIMIVKMAGEQAAAGGVSFLAFVALLSVNLGVLNLLPVP 298

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           ILDGGHL  FL+E++ G+ L      +  ++GL +++ L  L   NDI
Sbjct: 299 ILDGGHLAFFLIELVTGRPLSKRAREIAQQVGLVLLIGLMMLAFYNDI 346


>gi|114566425|ref|YP_753579.1| peptidase M50 membrane-associated zinc metallopeptidase
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114337360|gb|ABI68208.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 343

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 103/349 (29%), Positives = 168/349 (48%), Gaps = 20/349 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           ++  L+  + + ++++ HE+GH++VAR   I V  F++GFGP++     R+GV + + LI
Sbjct: 1   MNTILITLLIIAVLILAHEWGHFVVARRIGIPVYEFAIGFGPKVFS-WKRNGVIYSLRLI 59

Query: 64  PLGGYVSFSEDE----KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV-- 117
           PLGG+V  + +E    ++   F    P +KI    AGP  N V+A+L F F +   G+  
Sbjct: 60  PLGGFVRMAGEEPGDPEEPNGFSHRTPLEKIRVSFAGPFMNFVLALLIFVFSYSVIGLPH 119

Query: 118 --MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
              +P++  V    PA +AG+K GD IIS +GI V+++ +       +    + L L R+
Sbjct: 120 SSNEPIIGTVIKGKPADLAGIKAGDRIISANGIAVNSWADFNQQTSRSSGQPLELQLERK 179

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
               L L+V P   D+    GI             +      + +L+S   GL +   +T
Sbjct: 180 QQ-RLSLEVSPVKLDSSGNMGIG----------VLNRVVYEKQGILKSMELGLKQTYELT 228

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
                 L         +  ++GPVGI R+   F   G    + F A  S  +G MNLLPI
Sbjct: 229 LLLFSALGVLISGGASMGDLAGPVGITRLVGEFAQVGMIFLLNFTAFLSINLGIMNLLPI 288

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           P LDG  ++  ++E IR K L       +  +G   ++ L  +   NDI
Sbjct: 289 PALDGSKIVFAVVEAIRKKPLDPEKEGFLNWIGFLFLIGLMIIVTFNDI 337


>gi|189182936|ref|YP_001936721.1| putative membrane-associated Zn-dependent protease 1 [Orientia
           tsutsugamushi str. Ikeda]
 gi|189179707|dbj|BAG39487.1| putative membrane-associated Zn-dependent protease 1 [Orientia
           tsutsugamushi str. Ikeda]
          Length = 353

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 114/361 (31%), Positives = 187/361 (51%), Gaps = 24/361 (6%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           MF +   L + ++  ++V +HE GHY  AR+C + V  FS+GFG E+     ++  RWK+
Sbjct: 1   MFLVTTILSFVITTGLLVFVHELGHYFCARVCGVYVQEFSIGFGKEIFAFVDKNLTRWKI 60

Query: 61  SLIPLGGYVSFSEDEKDM----RSFFCAAPWKKILTVLAGPLANCVMAILFFTFF--FYN 114
            + P GG+V      +D     RS+       ++L VLAGP AN + AI+  TF   FY 
Sbjct: 61  CIFPFGGFVRMQHHSQDFASDRRSYNNQPIINRMLIVLAGPAANFIFAIVALTFLNNFYG 120

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             ++  VV +V   S A  AG+ K D I  + G+ V  F ++   V   P   I LVL R
Sbjct: 121 KYIISSVVDHVILESAAEKAGIMKSDIITEVAGVKVRNFLDLVQVVFNYPEVPIELVLER 180

Query: 175 EHVGVLHLKVMP-----RLQDTVDRFG-IKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
           ++  ++ + V+P     +L D+  R G +  +   + I  S+ ++ L S     +++ G+
Sbjct: 181 DN-KLMKINVVPHAKLYKLNDSEIRLGDLGVRGKLIRIKSSFIDSILES----VNYTFGV 235

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
            ++       + +     GKD  + +I G VGIA+ +        ++++ FL   S ++G
Sbjct: 236 SKLI-----LIALWQKLTGKDA-IAEIVGVVGIAQESSKAMCRSIDSFLLFLVNLSISLG 289

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGK-SLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
            MNLLPI  LDGG  +  + EMI GK S+ + V  +  ++G+ II+FL  + I NDI  L
Sbjct: 290 VMNLLPILPLDGGRFLYLVYEMIVGKGSINLMVYNIAMKIGVAIIIFLIVISISNDIKNL 349

Query: 348 M 348
           +
Sbjct: 350 L 350


>gi|78222471|ref|YP_384218.1| peptidase RseP [Geobacter metallireducens GS-15]
 gi|78193726|gb|ABB31493.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Geobacter
           metallireducens GS-15]
          Length = 355

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 104/342 (30%), Positives = 173/342 (50%), Gaps = 12/342 (3%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           + L I++ +HEFGH++ A+L  + V  FS+GFGP+LIG        + +S  PLGGYV  
Sbjct: 9   IVLGILIFVHEFGHFLFAKLFGVGVEKFSLGFGPKLIG-KKMGETEYLISAFPLGGYVKM 67

Query: 72  S--------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVV 122
                     DE+  RSF   +P ++I  V+AGP  N + A  +F   F          +
Sbjct: 68  VGEGGGDELSDEEKARSFGEKSPLRRIGIVVAGPGFNLIFAWFVFIAVFMVGVPSATTKI 127

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
             V    PAA AG+  GD I +++G  V  +EE+A  +  +    + LV  +        
Sbjct: 128 GEVVKDKPAAKAGIVAGDRITAVNGKKVDRWEEMATEIAASKGPSL-LVEIKRGGETKAF 186

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVL 242
           ++ P ++   +  G     P +G+  +  ET +      ++FSRG  +  ++    +  L
Sbjct: 187 QLKPEMRTGKNLLGETVTSPVIGV-VAAGETVIDRYPPGEAFSRGSVQTWNVIELTVLSL 245

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
                +   L+ I GP+ IA++A    + G  +++AF+A+ S  +G +NLLPIPILDGGH
Sbjct: 246 VRIIERAIPLDTIGGPIMIAKMAGQQAEAGGVSFLAFMALLSVNLGVLNLLPIPILDGGH 305

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L  +L E+I  + + +    +  ++GL +++ L  L   NDI
Sbjct: 306 LFFYLWELIFRRPVSMRAREIAQQVGLALLIGLMVLAFYNDI 347


>gi|303228541|ref|ZP_07315369.1| RIP metalloprotease RseP [Veillonella atypica ACS-134-V-Col7a]
 gi|302516788|gb|EFL58702.1| RIP metalloprotease RseP [Veillonella atypica ACS-134-V-Col7a]
          Length = 338

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/342 (30%), Positives = 175/342 (51%), Gaps = 25/342 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +IV IHE GH++ A+L  +RV  F++GFGP L+         + V  IPLGG+      +
Sbjct: 13  LIVFIHELGHFITAKLSGMRVDEFAIGFGPVLLK-KQYGETLYSVRCIPLGGFNRIAGMT 71

Query: 73  EDEK-DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM----KPVVSNVSP 127
            DE  D  SF+    +KK++ + AG + N ++AI+ +       G M    KP++ +V  
Sbjct: 72  PDEPLDDGSFYTKPAYKKLIVISAGAIFNFLLAIVIYFGLNATVGTMVSTDKPIIGSVIT 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
              A +  ++ GD I+S+D   +S + E++  ++    H +++V+ R    V    V+P+
Sbjct: 132 GGAADLGKLQGGDIILSIDNQPISKWSEISERLKGTANHGVTVVVNRNGETV-ETTVIPK 190

Query: 188 LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL-GVLSSAF 246
           ++         +  P +GI  +Y ET  HS  +  SF   + +   I    + G+     
Sbjct: 191 ME---------KDTPKLGIYQAY-ETIPHS--IGDSFILAVQKTGYIIVAMVDGLREMVV 238

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
           G  T   ++SGPVGI+ +A +    GF   ++F A+ S  +G +NLLP+P+LDGGHLI  
Sbjct: 239 G--TEQAEVSGPVGISHMAGSIAQQGFAPLLSFAALLSINLGVINLLPLPVLDGGHLIII 296

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           L+E I  + L       I  +G+ +++ +F      DI  L+
Sbjct: 297 LIEAITRRKLPAKALMYIQMIGIALLVTIFVYATAKDILQLL 338


>gi|251772090|gb|EES52660.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Leptospirillum ferrodiazotrophum]
          Length = 355

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 108/358 (30%), Positives = 178/358 (49%), Gaps = 28/358 (7%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L + + + ++++IHE GH++VAR   +++  FSVGFGP +   T      ++VS I
Sbjct: 1   MSAVLSFILVIGVLILIHELGHFLVARRFGVKIEKFSVGFGPPIFSKTVGE-TEYRVSWI 59

Query: 64  PLGGYVSFSED--------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT 115
           PLGGYV    +        E   RSF   +  +++    AGP+AN ++AIL F+  ++ T
Sbjct: 60  PLGGYVKMLGETDPEKVAPEDRPRSFAALSVSRRMGIAAAGPVANFLLAILLFSAVYW-T 118

Query: 116 G--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
           G  VM+ VV  V P SPA  AG+ KGD I ++DG+ ++ ++++   +       + + + 
Sbjct: 119 GFPVMEAVVGQVLPGSPAQAAGIMKGDRITTVDGVKIARWDDLRHMIEHRGGQSVVIGIL 178

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD---- 229
           R     L   ++PR++   + FG   +   +G+  S   T L        FS GL     
Sbjct: 179 RGGQ-PLSFTLVPRVESGKNLFGEAERQGKIGVGPSGSFTTLR-----YGFSEGLGMAMI 232

Query: 230 ---EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
               I+SI    L  L      +     + GP+ IA+++      G +  + F+   S  
Sbjct: 233 KTWNIASIN---LVSLWKMVAGEVSPKNLGGPILIAQMSAKAAKSGVSNLLFFMGFVSVT 289

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +G MNLLPIP+LDGGHL+   +E I  +   V V  +  ++G  I+L +      NDI
Sbjct: 290 LGVMNLLPIPVLDGGHLLFLAVEGILRRPPSVRVRELSMQLGFVILLTVMVFAFYNDI 347


>gi|258541751|ref|YP_003187184.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632829|dbj|BAH98804.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635886|dbj|BAI01855.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638941|dbj|BAI04903.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-07]
 gi|256641995|dbj|BAI07950.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645050|dbj|BAI10998.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648105|dbj|BAI14046.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651158|dbj|BAI17092.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654149|dbj|BAI20076.1| zinc metallopeptidase [Acetobacter pasteurianus IFO 3283-12]
          Length = 370

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 100/361 (27%), Positives = 175/361 (48%), Gaps = 25/361 (6%)

Query: 3   WLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           +L   L +   L ++V  HE GHY+ A+   + V  FS+GFGP L     +SG  W+V  
Sbjct: 6   YLRTLLSFVFVLGVLVSFHELGHYLAAKWRGVHVEVFSLGFGPALFRWRDKSGTEWRVCP 65

Query: 63  IPLGGYVSFS--EDEKDM-----------RSFFCAAPWKKILTVLAGPLANCVMAILFFT 109
           IPLGGYV     ED +D            R+F   + + + + +LAGP+ N ++A + F 
Sbjct: 66  IPLGGYVRPHGFEDPEDATPEQKAAWIKGRTFHDKSVFSRAIVILAGPIFNFILAFVLFA 125

Query: 110 FFFYNTGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE 167
             F  TG   ++  ++ V P   AA+AGV++GD I  +    V+  E++   +      +
Sbjct: 126 LLFATTGQPHVRDQIATVMPNGAAAVAGVQQGDVIQRIGSHDVTGVEDIQATISTQAGAQ 185

Query: 168 ISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKL--HSRTVLQSFS 225
            +L + R    V     + +  D+      ++    +GI F+ +  K     + V+    
Sbjct: 186 TTLTVKRGEQSVTLPITIGKAPDSTP----QKPHGQLGIIFATEVGKPLPFPQAVVAGVK 241

Query: 226 RGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSW 285
              +       G   +LS   G+ T    + GP+ IA+++     +GF + ++F+A+ S 
Sbjct: 242 ATWNASVQTLDGVWQILS---GQHTA-KDLGGPLKIAQLSGQVAQYGFASLLSFMALLSV 297

Query: 286 AIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
            +G +NL P+P+LDGG L+ + +E IRG+ +   V  +  ++G  ++  LF     ND+ 
Sbjct: 298 NLGLINLFPVPLLDGGRLVFYAIEAIRGRPVSKRVQEISFQVGFALLAGLFLFSTFNDLS 357

Query: 346 G 346
           G
Sbjct: 358 G 358


>gi|218780998|ref|YP_002432316.1| membrane-associated zinc metalloprotease [Desulfatibacillum
           alkenivorans AK-01]
 gi|218762382|gb|ACL04848.1| membrane-associated zinc metalloprotease [Desulfatibacillum
           alkenivorans AK-01]
          Length = 359

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 103/339 (30%), Positives = 175/339 (51%), Gaps = 17/339 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVR-WKVSLIPLGGYVSF---- 71
           ++  HE GH++ ARL  + V +FS+GFGP L G   +SG+  ++VS +PLGGYV      
Sbjct: 14  LIFFHELGHFLAARLLGVGVETFSLGFGPRLFG--KKSGMTDYRVSAVPLGGYVKMVGED 71

Query: 72  ---SEDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAI-LFFTF-FFYNTGVMKPVVSNV 125
               E+ +D    F   P WK+I  V AGP+ N ++A+ +FFT  FF        ++  V
Sbjct: 72  PDSDEEPEDTSISFSHKPVWKRITIVAAGPVFNFLLAVVIFFTIGFFSGVDHTTNILDRV 131

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
              SPAA AG+ +GD ++S++GI +  F +V+  + +N    +++V+ R     L   V+
Sbjct: 132 VEDSPAAQAGMLEGDEVLSVNGIAIENFRQVSAEINKNSGEPVNIVVGRNGEE-LSFTVI 190

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           P+  +  + FG   +   VGIS   D         + S    +++     +     L   
Sbjct: 191 PKETEGKNAFGEDVKAYKVGISNRVDFVPYEP---INSAVYAVEQTWFFVKFTFQALFKF 247

Query: 246 FGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLIT 305
             +   L+ + G + I +++    + G  +++  +A+ S  +G +NL P+PILDGGH++ 
Sbjct: 248 VDRSIPLDNLGGVILITQVSGVAAEAGLTSFLFIMALLSVNLGIINLFPVPILDGGHILF 307

Query: 306 FLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           F +E I  K L + V  V  ++GL  ++FL  +    DI
Sbjct: 308 FAIEGIMRKPLSLRVREVAMQVGLAALIFLMIMVFYFDI 346


>gi|328954561|ref|YP_004371895.1| membrane-associated zinc metalloprotease [Desulfobacca acetoxidans
           DSM 11109]
 gi|328454885|gb|AEB10714.1| membrane-associated zinc metalloprotease [Desulfobacca acetoxidans
           DSM 11109]
          Length = 355

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 185/359 (51%), Gaps = 21/359 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPEL----IGITSRSGVRWK 59
           ++  L   V + +++ +HE GH++VA+   + V +FS+GF P L    +G T      ++
Sbjct: 1   METILATVVVIGVLIFVHELGHFLVAKYYGVGVEAFSLGFPPRLFHKKVGETD-----YR 55

Query: 60  VSLIPLGGYVSF-SEDEKD------MRSFFCAAPWKKILTVL-AGPLANCVMAILFFTFF 111
           +S+IPLGGYV    E+  +      +   F   P K+   ++ AGP AN + +I+  +  
Sbjct: 56  ISVIPLGGYVKMVGENPGEEIPPELLPKSFSHRPLKQRFAIVAAGPFANLLFSIVALSLV 115

Query: 112 FYNTGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
           F  +G+      +  + P SPA  AG++KGD I+S++   V  +EE++  +R +    ++
Sbjct: 116 FTFSGMPFFNAEIGGIQPNSPAEEAGLQKGDLILSINDQPVQRWEELSRIIRGSGDTPLT 175

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
           L+ +R       + + PR  +T + FG K     +G+S + +  ++     L ++  G+ 
Sbjct: 176 LI-FRRGDRTEQITITPRTMETSNIFGEKVSARLIGVS-APERYEIERVDPLSAWWHGVT 233

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
               I    +  +     + T L  + GP+ IA++A    + G +  + F+A+ S  +  
Sbjct: 234 YSYRILEVTVLSVVKLITQKTPLTSLGGPIMIAQVAGKQAEQGVSHLVHFMAVLSINLFL 293

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +NLLPIP+LDGGHLI F++E +RG+ + +    +   +GL  IL L F     DI  L+
Sbjct: 294 LNLLPIPMLDGGHLIFFMVEAVRGRPIAMKHREIAQAIGLTFILMLMFFVFYQDIMRLL 352


>gi|303232064|ref|ZP_07318767.1| RIP metalloprotease RseP [Veillonella atypica ACS-049-V-Sch6]
 gi|302513170|gb|EFL55209.1| RIP metalloprotease RseP [Veillonella atypica ACS-049-V-Sch6]
          Length = 338

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 103/342 (30%), Positives = 175/342 (51%), Gaps = 25/342 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +IV IHE GH++ A+L  +RV  F++GFGP L+         + V  IPLGG+      +
Sbjct: 13  LIVFIHELGHFITAKLSGMRVDEFAIGFGPVLLK-KQYGETLYSVRCIPLGGFNRIAGMT 71

Query: 73  EDEK-DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM----KPVVSNVSP 127
            DE  D  SF+    +KK++ + AG + N ++AI+ +       G M    KP++ +V  
Sbjct: 72  PDEPLDDGSFYTKPAYKKLIVISAGAIFNFLLAIVIYFGLNATVGTMVSTDKPIIGSVIT 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
              A +  ++ GD I+S+D   +S + E++  ++    H +++V+ R    V    V+P+
Sbjct: 132 GGAADLGKLQGGDIILSIDNQPISKWSEISERLKGTANHGVTVVVNRNGETV-ETTVIPK 190

Query: 188 LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL-GVLSSAF 246
           ++         +  P +GI  +Y ET  HS  +  SF   + +   I    + G+     
Sbjct: 191 ME---------KDTPKLGIYQAY-ETIPHS--IGDSFILAVQKTGYIIVAMVDGLREMVV 238

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
           G  T   ++SGPVGI+ +A +    GF   ++F A+ S  +G +NLLP+P+LDGGHLI  
Sbjct: 239 G--TEQAEVSGPVGISHMAGSIAQQGFAPLLSFAALLSINLGVINLLPLPVLDGGHLIII 296

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           L+E I  + L       I  +G+ +++ +F      DI  L+
Sbjct: 297 LIEAITRRKLPPKALMYIQMIGIALLVTIFVYATAKDILQLL 338


>gi|322420119|ref|YP_004199342.1| membrane-associated zinc metalloprotease [Geobacter sp. M18]
 gi|320126506|gb|ADW14066.1| membrane-associated zinc metalloprotease [Geobacter sp. M18]
          Length = 367

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 103/343 (30%), Positives = 174/343 (50%), Gaps = 13/343 (3%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++L  ++ IHE GH++ A+   + V  FS+GFGP+L+         + VS +PLGGYV  
Sbjct: 20  IALGALIFIHELGHFIFAKTFKVGVEKFSLGFGPKLVS-KQVGETEYLVSALPLGGYVKM 78

Query: 72  SED-------EKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPV 121
             +       E+D R  F   P  ++I+ V AGP+ N + A + F   +   GV  +   
Sbjct: 79  VGEGDDVELSEEDRRRSFADKPVLQRIVIVAAGPVFNLLFAYVIFIVIYMFLGVPSVTTK 138

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V  V P  PAA AG+K GD I S+DG  VS ++E    + E     + + + R    +L 
Sbjct: 139 VGEVLPDKPAARAGIKAGDAIRSVDGRPVSRWDEFHRMIIEGKAAPVRIEVQRGE-SLLK 197

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
             ++P  + + +  G     P +G+  +  ET +      ++  +G  +  ++    +  
Sbjct: 198 FDMVPERRTSKNLLGDTVTQPVIGV-VAAGETVIDHFPPGEAIVKGSTQCWNVIELTVLS 256

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           L     +   L+ I GP+ I ++A      G  +++AF+A+ S  +G +NLLP+PILDGG
Sbjct: 257 LVRLVERAIPLDNIGGPIMIVKMAGEQAAAGGVSFLAFVALLSVNLGVLNLLPVPILDGG 316

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           HL  FL+E++ GK +      +  ++GL +++ L  L   NDI
Sbjct: 317 HLAFFLIELVTGKPVSKRTREIAQQVGLVLLISLMMLAFYNDI 359


>gi|222054613|ref|YP_002536975.1| membrane-associated zinc metalloprotease [Geobacter sp. FRC-32]
 gi|221563902|gb|ACM19874.1| membrane-associated zinc metalloprotease [Geobacter sp. FRC-32]
          Length = 356

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 103/343 (30%), Positives = 172/343 (50%), Gaps = 14/343 (4%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++L  ++ IHE GH++ A+   + V  FS+GFGP++IG        + +S  PLGGYV  
Sbjct: 9   IALGALIFIHELGHFIFAKWFGVGVDKFSLGFGPKIIG-KKIGETEYLLSAFPLGGYVKM 67

Query: 72  ---SED-----EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV-- 121
               ED     E   RSF    P ++I+ V AGPL N + A   F    Y  GV      
Sbjct: 68  VGEGEDAELTEEDKARSFAAKPPLQRIVIVAAGPLFNLLFAYFIF-IIVYMVGVPAATTK 126

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           +  V    PAA AGV+  D + +++G  V+ +EE++  + E     + L + RE    L+
Sbjct: 127 IGEVVKDKPAARAGVQAKDMVTAINGKVVNRWEELSSTIIEGKGQPVELQVQREG-KTLN 185

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
            ++ P  +   +  G     P +GI  S  E  +     + +F++G  +  ++ +  +  
Sbjct: 186 FRITPEKRTAKNLLGDTVTTPVLGI-VSAGEIVIDHFGPVDAFTKGSAQTWNVIKITVLS 244

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           L     +   L+ I GP+ I ++A      G  +++AF+A+ S  +G +NLLP+PILDGG
Sbjct: 245 LVKLVERAIPLDTIGGPIMIVKMAGQQAAEGSVSFLAFVALLSVNLGILNLLPVPILDGG 304

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           HL  +L E++  K +      +  ++GL +++ L  L   NDI
Sbjct: 305 HLFFYLWEIVFRKPISPKAREIAQQIGLVLLISLMVLAFYNDI 347


>gi|256544691|ref|ZP_05472063.1| zinc metalloprotease [Anaerococcus vaginalis ATCC 51170]
 gi|256399580|gb|EEU13185.1| zinc metalloprotease [Anaerococcus vaginalis ATCC 51170]
          Length = 337

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 157/330 (47%), Gaps = 24/330 (7%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   ++  +  + +++IHEFGH+++A+   IRV  F++G GP++     +    + V+L 
Sbjct: 1   MKSVIISIIMFLFLILIHEFGHFIIAKKSGIRVNEFAIGMGPKIFS-KQKGETLYSVNLF 59

Query: 64  PLGGYVSFS-EDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
           P+GGY +   ED +  D RSF  A  +K+  T+LAGPL N + A L F F  +NTG    
Sbjct: 60  PIGGYCAMEGEDSESDDERSFDKAPAYKRFFTILAGPLTNLIFAGLIFAFVSFNTGTAST 119

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAP-----YVRENPLHEISLVLYRE 175
            + N +  SP    G K  D I+ +DG  ++ F +++      Y +     +ISL + R+
Sbjct: 120 SIGNFTKNSPIEAQGFKVDDEIVEIDGNKINNFNDISKNLENYYQKHGKNDKISLKVKRD 179

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
           +   +   V  + ++     G   +   VG                +S   G  E+ S+ 
Sbjct: 180 N-KYIEKNVKVKFENKRPLLGFIPKNKDVGF--------------FESIKIGFKEVGSMI 224

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
              + VL S F      + +SGPVG+ +      + G    + FL   S  +GF NLLPI
Sbjct: 225 VLMINVLKSLFTGKLGFSALSGPVGVVKEMGRQANLGIMNLLFFLGYISVNLGFFNLLPI 284

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVIT 325
           P LDG  + T L EMI  K++   +    T
Sbjct: 285 PALDGSKIFTSLFEMITKKTVNKKIEEKFT 314


>gi|258645588|ref|ZP_05733057.1| RIP metalloprotease RseP [Dialister invisus DSM 15470]
 gi|260402946|gb|EEW96493.1| RIP metalloprotease RseP [Dialister invisus DSM 15470]
          Length = 340

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 111/337 (32%), Positives = 171/337 (50%), Gaps = 23/337 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS----EDEK 76
           HE GH+ +A+L  ++V  F+VGFGP+++    +    + +  IPLGGY   +    +D  
Sbjct: 19  HEGGHFFMAKLTGMKVDEFAVGFGPKIVSF-RKGETLYSLRAIPLGGYNKIAGMNRDDLD 77

Query: 77  DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK----PVVSNVSPASPAA 132
           D R+F     W K+L +  G L N ++A   FT  F   G+      PV  +V   S AA
Sbjct: 78  DPRAFRQRPTWAKLLVIAGGALFNILLAFFIFTAIFSVNGIHTFKDVPVAGSVLEESSAA 137

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            AG+K GD IIS++G  V  +E++   V +     +S+V+  E V    + V+P+     
Sbjct: 138 RAGIKAGDKIISINGEKVERWEDIGRIVSDKAGRVLSVVIDSEGVKK-TVTVIPKDN--- 193

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
              G  R +  +  S   ++  L  R V     R +  +  +  G   +L+ A       
Sbjct: 194 ---GEGRAIMGITPSVEKEDVSLD-RAVSLGAERCVYILKMMVAGLADILAGAEA----- 244

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
             ++GP+G+AR+A    D G  A  AF+A+ S  +GF+NLLPIP+LDGG LI  L+E I 
Sbjct: 245 -GVAGPIGVARMAGTVADSGMTALFAFIALLSLNLGFLNLLPIPLLDGGLLILTLIEGIS 303

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           GK L       I  +G+ II F+F   + ND+  LM+
Sbjct: 304 GKELPERALYYIQAVGIIIIGFIFLFAMCNDVMSLMK 340


>gi|315651643|ref|ZP_07904654.1| M50A family metalloprotease [Eubacterium saburreum DSM 3986]
 gi|315486097|gb|EFU76468.1| M50A family metalloprotease [Eubacterium saburreum DSM 3986]
          Length = 345

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 103/343 (30%), Positives = 168/343 (48%), Gaps = 28/343 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---S 72
           +IV+IHEFGH++ A+L  ++V+ FSVG GP L  I  +   ++ + L+PLGG        
Sbjct: 12  VIVLIHEFGHFLFAKLSGVKVVEFSVGMGPRLFSINGKE-TKYSLKLLPLGGSCQMYGED 70

Query: 73  EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           EDE +  SF  A    +I T+ AGP+ N ++A     F   N GV KPV+SN+    PA 
Sbjct: 71  EDEDEQGSFNSAPLIGRIATIAAGPVFNFILAFFVAIFIVSNVGVDKPVISNLMDGLPAQ 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            +G++KGD I  ++G  V  + +++ Y+  +   +I+L + R       + + P   +  
Sbjct: 131 SSGLQKGDEIKKINGKNVDFYRDLSTYLFLHQGKDITLTVKRNGNEEKSITITPVYNEKY 190

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQ---SFSRGLDEISSITRGFLGVLSSAFGKD 249
            ++ I   + S G     +  ++   +VL+   + S  +D +  +  G            
Sbjct: 191 SQYMIG--IESSGYQKLKNPIEVLKYSVLEVKYTVSTTIDSLLYLLHG-----------K 237

Query: 250 TRLNQISGPVGIARIAKNFFDHG--FNAYIAFLA------MFSWAIGFMNLLPIPILDGG 301
              N+ISGPVGI  +  N  +    +  ++  L+      + S  +G MNLLP+P LDGG
Sbjct: 238 ANANEISGPVGIVSMIGNTVNESKPYGIFVVLLSLSQMVLLLSANLGVMNLLPLPALDGG 297

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            LI   LE I  + L   V   I   G  +++ L    + NDI
Sbjct: 298 RLIFLFLEAIFRRPLNRKVEGYIHLAGFALLMILMVFVMFNDI 340


>gi|329114463|ref|ZP_08243225.1| Putative zinc metalloprotease [Acetobacter pomorum DM001]
 gi|326696539|gb|EGE48218.1| Putative zinc metalloprotease [Acetobacter pomorum DM001]
          Length = 370

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 99/360 (27%), Positives = 176/360 (48%), Gaps = 23/360 (6%)

Query: 3   WLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           +L   L +   L ++V  HE GHY+ A+   + V  FS+GFGP L     +SG  W++  
Sbjct: 6   YLRTLLSFVFVLGVLVSFHELGHYLAAKWRGVHVEVFSLGFGPALFRWRDKSGTEWRICP 65

Query: 63  IPLGGYVSFS--EDEKDM-----------RSFFCAAPWKKILTVLAGPLANCVMAILFFT 109
           IPLGGYV     ED +D            R+F   + + + + +LAGP+ N ++A + F 
Sbjct: 66  IPLGGYVRPHGFEDPEDATPEQKAAWIKGRTFHDKSVFSRAIVILAGPIFNFILAFVLFA 125

Query: 110 FFFYNTGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE 167
             F  TG   ++  ++ V P   AA+AGV++GD I  +    V+  E++   +      +
Sbjct: 126 VLFATTGQPHVRDQIATVMPNGAAAVAGVQQGDVIQRIGSHDVTGVEDIQASISTQAGAQ 185

Query: 168 ISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRG 227
            +L + R    V     + +  D+      ++    +GI F+ +  K       Q+   G
Sbjct: 186 TTLTVKRGEQSVTLPITIGKAPDSTP----QKPHGQLGIIFATEVGK--PLPFPQAVVAG 239

Query: 228 LDEI-SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
           +    ++  +   GV     G+ T    + GP+ IA+++     +GF + ++F+A+ S  
Sbjct: 240 VKATWNASVQTLDGVWQILTGQHTA-KDLGGPLKIAQLSGQVAQYGFASLLSFMALLSVN 298

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYG 346
           +G +NL P+P+LDGG L+ + +E IRG+ +   V  +  ++G  ++  LF     ND+ G
Sbjct: 299 LGLINLFPVPLLDGGRLVFYAIEAIRGRPVSKRVQEISFQVGFALLAGLFLFSTFNDLSG 358


>gi|212704269|ref|ZP_03312397.1| hypothetical protein DESPIG_02324 [Desulfovibrio piger ATCC 29098]
 gi|212672349|gb|EEB32832.1| hypothetical protein DESPIG_02324 [Desulfovibrio piger ATCC 29098]
          Length = 375

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/360 (28%), Positives = 173/360 (48%), Gaps = 26/360 (7%)

Query: 8   LLYTVSLIIIVV-----IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVS 61
           +L T+   IIV+      HE GH+ VAR   + V +FS+GFGP+L+    R G   + +S
Sbjct: 1   MLTTIVAAIIVLGGLIFFHELGHFTVARWLGMGVSTFSLGFGPKLL--KYRHGKTEYALS 58

Query: 62  LIPLGGYVSF--SEDEKDMRSFFCAAP-------WKKILTVLAGPLANCVMAILFFTFFF 112
           L+PLGGYV+     DE D+ S F           W++ L + AGP AN ++A +      
Sbjct: 59  LVPLGGYVALVGENDENDIPSGFTREECFSLRPAWQRFLVIAAGPFANILLACILCWVVA 118

Query: 113 YNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
           +  G  VM P V  V P S AA AG++KGD I+S+DG  +S+++E++P V       ++L
Sbjct: 119 WGWGNTVMLPQVGTVMPQSAAAQAGLQKGDLILSIDGQALSSWDEISPTVAAANGRPLTL 178

Query: 171 VLYREHV------GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSF 224
            + R+          L L + P+       FG   +   +GI       ++      ++ 
Sbjct: 179 TVARQPAEGMTQGTELELTLTPQWSTRKTIFGEDEKAWLIGIG-PLGSVRVEELGFAEAL 237

Query: 225 SRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFS 284
             GL +   +             +    +Q+ GP+ IA++     + G    +   A+ S
Sbjct: 238 ETGLVQTWRLVDLTWQSFVKLAQRVVPADQVGGPIMIAQMVGQQAEQGLVGVLGLAALIS 297

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             +  +NLLP+P+LDGG ++  L+EMI  + +   +     R+G+ ++L L      ND+
Sbjct: 298 INLAILNLLPVPVLDGGQMLFCLIEMIFRRPVPQKIQEWGMRVGMALLLSLMIFATFNDV 357


>gi|296273660|ref|YP_003656291.1| membrane-associated zinc metalloprotease [Arcobacter nitrofigilis
           DSM 7299]
 gi|296097834|gb|ADG93784.1| membrane-associated zinc metalloprotease [Arcobacter nitrofigilis
           DSM 7299]
          Length = 350

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/346 (30%), Positives = 174/346 (50%), Gaps = 21/346 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED- 74
           +V  HE GH++ AR   I+V  FS+GFG +L       G  W+ +LIPLGGYV    +D 
Sbjct: 13  LVFFHELGHFLAARYFGIKVEVFSIGFGKKLFS-KQWMGTSWQFALIPLGGYVKMKGQDD 71

Query: 75  ------EKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNVSP 127
                 E    S+    PW++I+ + AGP AN V+A IL+F         + P +  V P
Sbjct: 72  TKPGLVEAGNDSYNNKKPWQRIIILFAGPFANFVLAAILYFAIAMIGANALSPTIGQVVP 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM-P 186
            SPAA AG+K  D I+ ++   V  + EV  Y+ ++   + +L  Y +  GV+  +++ P
Sbjct: 132 NSPAAKAGLKVNDEILRINNTDVKQWNEVGKYIVQS---KGALQFYIKRDGVVITRIINP 188

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLH---SRTVLQSFSRGLDEISSITRGFLGVLS 243
            + D+ + F  K +   +GI+ +    KL+      ++ ++ R ++    I +G   ++ 
Sbjct: 189 HISDSENIFKEKIKKRMIGIAPAPKVIKLNLSPIEALVFAYDRTVESSKMIFKGVQKLIQ 248

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
                    +++ G + I ++          A ++  A+ S  +G +NLLPIP LDGGH+
Sbjct: 249 GVIPS----SEVGGVITIGKVISEASQSSIIALLSITALISVNLGVLNLLPIPALDGGHI 304

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           +  L E+I  +     V   +T +G  I+  L  LGI NDI  L++
Sbjct: 305 MFNLYEIIARRKPSDKVFMYLTVVGWVILGSLMLLGIYNDISRLLK 350


>gi|229829205|ref|ZP_04455274.1| hypothetical protein GCWU000342_01292 [Shuttleworthia satelles DSM
           14600]
 gi|229792368|gb|EEP28482.1| hypothetical protein GCWU000342_01292 [Shuttleworthia satelles DSM
           14600]
          Length = 344

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 111/339 (32%), Positives = 167/339 (49%), Gaps = 29/339 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGV-RWKVSLIPLGGY-VSFSEDEK-- 76
           HE GH++ AR C ++V  F +GFGP++IG T    +  W+  LIP GG  V   ED++  
Sbjct: 17  HELGHFLTARACGVKVNEFCLGFGPKIIGFTKGETLYAWR--LIPFGGACVMEGEDQESD 74

Query: 77  DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGV 136
           + R+F     W++ L VL GP+ N ++A +         GVMKP +  V    PA  AG+
Sbjct: 75  NDRAFGNKPVWQRFLIVLMGPMFNFLLAFILSAILLAAIGVMKPKIGGVMEDYPAQEAGL 134

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM-PRLQDTVDRF 195
           + GD I +L G  V  ++E++ YV  +    IS+   RE  G  H   + PR  +   R+
Sbjct: 135 EAGDEITALGGHRVYFYQEISAYVFFHGKEAISVTYTRE--GQNHQTTLIPRYDEESKRY 192

Query: 196 GIKRQVPSVGISFSYDETKLHSRTVL-QSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQ 254
            I  Q PS       D  KL +  +   SF     +I +  +    +++        L Q
Sbjct: 193 LIGIQGPS-------DYEKLSAGQIAGYSFHEIRYQIYNTAKSLQFLVTG----QVSLRQ 241

Query: 255 ISGPVGIARIAKNFFDHGF--NAYIAFLAMFSWAI------GFMNLLPIPILDGGHLITF 306
           ISGPVGI +   + +       A+  F+ M S AI      G MNLLP P LDGG L+ F
Sbjct: 242 ISGPVGIVKTIGDTYQQSARDGAFYIFVNMLSIAILLTANLGVMNLLPFPALDGGRLVFF 301

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           L+EMIR K     +   +   G  +++ L  L + +D++
Sbjct: 302 LIEMIRRKPAPQKLEGYVNMAGFVLLMGLMILVVFSDLF 340


>gi|307243227|ref|ZP_07525398.1| RIP metalloprotease RseP [Peptostreptococcus stomatis DSM 17678]
 gi|306493355|gb|EFM65337.1| RIP metalloprotease RseP [Peptostreptococcus stomatis DSM 17678]
          Length = 336

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/302 (31%), Positives = 153/302 (50%), Gaps = 18/302 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           +I+ +HE GH+++A+   + +  FS+G GP++    S+ G+++ + +IP+GGYV+     
Sbjct: 12  LIIFVHELGHFLLAKRAGVTIHEFSIGMGPQIFSKESQ-GIKYSLRMIPIGGYVAMEGED 70

Query: 73  EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           ED  D  SF   +   + LT+ AGP  N V  I+     F+  G      S V   SPAA
Sbjct: 71  EDSDDPNSFGKKSLKDRFLTIFAGPFVNIVFCIILLVPVFFFIGAPTTKFSQVISKSPAA 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE-HVGVLHLKVMPRLQDT 191
           +AG++K D I+S++G     F +++  V +    E+++   R+ HV  + LK     Q+ 
Sbjct: 131 LAGLQKNDVILSINGEKTKEFNDISKLVNKYGKEELTIKYKRKNHVDTVKLKA----QNQ 186

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
             R+        VGI  +Y+  +   + V Q+F    D  S     FL  L S       
Sbjct: 187 GGRY-------IVGIQPAYERNQ-PIKAVKQAFVVTYDT-SKTMLSFLWKLVSGQLSGKA 237

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
            + ISGPVG+ ++  N    G    +   A+ S  IG MNLLPIP LDG  ++  L+E +
Sbjct: 238 ADAISGPVGVVKMVSNAATTGLINVLYLTAIISLNIGLMNLLPIPALDGWRILMLLIEAL 297

Query: 312 RG 313
           RG
Sbjct: 298 RG 299


>gi|148240242|ref|YP_001225629.1| membrane-associated Zn-dependent protease [Synechococcus sp. WH
           7803]
 gi|147848781|emb|CAK24332.1| Predicted membrane-associated Zn-dependent protease [Synechococcus
           sp. WH 7803]
          Length = 362

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 161/320 (50%), Gaps = 32/320 (10%)

Query: 18  VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE---- 73
           +VIHE GH++ ARL  IRV  FSVGFGP L+  T R+GV + + L+PLGG+VSF +    
Sbjct: 14  IVIHEAGHFLAARLQGIRVNGFSVGFGPALL-KTERNGVTYALRLLPLGGFVSFPDDDDD 72

Query: 74  -------DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM-KP----V 121
                  D+ D+         +++L + AG LAN ++A L         GV   P    V
Sbjct: 73  NDQSIPLDDPDL--LRNRPIPQRVLVISAGVLANLLLAWLVLVGHTAAAGVPGDPAPGVV 130

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITV----SAFEEVAPYVRENPLHEISLVLYREHV 177
           V  V   +PAA AG++ GD I+S+D  T+    SA       +R +P  ++ L + R   
Sbjct: 131 VMTVQDGAPAAQAGLRPGDRILSIDAQTLGSGESAVRAAVEPIRRSPGQKLELEVQRGEA 190

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI-TR 236
            V  L++ P  Q    R G + QV   G S          R+ L++ S G  + +S+ +R
Sbjct: 191 -VSTLRLTPADQQGTGRIGAQLQVAMGGGSRPV-------RSPLEAISAGSRQFASLFSR 242

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
              G  S      +   Q+SGPV I  +       G +    FLA+ S  +G +N LP+P
Sbjct: 243 TVSGYASLFTDFSSTAQQVSGPVKIVEMGAQLSSQGGSGLALFLALISINLGVLNALPLP 302

Query: 297 ILDGGHLITFLLEMIRGKSL 316
           +LDGG L+  LLE +RG+ L
Sbjct: 303 LLDGGQLVFLLLEGLRGRPL 322


>gi|78777432|ref|YP_393747.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Sulfurimonas denitrificans DSM 1251]
 gi|78497972|gb|ABB44512.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Sulfurimonas
           denitrificans DSM 1251]
          Length = 350

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 108/357 (30%), Positives = 185/357 (51%), Gaps = 23/357 (6%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
            FL+    L  ++  HE GHY  AR   +R+  FS+GFG + I   +R G  W+++LIPL
Sbjct: 2   SFLISLAVLSALIFFHELGHYFAARAMGVRIEVFSIGFGKK-IASFNRWGSEWRLALIPL 60

Query: 66  GGYVSFS-EDEKD-------MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG- 116
           GGYV    +D+ D         S+    P +KI  +LAGPLAN V+A  FF +F    G 
Sbjct: 61  GGYVRMKGQDDSDPTKKSYDNDSYNVKTPLQKIFILLAGPLANFVLA--FFLYFVIALGG 118

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL-Y 173
             ++  V+  V   SPA  A ++  D I S++G+ ++ +EE+A ++    L + SL L  
Sbjct: 119 PNILSAVIGKVVENSPAHAAALETNDTIRSINGVEITTWEEMAKFIE---LSDGSLKLEV 175

Query: 174 REHVGVLHLKVMPRLQDTVDRFG--IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
           +    +  + + P++  T + F   I++++  +G +    +  L     L   ++    I
Sbjct: 176 QRGKEIKQIILTPKITQTTNIFNEVIEKKMIGIGSAGVTHKLNLGISETLSYATK--QTI 233

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
            + T  F G+    FG +   N++ G + I ++  +  + G+ + + F A+ S  +G +N
Sbjct: 234 FASTLIFSGLKKLLFG-EVPANELGGVISIVKLTSDASEAGWMSVLFFAALISVNLGVLN 292

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDGGH++  L E +  + +  ++   +T +G  I+  L  LG+ NDI  L+
Sbjct: 293 LLPIPALDGGHIMFNLYEFLFRREVNEAIMIKLTIVGWVILFSLMGLGLYNDINRLI 349


>gi|86150973|ref|ZP_01069189.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni 260.94]
 gi|86152684|ref|ZP_01070889.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni HB93-13]
 gi|121612227|ref|YP_001000746.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni 81-176]
 gi|157415329|ref|YP_001482585.1| hypothetical protein C8J_1009 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|167005666|ref|ZP_02271424.1| hypothetical protein Cjejjejuni_05650 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|85842143|gb|EAQ59389.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni 260.94]
 gi|85843569|gb|EAQ60779.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni HB93-13]
 gi|87249160|gb|EAQ72121.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni 81-176]
 gi|157386293|gb|ABV52608.1| hypothetical protein C8J_1009 [Campylobacter jejuni subsp. jejuni
           81116]
          Length = 368

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 174/358 (48%), Gaps = 27/358 (7%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI    + G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIEREFK-GTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  ALPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++P S A   G++K D I+ ++G+ + +F+E++ ++   PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGNIAPNSAAQEIGLQKNDTILEINGVKIQSFDEISKHLSLEPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +G+S +   T L     L+SF  
Sbjct: 189 --KILIDREGKN-LEFTLTPKIGQGYNDFGQIVEKPQLGVSPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
            + E    +   +  +      +     + G + +  I      + F   +   A+ S  
Sbjct: 245 AIQESFQASTLIIKGIIKLISGEVEAKNLGGIITMTEITSKAAQNSFTLLLFITALISIN 304

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ I+L L      NDI
Sbjct: 305 LGILNLLPIPMLDGGHILFNLYEMIFRRKVPQRAFEYLSYAGMAILLSLMLFATYNDI 362


>gi|219847476|ref|YP_002461909.1| peptidase M50 [Chloroflexus aggregans DSM 9485]
 gi|219541735|gb|ACL23473.1| peptidase M50 [Chloroflexus aggregans DSM 9485]
          Length = 388

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 112/370 (30%), Positives = 178/370 (48%), Gaps = 33/370 (8%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L++ + L ++V +HE GH  V     I+V  F +GF P  + +  R+G+++ ++ +
Sbjct: 21  LVTILVFLIMLSLLVFVHELGHLWVGLRMGIKVEEFGIGFPPRALVLFERNGIKYTLNWL 80

Query: 64  PLGGYVSFS--EDEKDM----RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV 117
           PLGG+V F+  + EKD      S   A PW+KI  +LAGPL N ++A++ F   F  TG+
Sbjct: 81  PLGGFVRFAGMDGEKDAVYGSGSLATAPPWRKIPVMLAGPLMNFILAVVIFAVLFATTGI 140

Query: 118 MKPV----VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
             P     + NV P +PAA+AG + GD ++SLDG  V++ + +    R+     I  V+ 
Sbjct: 141 PTPTGRMEIGNVFPNTPAAMAGFQPGDELVSLDGQPVTSEQVIRDVARKRLGSTIEAVVV 200

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRT---------VLQSF 224
           R     L L V P      D     R+  S G  FSY    ++            ++ SF
Sbjct: 201 RNG-SELTLNVTPGPWTAPD----GREF-SAGFGFSYGPQVVNQPIHPLAAVGAGLMHSF 254

Query: 225 S---RGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDH--GFNAYIAF 279
               R +  ++ +     G+ S          +  GPVGIAR          GF ++ + 
Sbjct: 255 ELTGRMVMMLADLPAAIAGLFSP---TPPPTGEPLGPVGIARATGEVIRQPDGFISFWSL 311

Query: 280 LAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLG 339
            A+ S  +  +NLLPIP LDG H++  L+E +RGK L      ++   G   ++ L  L 
Sbjct: 312 TAVLSLNLFILNLLPIPALDGSHIMFALIEWVRGKKLPPEKEALVHTFGFMALMGLMLLL 371

Query: 340 IRNDIYGLMQ 349
             ND+   +Q
Sbjct: 372 TVNDVINAVQ 381


>gi|148926029|ref|ZP_01809715.1| putative integral membrane protein [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845508|gb|EDK22600.1| putative integral membrane protein [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 368

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 178/362 (49%), Gaps = 35/362 (9%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI      G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIE-REFKGANYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  TLPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++P S A   G++K D I+ ++GI +  F+E++ ++  +PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGNIAPNSAAQEIGLQKNDTILEINGIRIQTFDEISKHLSLDPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +G+S +   T +  +  L+SF  
Sbjct: 189 --KILINREGKN-LEFILTPKIGQGYNDFGQIVEKPQLGVSPNGTSTLIKHQG-LESFKY 244

Query: 227 GLDEI----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
              E     + I +G + ++S     +     + G + +  I      + F   +   A+
Sbjct: 245 AAQESFQASTLIIKGIVKLISG----EVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ I+L L      N
Sbjct: 301 ISINLGILNLLPIPMLDGGHILFNLYEMIFRRKVPQRTFEYLSYTGMAILLSLMLFATYN 360

Query: 343 DI 344
           DI
Sbjct: 361 DI 362


>gi|218562682|ref|YP_002344461.1| putative peptidase M50 family protein [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|20978856|sp|Q9PNM6|Y1068_CAMJE RecName: Full=Putative zinc metalloprotease Cj1068
 gi|112360388|emb|CAL35185.1| putative peptidase M50 family protein [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
          Length = 368

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 177/362 (48%), Gaps = 35/362 (9%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI      G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIE-REFKGTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  TLPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++P S A   G++K D I+ ++GI +  F+E++ ++  +PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGNIAPNSAAQEIGLQKNDTILEINGIRIQTFDEISKHLSLDPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +G+S +   T L     L+SF  
Sbjct: 189 --KILINREGKN-LEFILTPKIGQGYNDFGQIVEKPQLGVSPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEI----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
              E     + I +G + ++S     +     + G + +  I      + F   +   A+
Sbjct: 245 AAQESFQASTLIIKGIVKLISG----EVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ I+L L      N
Sbjct: 301 ISINLGILNLLPIPMLDGGHILFNLYEMIFRRKVPQRTFEYLSYTGMAILLSLMLFATYN 360

Query: 343 DI 344
           DI
Sbjct: 361 DI 362


>gi|86150427|ref|ZP_01068652.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni CF93-6]
 gi|205355820|ref|ZP_03222589.1| putative integral membrane protein [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|85839022|gb|EAQ56286.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni CF93-6]
 gi|205346254|gb|EDZ32888.1| putative integral membrane protein [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|284926297|gb|ADC28649.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni IA3902]
 gi|315928752|gb|EFV08027.1| RIP metalloprotease RseP [Campylobacter jejuni subsp. jejuni 305]
          Length = 368

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 177/362 (48%), Gaps = 35/362 (9%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI      G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIE-REFKGTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  TLPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++P S A   G++K D I+ ++GI +  F+E++ ++  +PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGNIAPNSAAQEIGLQKNDTILEINGIRIQTFDEISKHLSLDPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +G+S +   T L     L+SF  
Sbjct: 189 --KILINREGKN-LEFILTPKIGQGYNDFGQIVEKPQLGVSPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEI----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
              E     + I +G + ++S     +     + G + +  I      + F   +   A+
Sbjct: 245 AAQESFQASTLIIKGIVKLISG----EVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ I+L L      N
Sbjct: 301 ISINLGILNLLPIPMLDGGHILFNLYEMIFRRKVPQRTFEYLSYTGMAILLSLMLFATYN 360

Query: 343 DI 344
           DI
Sbjct: 361 DI 362


>gi|315932201|gb|EFV11144.1| RIP metalloprotease RseP [Campylobacter jejuni subsp. jejuni 327]
          Length = 368

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 178/362 (49%), Gaps = 35/362 (9%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI    + G+ +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIEREFK-GINYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  ALPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++P S A   G++K D I+ ++GI + +F+E++ ++   PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGNIAPNSAAQDIGLQKNDTILEINGIKIQSFDEISKHLSLEPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +G+S +   T L     L+SF  
Sbjct: 189 --KILINREGKN-LEFILTPKIGQGYNDFGQIVEKPQLGVSPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEI----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
              E     + I +G + ++S     +     + G + +  I      + F   +   A+
Sbjct: 245 AAQESFQASTLIIKGIVKLISG----EVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP+LDGGH++  L EMI    +       ++  G+ I+L L      N
Sbjct: 301 ISINLGILNLLPIPMLDGGHILFNLYEMIFRHKVPQRAFEYLSYTGMAILLSLMLFATYN 360

Query: 343 DI 344
           DI
Sbjct: 361 DI 362


>gi|306821571|ref|ZP_07455169.1| RIP metalloprotease RseP [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550316|gb|EFM38309.1| RIP metalloprotease RseP [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 335

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 98/332 (29%), Positives = 172/332 (51%), Gaps = 21/332 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--E 73
           ++V +HEFGH+ VA+L  I V  F++G GP ++    ++G  + +  IP+GG+V+    +
Sbjct: 15  LVVAVHEFGHFFVAKLNKITVHEFAIGMGP-VVFQKEKNGTNYSIRAIPMGGFVAMEGED 73

Query: 74  DEKDMRSFFCAA-PWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           +E D  + FC   P +K+  V AGP  N V+ I+ F   F  +GV    V N+   SPA+
Sbjct: 74  EESDDPNAFCQKNPLQKMAVVFAGPFMNFVLTIVTFILLFTLSGVPVNKVGNIIENSPAS 133

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            + +K GD I S++GI++ ++ ++ P        +++L + R+    + + + P      
Sbjct: 134 KSELKVGDEIKSINGISIKSWNDI-PTTIAGTKGDVTLQVIRDGQS-MEITITPE----- 186

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
           ++ G +    +VGI   Y+  K  S ++ Q+FS    +  S++   L  +   F      
Sbjct: 187 EKSGRR----TVGIYPMYE--KNFSSSISQAFS----QTYSVSLSMLDFIKKLFTGKVDF 236

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
           N +SGPVGI +   +  + G    I ++A  S  +G MNLLPIP LDG  L+T  +E+I 
Sbjct: 237 NYVSGPVGIVKEMGSSVNSGLATVINYIAFISLNLGIMNLLPIPALDGFRLLTSFVELIT 296

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            K L   +  ++   G+  ++ +  L    D+
Sbjct: 297 RKKLNKKMEYIVNAAGMIFLIGIMLLVTYKDL 328


>gi|289423508|ref|ZP_06425309.1| RIP metalloprotease RseP [Peptostreptococcus anaerobius 653-L]
 gi|289156010|gb|EFD04674.1| RIP metalloprotease RseP [Peptostreptococcus anaerobius 653-L]
          Length = 337

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 104/336 (30%), Positives = 167/336 (49%), Gaps = 28/336 (8%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-EDE 75
           IV  HE GH+  A+   + +  FS+G GP +     + G+++ + L+P+GG+V+   EDE
Sbjct: 13  IVFFHELGHFYFAKRAGVTIHEFSIGMGPTIYE-KEKEGIKYSLRLLPIGGFVAMEGEDE 71

Query: 76  K--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           +  D  SF      +++ T+LAGP+AN V+ IL     +   G     V  V    PA  
Sbjct: 72  ESDDPNSFEKKTIVERLKTILAGPIANIVLCILLLLPVYAVMGTPSNYVDQVPKNMPAYT 131

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVD 193
           +G++K D IISLDG  V +FE++   V ++   E+ L  Y+ +  ++   + P    T  
Sbjct: 132 SGIRKDDQIISLDGKKVDSFEDLTKIVNQSKGKEMKLE-YKRNQKLMSTNIKP--ISTQG 188

Query: 194 RFGIKRQVPSVGISFSYDETK-----LHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGK 248
           R+        +G++  Y +        +S T   S  +G+ E       FL  L +    
Sbjct: 189 RY-------QIGVTSQYKKNNPLAIVKYSFTTTYSVGKGMLE-------FLWKLVTGQLS 234

Query: 249 DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLL 308
           +  ++ +SGPVG+  +  N   +GF   +   A+ S  IG MNLLPIP LDG  ++  LL
Sbjct: 235 NKIVDSLSGPVGVINMVSNAATNGFVNVLYLTAIISLNIGIMNLLPIPALDGWRILILLL 294

Query: 309 EMIR-GKSLGVSVTRVITRMGLCIIL-FLFFLGIRN 342
           E +R GK L   V   I   GL  +L F+ F+  ++
Sbjct: 295 EALRKGKKLPAKVEGYINAGGLVFLLSFMLFITYKD 330


>gi|325479513|gb|EGC82609.1| RIP metalloprotease RseP [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 339

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 99/325 (30%), Positives = 162/325 (49%), Gaps = 24/325 (7%)

Query: 15  IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSFS- 72
           + +++IHEFGH++VA+L  I+V  F++G GP     T + G   + +  IP+GGY +   
Sbjct: 12  LFLILIHEFGHFIVAKLSGIKVNEFAIGMGPAFF--TKQKGETLYSLRAIPMGGYCAMEG 69

Query: 73  EDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASP 130
           ED++  D RS+  A P  K LT+LAGP+ N ++A + F     NTG+    + N +  SP
Sbjct: 70  EDDESNDPRSYDRARPINKFLTILAGPVMNLLLASIIFFIVGLNTGITTTSIGNFTDNSP 129

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVA----PYVRENPLHE-ISLVLYREHVGVLHLKVM 185
           A  AG++ GD +  ++   +  F E++     Y ++  + E I + +YRE      +   
Sbjct: 130 AKEAGMEIGDEVREVNHTKIDNFPEISQIVNEYYKDKDISEPIEVKVYRESSNEEMI--- 186

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSA 245
                    F IK Q  +  + F   E+KL   +  ++   G  E          +L   
Sbjct: 187 ---------FDIKPQKENGNVFFGV-ESKLRKASFFEAIKLGFIETGKNIALIFIILGKL 236

Query: 246 FGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLIT 305
           F  +  ++ +SGPVG+ +   N   +G  + + FL   S  +G  NLLPIP LDG  L++
Sbjct: 237 FTGEIAVSALSGPVGVVKELGNQAQNGLMSILYFLGYISVNLGVFNLLPIPALDGSKLVS 296

Query: 306 FLLEMIRGKSLGVSVTRVITRMGLC 330
            L EMI GK +   +   +T +G  
Sbjct: 297 SLYEMITGKRVNKKLEEKVTIVGFV 321


>gi|320527470|ref|ZP_08028651.1| RIP metalloprotease RseP [Solobacterium moorei F0204]
 gi|320132183|gb|EFW24732.1| RIP metalloprotease RseP [Solobacterium moorei F0204]
          Length = 353

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 116/365 (31%), Positives = 177/365 (48%), Gaps = 43/365 (11%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG--VRWKVSLIPL 65
           +L+ V L IIV IHEFGH++VA+   +    FS+G GP    I +R G   ++ +  +P+
Sbjct: 4   VLFIVLLSIIVTIHEFGHFLVAKAFGVYCFEFSIGMGP---AIFTRKGKETQFSIRALPI 60

Query: 66  GGYVSFS-EDEKDM----------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN 114
           GGYV+ + E E D           R      PWKKI  +LAG   N ++A + F+ F  N
Sbjct: 61  GGYVAMAGETEGDEAYPNVKVPEGRRITDQKPWKKICIMLAGVAMNFLLAWVIFSMFLLN 120

Query: 115 TGVM----KPVVSNVSPASPAAIAGVKKGDCIISL---DGITVS--AFEEVAPYVRENPL 165
           TG      +PV++ V   SPA  AG++ GD II +   DG +V    F E   +  +N  
Sbjct: 121 TGTFTKSSEPVIATVLENSPAEQAGLQAGDRIIKVVKEDGSSVEPKTFLEFQAFNGDNKG 180

Query: 166 HEISLVLYREHVGVLHLKVMPRLQDTVDR--FGIKRQVPSVGISFSYDETKLHSRTVLQS 223
            E   +L       L ++V P      D   FGI  +        + ++ K++   +L  
Sbjct: 181 TETFTILRDGQT--LTIEVTPTYNKETDSYMFGISAK--------AGEQVKIN---LLNC 227

Query: 224 FSRGLDEISSITR-GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
           +  GL E+  IT      +L+   GK   LNQ+SGPVGI +    +   GF AY+  +A 
Sbjct: 228 WYYGLVEMQVITSMTIQALLNLVRGKG--LNQLSGPVGIYQATATYASLGFGAYMMLVAQ 285

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G  NLLP+P+LDGG ++  +LE I  +     +   I  +   +++ +      N
Sbjct: 286 ISLNVGIFNLLPLPVLDGGQVVITVLEWITRRHFNEKLKTAIMIICWLLLISVMIFATWN 345

Query: 343 DIYGL 347
           DI  L
Sbjct: 346 DISKL 350


>gi|307747969|gb|ADN91239.1| Putative zinc metalloprotease [Campylobacter jejuni subsp. jejuni
           M1]
          Length = 368

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 174/358 (48%), Gaps = 27/358 (7%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI    + G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIEREFK-GTSYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  ALPLGGYVKL-KGQDDMRPSFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++P S A   G++K D I+ ++G+ + +F+E++ ++   PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGNIAPNSAAQEIGLQKNDTILEINGVKIQSFDEISKHLSLEPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +G+S +   T L     L+SF  
Sbjct: 189 --KILINREGKN-LEFILTPKIGQGYNDFGQIIEKPQLGVSPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
            + E    +   +  +      +     + G + +  I      + F   +   A+ S  
Sbjct: 245 AVQESFQASTLIIKGIIKLISGEVEAKNLGGIITMTEITSKAAQNSFTLLLFITALISIN 304

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ I+L L      NDI
Sbjct: 305 LGILNLLPIPMLDGGHILFNLYEMIFRRKVPQRAFEYLSYTGMAILLSLMLFATYNDI 362


>gi|153951719|ref|YP_001397816.1| putative membrane-associated zinc metalloprotease [Campylobacter
           jejuni subsp. doylei 269.97]
 gi|152939165|gb|ABS43906.1| putative membrane-associated zinc metalloprotease [Campylobacter
           jejuni subsp. doylei 269.97]
          Length = 368

 Score =  145 bits (367), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 171/358 (47%), Gaps = 27/358 (7%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + L  ++  HE GH++ AR   ++V  FS+GFG  LI      G  +++S
Sbjct: 17  FYSIEFLATILVLSFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIE-REFKGTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  ALPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P ++N++P S A   G++K D I+ ++GI + +F+E++ ++   PL 
Sbjct: 130 YIIIGNLGLNKLAPQIANIAPNSAAQEIGLQKNDTILEINGIKIQSFDEISKHLSLEPLK 189

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
               +L       L   + P++    + FG   + P +G+S +   T L     L+SF  
Sbjct: 190 ----ILIDREGKKLEFILTPKIGQGYNDFGQIVEKPQLGVSPNGIST-LVKHQGLESFKY 244

Query: 227 GLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
            + E    +   +  ++     +     + G + +  I      + F   +   A+ S  
Sbjct: 245 AIQESFQASTLIIKGIAKLISGEVEAKNLGGIITMTEITSKAAQNSFTLLLFITALISIN 304

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +G +NLLPIP+LDGGH++  L EMI    +       ++  G+ ++L L      NDI
Sbjct: 305 LGILNLLPIPMLDGGHILFNLYEMIFRCKVSQRAFEYLSYAGMAMLLSLMLFATYNDI 362


>gi|315636828|ref|ZP_07892053.1| membrane protein [Arcobacter butzleri JV22]
 gi|315478882|gb|EFU69590.1| membrane protein [Arcobacter butzleri JV22]
          Length = 352

 Score =  145 bits (367), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 103/342 (30%), Positives = 172/342 (50%), Gaps = 23/342 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS---- 72
           +V  HE GH++ A+   ++V +FS+GFG ++     + G  W+++LIPLGGYV       
Sbjct: 13  LVFFHELGHFLAAKFFGVKVHTFSIGFGKQIYSKYWK-GTTWQIALIPLGGYVKMKGQDD 71

Query: 73  ------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNV 125
                 ED +D  S+    PW++I+ + AGP AN ++A IL+F             V +V
Sbjct: 72  SNPALIEDGED--SYNAKKPWQRIIILFAGPFANFILAAILYFIIALSGANTWAAQVGSV 129

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
              SPA IAG+K  D II ++ I + ++EE+   +       +   + R++  VL   + 
Sbjct: 130 QENSPAFIAGIKANDEIIRINDIDIKSWEEIGKVITTTQ-GALQFFIKRDN-QVLIKTIN 187

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLH---SRTVLQSFSRGLDEISSITRGFLGVL 242
           P + D+ + F    +   +GIS S     L    S++++ ++ + +   + I +G   ++
Sbjct: 188 PEISDSQNMFKENIKKRMIGISPSGKVITLDLSFSQSLVFAYEKTIFASTVIFQGVQKLI 247

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
           S         ++I G + I ++  +  +    A +   A+ S  +G +NLLPIP LDGGH
Sbjct: 248 SGI----VPTSEIGGVISIGKVISDASESSIIALLTITALISVNLGVLNLLPIPALDGGH 303

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           ++  L EMI  K     V   +T MG  I+  L  LGI NDI
Sbjct: 304 IMFNLYEMIVRKKPSDKVFVFLTIMGWIILGSLMLLGIYNDI 345


>gi|254459206|ref|ZP_05072628.1| RIP metalloprotease RseP [Campylobacterales bacterium GD 1]
 gi|207084099|gb|EDZ61389.1| RIP metalloprotease RseP [Campylobacterales bacterium GD 1]
          Length = 350

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 174/339 (51%), Gaps = 17/339 (5%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-EDEKD-- 77
           HE GHY  AR+  + V  FS+GFG  ++     S   W +S IPLGGYV    +D+ D  
Sbjct: 17  HELGHYFAARMMGVSVEVFSIGFGKRMLTFKKWS-TEWSISAIPLGGYVRMKGQDDSDPT 75

Query: 78  -----MRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNVSPASPA 131
                  S+    P +KI  + AGPLAN V+A +L+F        ++ PV+ +V   SPA
Sbjct: 76  KKSLDADSYNVKTPMQKIFILFAGPLANFVLAFVLYFVIALGGPNILSPVIGDVVKDSPA 135

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM-PRLQD 190
             AG+K  D + S++G+ ++ ++E+A  + E+    +++ + R+    +  K + P + +
Sbjct: 136 QAAGLKTNDIVKSINGVEITTWKEMAKIITESN-GALTVEIIRDSF--IEFKTLTPSITE 192

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE-ISSITRGFLGVLSSAFGKD 249
           T + F    Q   +GI  +    KL   +  ++ S   ++ I + T  F G+     G +
Sbjct: 193 TTNMFNEVVQKKMIGIGSAGVSHKLE-LSPSETLSYATEQTIFASTMIFTGLKKLIVG-E 250

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
               ++ G + I ++  +  D G+ + + F A+ S  +G +NLLPIP LDGGH++  L E
Sbjct: 251 VPAKELGGVISIVKLTSDATDAGWMSVLFFAALISVNLGVLNLLPIPALDGGHIMFNLYE 310

Query: 310 MIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +I  +    ++   +T  G  ++  L  LG+ NDI  LM
Sbjct: 311 LIFRREASEAIIIKLTIAGWVVLFSLMGLGLFNDINRLM 349


>gi|51245013|ref|YP_064897.1| hypothetical protein DP1161 [Desulfotalea psychrophila LSv54]
 gi|50876050|emb|CAG35890.1| hypothetical membrane protein [Desulfotalea psychrophila LSv54]
          Length = 357

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 186/354 (52%), Gaps = 31/354 (8%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---SE 73
           ++ +HE GH+++A+   +RVL FS+GFGP L G T      + +S  PLGG+V     + 
Sbjct: 14  LIFVHELGHFLLAKFFGVRVLKFSLGFGPRLCGKTIGE-TEYVLSAFPLGGFVKMLGENP 72

Query: 74  DEKDM------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV------ 121
           DE+++      R+F     +++ L VLAGPL N +  +L F+  F+  G+  PV      
Sbjct: 73  DEEELTGVEKERAFSYKPTYQRFLIVLAGPLFNFIFPVLIFSSLFFFQGI--PVSQDTTR 130

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           +  V+  SPAA AG+   D I+ ++G+  ++++ V   V+++    + +++ R    V  
Sbjct: 131 IGQVNEGSPAAQAGMLADDIIVDINGVETTSWQSVLNGVKDSGGVPLKVLVLRGDKEV-S 189

Query: 182 LKVMPRLQDTVDRFGIK-RQVPSVGI----SFSYDETKLHSRTVLQSFSRGLDEIS-SIT 235
           L ++P+  +  D FG    +   +G+    + SY+ET L +     +  RGL +    I 
Sbjct: 190 LAIVPQRDEVKDVFGQAVEERYMIGVMKAEALSYEETGLFA-----AIWRGLQQTWFYIY 244

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
              LG++     +    +++ GP+ IA++A      G+   + F ++ S  +G +NLLPI
Sbjct: 245 LTGLGIIK-LIQQVVPASEMGGPILIAQMAGEQMRAGWINLLYFTSLLSVNLGILNLLPI 303

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           P+LDGGHL+   LE IR K LG     +  ++GL ++  L      NDI  L++
Sbjct: 304 PVLDGGHLMFLTLEGIRKKPLGEKAQIIAQQIGLGLLATLMLFVFYNDIMRLIK 357


>gi|253682177|ref|ZP_04862974.1| RIP metalloprotease RseP [Clostridium botulinum D str. 1873]
 gi|253561889|gb|EES91341.1| RIP metalloprotease RseP [Clostridium botulinum D str. 1873]
          Length = 341

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 158/320 (49%), Gaps = 19/320 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---S 72
           I+V+IHEFGH+++A+L  ++V  F++G GP+L G+  +  + +   LIP+GGYV      
Sbjct: 16  ILVIIHEFGHFILAKLNGVKVEEFAIGMGPKLFGVRGKETL-YAFRLIPIGGYVKMLGEE 74

Query: 73  EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
            D +D RSF   +P +++  V AGP+ N ++AI+ F    Y  G + PVVS V P SPA 
Sbjct: 75  GDSEDERSFSNKSPLRRLSIVAAGPIMNFILAIVLFAVVGYLKGFLIPVVSEVIPQSPAI 134

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH-VGVLHLKVMPRLQDT 191
            AG++ GD I+ ++   +S +E+V   V  +    +++ L R +    + ++ M   +D 
Sbjct: 135 KAGIQPGDRILEINKHKISTWEDVMGQVAISKGEPLNIYLQRNNEKKTIVVRPMKNAKDD 194

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF-GKDT 250
               G+               + L   +  Q+ S G+ E +S  +     L   F GK +
Sbjct: 195 TYMLGVY-------------SSALEKPSFTQAVSYGIRETNSTVKQTFQSLGMLFKGKAS 241

Query: 251 RLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEM 310
               I GPV I R+       G    + F A  S  +G  NLLPIP LDG   +  L E+
Sbjct: 242 LKKDIGGPVTILRVTWAVSKAGLMNLVIFSAFISIQLGIFNLLPIPALDGFWALVSLYEI 301

Query: 311 IRGKSLGVSVTRVITRMGLC 330
           I  + +       ++ +G  
Sbjct: 302 ITRRRINRDKLGTVSTIGFT 321


>gi|331269634|ref|YP_004396126.1| membrane-associated zinc metalloprotease [Clostridium botulinum
           BKT015925]
 gi|329126184|gb|AEB76129.1| membrane-associated zinc metalloprotease, putative [Clostridium
           botulinum BKT015925]
          Length = 325

 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 151/300 (50%), Gaps = 19/300 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---SE 73
           +V+IHEFGH+ +A+L  ++V  F++G GP+L GI  +  + +   LIP+GGYV       
Sbjct: 1   MVIIHEFGHFTLAKLNGVKVEEFAIGMGPKLFGIRGKETL-YAFRLIPIGGYVKMLGEEG 59

Query: 74  DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           D +D RSF   +P +++  V AGP+ N ++AI+ F    Y  G + PVVS V P SPA  
Sbjct: 60  DSEDERSFSNKSPLRRLSIVAAGPIMNFILAIVLFAVVGYLKGFLIPVVSEVIPQSPAVK 119

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH-VGVLHLKVMPRLQDTV 192
           AG++ GD I+ ++   +S +E+V   V  +    +++ L R +    + ++ M   +D  
Sbjct: 120 AGIQPGDRILEINKHKISTWEDVMGQVTISKGEPLNIELQRNNEQKTIVVRPMKNAKDGT 179

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF-GKDTR 251
              G+               + L   +  Q+ S G+ E +S  +     L   F GK + 
Sbjct: 180 YMLGVY-------------SSALEKPSFTQAVSYGIRETNSTVKQTFQSLGMLFKGKASL 226

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
              I GPV I R+       GF   + F A  S  +G  NLLPIP LDG   +  L E+I
Sbjct: 227 KKDIGGPVTILRVTWAVSKAGFVNLVIFSAFISIQLGIFNLLPIPALDGFWALVSLYEII 286


>gi|237750786|ref|ZP_04581266.1| membrane-associated zinc metalloprotease [Helicobacter bilis ATCC
           43879]
 gi|229373231|gb|EEO23622.1| membrane-associated zinc metalloprotease [Helicobacter bilis ATCC
           43879]
          Length = 364

 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 177/355 (49%), Gaps = 44/355 (12%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV---------SF 71
           HE GH++ ARL  +RVL FS+GFG +LI      G  + +SLIPLGGYV         S 
Sbjct: 17  HELGHFLFARLFGVRVLVFSIGFGKKLI-TKQYKGTEYTLSLIPLGGYVKLKGEITKDSI 75

Query: 72  SED----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV---- 117
           S+D          + D  S     P+++IL +LAGPL N ++A   +   F   GV    
Sbjct: 76  SKDSNEIESSISSQYDKDSLLSKHPFQRILILLAGPLFNFILAFFIYIIIF-AKGVPSYS 134

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH--EISLVLYR- 174
             P++ ++      A   +KK D IIS++GI V  F +++  + EN     E  L++ R 
Sbjct: 135 NTPIIGDIGKEF-LAYNILKKDDEIISINGIKVEKFSDISHILNENKTQNMEAKLLISRP 193

Query: 175 -----EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
                 +     L+++  L    DR  I    P++ I + +   ++    +++ +    D
Sbjct: 194 ISYEKSNKNKEILELLVPLSKEKDRI-ILGITPAITIMY-FSPIEILQNAIMKVY----D 247

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
           +I  I +G   +L    G    L  +S  VGI  ++   ++ GF  +I  LA+ S  +G 
Sbjct: 248 DIMLIYKGLRDMLLGLIG----LENLSSVVGITDVSAKAYNAGFVNFILVLAIISVNLGV 303

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +NLLPIPI+DGG ++  L E + GK+L   +  ++  +GL  I+ L  LG+ NDI
Sbjct: 304 INLLPIPIVDGGQILFTLYEWLTGKALHEKIANILVALGLSFIITLMLLGLYNDI 358


>gi|283956463|ref|ZP_06373943.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni 1336]
 gi|283792183|gb|EFC30972.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni 1336]
          Length = 368

 Score =  145 bits (366), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 103/362 (28%), Positives = 175/362 (48%), Gaps = 35/362 (9%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI    + G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIEREFK-GTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  TLPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++P S A   G++K D I+ ++G+ + +F+E++ ++   PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGNIAPNSAAQDIGLQKNDTILEINGVKIQSFDEISKHLSLEPLK 189

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
               +L       L   + P++    + FG   + P +GIS +   T L     L+SF  
Sbjct: 190 ----ILTNREGKNLEFILTPKIGQGYNDFGQIIEKPQLGISPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEI----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
              E     + I +G + ++S     +     + G + +  I      + F   +   A+
Sbjct: 245 AAQESFQASTLIIKGIVKLISG----EVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP+LDGGH++  + EMI  + +       ++  G+ I+L L      N
Sbjct: 301 ISINLGILNLLPIPMLDGGHILFNIYEMIFRRKVPQRAFEYLSYAGMAILLSLILFATYN 360

Query: 343 DI 344
           DI
Sbjct: 361 DI 362


>gi|163849103|ref|YP_001637147.1| peptidase M50 [Chloroflexus aurantiacus J-10-fl]
 gi|222527076|ref|YP_002571547.1| peptidase M50 [Chloroflexus sp. Y-400-fl]
 gi|163670392|gb|ABY36758.1| peptidase M50 [Chloroflexus aurantiacus J-10-fl]
 gi|222450955|gb|ACM55221.1| peptidase M50 [Chloroflexus sp. Y-400-fl]
          Length = 388

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 111/352 (31%), Positives = 167/352 (47%), Gaps = 27/352 (7%)

Query: 19  VIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--EDEK 76
           ++HE GH  V     I+V  F +GF P  + +  R+G+++ ++ +PLGG+V F+  + EK
Sbjct: 36  IVHELGHLWVGLRMGIKVEEFGIGFPPRALVLFERNGIKYTLNWLPLGGFVRFAGMDGEK 95

Query: 77  D----MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP----VVSNVSPA 128
           D      S   A PW+KI  +LAGP+ N V+A++ F+  F   GV  P    ++SNV P 
Sbjct: 96  DAVYGTGSLAAAPPWRKIPVMLAGPVMNFVLAVVIFSILFATVGVPTPTGRMLISNVFPG 155

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRL 188
           +PAA+AG + GD +I LDG  V     +    +      I  V+ R    V  L+V P  
Sbjct: 156 TPAAVAGFQAGDELILLDGEPVYDETTIRAVAQRRLGTTIEAVVLRNGTEV-TLQVTPGP 214

Query: 189 QDTVDRFGIKRQVPSVGISFSY-DETKLHSRTVLQSFSRGLDEISSITRG---FLGVLSS 244
               D     R+  S G  FSY  + +      L +F  GL     +T      L  L +
Sbjct: 215 WTAPD----GREF-SAGFGFSYGPQVENQPINPLAAFGAGLMHSVDLTGRMVMMLADLPA 269

Query: 245 AFG-----KDTRLNQISGPVGIARIAKNFFDH--GFNAYIAFLAMFSWAIGFMNLLPIPI 297
           A             +  GPVGIAR          GF ++ +  A+ S  +  +NLLPIP 
Sbjct: 270 ALAGLFSPTPPPTGEPLGPVGIARATGEVIRQPDGFVSFWSLTAVLSLNLFILNLLPIPA 329

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           LDG H++  L+E +RGK L      ++   G   ++ L  L   ND+   +Q
Sbjct: 330 LDGSHILFALIEWVRGKKLPPEKEALVHAFGFMALMGLMALLTVNDVLNAVQ 381


>gi|227499276|ref|ZP_03929388.1| M50A family metalloprotease [Anaerococcus tetradius ATCC 35098]
 gi|227218627|gb|EEI83861.1| M50A family metalloprotease [Anaerococcus tetradius ATCC 35098]
          Length = 339

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 101/329 (30%), Positives = 165/329 (50%), Gaps = 24/329 (7%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           +  + +++IHEFGH+++A+   I+V  F+VG GP ++    +    + + LIP+GGY + 
Sbjct: 9   IMFLFLILIHEFGHFIIAKASGIKVNEFAVGMGPAILK-KVKGETLYTLRLIPIGGYCAM 67

Query: 72  S-EDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPA 128
             EDE+  D RS+  A    K  T+LAGP+ N ++A++ F     NTGV   V+ N +  
Sbjct: 68  EGEDEESSDPRSYDMADAKSKFFTILAGPMMNLILAVVIFFIVSLNTGVATNVIGNFTDD 127

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEEV-----APYVRENPLHEISLVLYREHVG-VLHL 182
           S A +AG++ GD I+SL G  +  F ++     A Y  ++    I L +YRE     L+ 
Sbjct: 128 SSARMAGLEVGDEILSLGGEKIEKFSDISQVLNAYYKDKDITKTIELEVYRESSKEKLNF 187

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVL 242
            + P+ +      GI+ ++  VG    ++  KL        F      I+ I   F+ +L
Sbjct: 188 DLSPKKEKGGVYLGIEAKLRGVGF---FEAIKL-------GFVETYKNIALI---FI-IL 233

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
              F      + +SGPVG+ +   N   +G  + + FL   S  +G  NLLPIP LDG  
Sbjct: 234 GKLFTGKIAFSALSGPVGVVKELGNQAQNGLMSLLYFLGYISVNLGVFNLLPIPALDGSK 293

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCI 331
           +++ L E+  GK +       IT  G  +
Sbjct: 294 IVSALYELFTGKKVNKKFEEKITLAGFVV 322


>gi|315927926|gb|EFV07248.1| RIP metalloprotease RseP [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 368

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 178/362 (49%), Gaps = 35/362 (9%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI    + G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIEREFK-GTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  ALPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + +++P S A   G++K D I+ ++GI + +F+E++ ++   PL 
Sbjct: 130 YIIIGNLGLSKLAPQIGSIAPNSAAQDIGLQKNDTILEINGIRIQSFDEISKHLSLEPLK 189

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +GIS +   T L     L+SF  
Sbjct: 190 ---ILIDREGKN-LEFILTPKIGQGYNDFGQIVEKPQLGISPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEI----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
              E     + I +G + ++S     +     + G + +  I      + F   +   A+
Sbjct: 245 AAQESFQASTLIIKGIVKLISG----EVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ I+L L      N
Sbjct: 301 ISINLGILNLLPIPMLDGGHILFNLYEMIFRRKIPQRAFEYLSYAGMAILLSLMLFATYN 360

Query: 343 DI 344
           DI
Sbjct: 361 DI 362


>gi|149194614|ref|ZP_01871710.1| putative integral membrane protein [Caminibacter mediatlanticus
           TB-2]
 gi|149135358|gb|EDM23838.1| putative integral membrane protein [Caminibacter mediatlanticus
           TB-2]
          Length = 348

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 109/346 (31%), Positives = 182/346 (52%), Gaps = 32/346 (9%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPEL----IGITSRSGVRWKVSLIPLGGYVSFS 72
           ++  HE GH+++ARL  ++V  FS+GFG +L    IG T+     W +S IPLGGYV   
Sbjct: 11  LIFFHELGHFLMARLVGVKVEVFSIGFGKKLFCKKIGDTN-----WCISAIPLGGYVQMK 65

Query: 73  ----------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT-GVMKPV 121
                      D+KD  S+   +PW++IL +L GP  N ++A L + F   N    + P+
Sbjct: 66  GQDDSNPFAKSDDKD--SYTSKSPWQRILILLGGPGFNFLLAFLIYIFIAVNGWPKLAPI 123

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V    P +PAA   +K GD II ++G  V ++++V   ++E+  +E+ L + R    ++ 
Sbjct: 124 VGKTLPNTPAAKV-LKSGDKIIEVNGKKVKSWDDVGRLIQESK-NEVKLKVLRNG-KIIM 180

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSR--TVLQ-SFSRGLDEISSITRGF 238
           L + P+++ T + F  K +   +GI  S    K+H     +L+ +F + +++ + I +  
Sbjct: 181 LTLRPKIKTTQNIFKEKIKRKIIGIIPSGKTIKIHYSGIEILKIAFEKVINDATLIFKSV 240

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
             +++ A G DT    +SGP+GI  I       G    +   A+ S  +G +NLLPIP L
Sbjct: 241 QKLITGALGLDT----LSGPIGIVDITAKVSQAGIIPLLFLTALLSVNLGVLNLLPIPAL 296

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           DGGH++  L E I  + +   V   +T  G  ++  L  +G+ NDI
Sbjct: 297 DGGHIMFNLYEGIFKREVNEEVMYRLTIAGWILLGSLMIIGVVNDI 342


>gi|269926810|ref|YP_003323433.1| membrane-associated zinc metalloprotease [Thermobaculum terrenum
           ATCC BAA-798]
 gi|269790470|gb|ACZ42611.1| membrane-associated zinc metalloprotease [Thermobaculum terrenum
           ATCC BAA-798]
          Length = 353

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 105/326 (32%), Positives = 170/326 (52%), Gaps = 27/326 (8%)

Query: 3   WLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           WL  +L     L ++V +HE GH++ ARL  IRV  F  GF P LIGI  R  V + ++L
Sbjct: 5   WL-VYLWIIPVLGLLVFVHELGHFVTARLNGIRVEEFGFGFPPRLIGI-KRGEVIYSINL 62

Query: 63  IPLGGYVSF----SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV- 117
           IP+GG+V       ED  D RSF    PW++ + + AG L N  +AI+ FT     TG+ 
Sbjct: 63  IPVGGFVRIYGENGEDPNDPRSFSYKKPWQRAIVLAAGSLMNLFLAIIIFTLLAM-TGLP 121

Query: 118 --MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
                V+  V+  SPAA AG++ GD I S+DGI++ + +++A  +       +++V+ R+
Sbjct: 122 VSKGAVIRQVADNSPAASAGLQPGDKIRSIDGISIDSPDDIARVIAGKQGQTVTIVVERD 181

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQV-PSVGISFSYDETKLHSRTVLQSFSRGLDEISSI 234
               +  +V PR+     +  I   + P   ++  Y+        +  SF    + I++I
Sbjct: 182 GR-TISKQVTPRVNPPRGQGAIGIVIYPETVVTRKYNPIAAIGVGISHSF----EVIATI 236

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIA----RIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
            +G   +++   G    +  + GP+GIA    +IA+     G   + A L++  +    +
Sbjct: 237 VQGIGDLITGKVG----IGGVMGPIGIADATGQIARQSALRGIAEWTALLSINLF---LV 289

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSL 316
           NLLP+P LDGG LI  ++E IRGK +
Sbjct: 290 NLLPLPALDGGRLIFVIIEAIRGKKI 315


>gi|189425771|ref|YP_001952948.1| membrane-associated zinc metalloprotease [Geobacter lovleyi SZ]
 gi|189422030|gb|ACD96428.1| membrane-associated zinc metalloprotease [Geobacter lovleyi SZ]
          Length = 376

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 103/366 (28%), Positives = 178/366 (48%), Gaps = 35/366 (9%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + + L I++ +HE GH++VA+   ++V  FS+GFGP+L G        + +S  PLGGYV
Sbjct: 6   FIIVLGILIFVHELGHFLVAKWMGVKVEKFSLGFGPKLFG-RQIGETEYLISAFPLGGYV 64

Query: 70  S------FSEDE------------------------KDMRSFFCAAPWKKILTVLAGPLA 99
                  FSE E                         + RSF   +  +++  V AGP  
Sbjct: 65  KMFGEGGFSEIEMIEQEYEREAPGSKPVEAYKLTPADEARSFAHKSIPQRMAIVFAGPFF 124

Query: 100 NCVMA-ILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAP 158
           N V A +L    +     ++K  V  V P  PAA+AG++KGD I +++G  +  +E+ + 
Sbjct: 125 NMVFAWLLLIVLYMTGMPILKATVGEVFPNRPAALAGIQKGDLITAINGQRIIQWEDFSA 184

Query: 159 YVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSR 218
           ++       ++L + R     L +++ P++ +T + FG   + P +G+S +YD       
Sbjct: 185 HMATTS-ETVTLNITRSG-KPLTVQLKPQVGETKNLFGEVVKKPIIGVSPAYDFAT-ERF 241

Query: 219 TVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA 278
            ++ +F  G  +   +TR  +  L   F     LN + GP+ IA +A      G   +  
Sbjct: 242 GLVDAFKLGNAKTVEVTRLTVLSLVKLFQGVVPLNSLGGPMMIADMANKAAQTGGATFFM 301

Query: 279 FLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
            LA+ S  +G +NLLP+P+LDGGHL+ + +E I  + +   V     + G+ +++ +  L
Sbjct: 302 LLAVVSINLGILNLLPVPVLDGGHLMFYTIEAIIRRPVPQKVREYAQQAGMILLIGMMVL 361

Query: 339 GIRNDI 344
              NDI
Sbjct: 362 AFYNDI 367


>gi|296115047|ref|ZP_06833689.1| membrane-associated zinc metalloprotease [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978384|gb|EFG85120.1| membrane-associated zinc metalloprotease [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 368

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 175/363 (48%), Gaps = 23/363 (6%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L + + L ++V IHE GHY+ AR   + V  FS+GFG  L+      G  W++  +
Sbjct: 5   LRTVLAFALVLGVLVFIHELGHYLAARWRGVHVEVFSIGFGKPLLRWHDSVGTEWRLCPV 64

Query: 64  PLGGYVSFS--EDEKDM-----------RSFFCAAPWKKILTVLAGPLANCVMAILFFT- 109
           PLGGYV     E  +D            R+F       + + ++AGP+ N ++AI+ FT 
Sbjct: 65  PLGGYVKPHGFEGPEDATPEQIAAWQPGRTFHDKPVLSRAIVIIAGPVFNFLLAIILFTG 124

Query: 110 -FFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEI 168
            F F     ++ VV++V P S AA AG+   D I+ L    +S   ++   V   P  + 
Sbjct: 125 LFAFAGQPHIRNVVADVMPGSAAASAGIVPHDVIVRLGDHPISDVADLQARVAAEPGAQT 184

Query: 169 SLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
            +V+ R+     H   +P    +V     K Q P   +  S+       +++ ++F   +
Sbjct: 185 DVVVQRDG----HDVTIPLTVGSVAD--AKGQPPHGQLGVSFLAEVGAPQSLPRAFVSAV 238

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
            E  +++   L  L            + GP+ IA+++     +G ++ ++F+A+ S  +G
Sbjct: 239 KETWNVSVQTLAGLWQMLTGQHSTKDLGGPLRIAQMSGQVAQYGLSSLVSFMALLSINLG 298

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI--YG 346
            +NL PIPILDGG L+ ++LE I G+ +   V ++  + G  +I  LF     ND+  +G
Sbjct: 299 LINLFPIPILDGGRLMFYILEGIMGRPVSRRVQQISFQAGFALIASLFLFSTFNDLSHFG 358

Query: 347 LMQ 349
           L Q
Sbjct: 359 LFQ 361


>gi|88596581|ref|ZP_01099818.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni 84-25]
 gi|88191422|gb|EAQ95394.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni subsp. jejuni 84-25]
          Length = 368

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 178/362 (49%), Gaps = 35/362 (9%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI    + G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIEREFK-GTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  TLPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + +++P S A   G++K D I+ ++GI + +F+E++ ++   PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGSIAPNSAAQDIGLQKNDTILEINGIRIQSFDEISKHLSLEPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +G+S +   T L     L+SF  
Sbjct: 189 --KILIDREGKN-LEFILTPKIGQGYNDFGQIVEKPQLGVSPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEI----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
              E     + I +G + ++S     +     + G + +  I      + F   +   A+
Sbjct: 245 AAQESFQASTLIIKGIVKLISG----EVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ I+L L      N
Sbjct: 301 ISINLGILNLLPIPMLDGGHILFNLYEMIFRRKIPQRAFEYLSYAGMAILLSLMLFATYN 360

Query: 343 DI 344
           DI
Sbjct: 361 DI 362


>gi|309389225|gb|ADO77105.1| membrane-associated zinc metalloprotease [Halanaerobium praevalens
           DSM 2228]
          Length = 357

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 112/366 (30%), Positives = 179/366 (48%), Gaps = 44/366 (12%)

Query: 8   LLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +L  VS II+    V IHEFGHY+ A+  +I V  F++GFGP+LI       V + +  I
Sbjct: 2   VLTIVSFIIVLGLLVFIHEFGHYITAKKSDIMVTEFALGFGPKLISKKVGETV-YSIRSI 60

Query: 64  PLGGYV----------SFSEDEKDM--------RSFFCAAPWKKILTVLAGPLANCVMAI 105
           PLGG+           S  E E+ +        R F   + +K++  +L GP+ N ++A 
Sbjct: 61  PLGGFCNMVGEFPADESMPEAERKVYEKAKAAGRLFNQKSAFKRLAVILMGPIMNFLLAT 120

Query: 106 LFFTFFFYNTGVMKPVVSN-----VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYV 160
           L F   F   GV      N     V P  PAA AG++  D IIS++G  ++++E+++  +
Sbjct: 121 LIFILAFIAVGVPTATTQNAILGQVIPEQPAAQAGLRANDKIISINGQEINSWEQMSQLI 180

Query: 161 RENPLHEISLVLYREHVGVLHLKVMPRLQDTVDR--FGIKRQVPSVGISFSYDETKLHSR 218
           ++N   EISL  Y  +  +  + + P      ++   GI  Q+    +SF+    KL  +
Sbjct: 181 QKNAEKEISL-QYERNNKIKKVNLTPIFSQNSEKGVIGIYPQLVREKVSFA-KSIKLGLK 238

Query: 219 TVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA 278
              Q F      I +I +GF+ +      KD+    I GP+ IA I       G    + 
Sbjct: 239 QSYQVF------IMTI-QGFMQMF-----KDSSAEDIGGPIMIASIIGRAARVGLINVLN 286

Query: 279 FLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
           + A+ S  +G +NL+P P LDGG ++  L+EMIRGK++       +  +G  I++ L   
Sbjct: 287 WTAIISINLGIINLIPFPALDGGRILFILIEMIRGKAVDPKKENYVHLIGFAILIVLMIF 346

Query: 339 GIRNDI 344
            I ND+
Sbjct: 347 IIYNDL 352


>gi|150390443|ref|YP_001320492.1| putative membrane-associated zinc metalloprotease [Alkaliphilus
           metalliredigens QYMF]
 gi|149950305|gb|ABR48833.1| putative membrane-associated zinc metalloprotease [Alkaliphilus
           metalliredigens QYMF]
          Length = 347

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 157/332 (47%), Gaps = 18/332 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
           +++  HE GH+ VA+L  I+V  F++G GP+ +  T +   ++ + L+PLGGYV    ED
Sbjct: 25  LLIFFHELGHFGVAKLVGIKVHEFAIGMGPKFLQFT-KGETKYSLRLLPLGGYVRMEGED 83

Query: 75  E--KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E   D RSF      ++I  + AGPL N ++AI  F   FY  G     +  V   SPA 
Sbjct: 84  EASSDERSFNNKTVVQRIAVLFAGPLMNFILAIFLFFIIFYTIGAPTTTIEQVMVESPAE 143

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
             G++ GD I+ +DG  ++++ E+   +  +    + + L R    +    + P ++   
Sbjct: 144 AVGIQPGDSIVEIDGSHITSWSEIVQEISVSEGRTMQMTLLRNDQEI-QKTITPNIEPET 202

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
            +  I   VP +  SF+             S     D+   I R  +  L +  G++   
Sbjct: 203 QQIMIGI-VPEMRASFT------------ASIRNSFDQTFMIIREIVLFLRNIVGREATS 249

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
            +I GPVGI  +       G+   +   ++ S  +G MNLLPIP LDG  ++  ++E +R
Sbjct: 250 TEIMGPVGIISLVGQATRTGWVDVLFLASLISINLGLMNLLPIPALDGSRILFLIVEFLR 309

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GK +      +I  +G  +++ L       DI
Sbjct: 310 GKPIAPEKEGMIHLVGFGLLMLLMVFITYQDI 341


>gi|57237950|ref|YP_179199.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni RM1221]
 gi|57166754|gb|AAW35533.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           jejuni RM1221]
 gi|315058509|gb|ADT72838.1| Membrane-associated zinc metalloprotease [Campylobacter jejuni
           subsp. jejuni S3]
          Length = 368

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 177/362 (48%), Gaps = 35/362 (9%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI    + G  +++S
Sbjct: 17  FYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIEREFK-GTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P KKI  + AGP  N ++A     FF 
Sbjct: 76  TLPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++  S A   G++K D I+ ++GI +  F+E++ ++  +PL 
Sbjct: 130 YIIIGNLGLNKLAPQIGNIASNSAAQEIGLQKNDTILEINGIRIQTFDEISKHLSLDPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P++    + FG   + P +G+S +   T L     L+SF  
Sbjct: 189 --KILINREGKN-LEFILTPKIGQGYNDFGQIVEKPQLGVSPNGTST-LVKHQGLESFKY 244

Query: 227 GLDEI----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
              E     + I +G + ++S     +     + G + +  I      + F   +   A+
Sbjct: 245 AAQESFQASTLIIKGIVKLISG----EVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL 300

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ I+L L      N
Sbjct: 301 ISINLGILNLLPIPMLDGGHILFNLYEMIFRRKVPQRTFEYLSYTGMAILLSLMLFATYN 360

Query: 343 DI 344
           DI
Sbjct: 361 DI 362


>gi|313901423|ref|ZP_07834885.1| membrane-associated zinc metalloprotease [Thermaerobacter
           subterraneus DSM 13965]
 gi|313468309|gb|EFR63761.1| membrane-associated zinc metalloprotease [Thermaerobacter
           subterraneus DSM 13965]
          Length = 345

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/340 (28%), Positives = 165/340 (48%), Gaps = 24/340 (7%)

Query: 8   LLYTVSL-IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           +++T+++  +++VIHE GH+  A+   + V  F++GFGP L     R    + + L+PLG
Sbjct: 3   VIWTIAVFALLIVIHELGHFWAAKRSGVLVHEFALGFGPRL-AFVRRGETEYSLRLLPLG 61

Query: 67  GYVSFS---------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV 117
           G+V  +         ED    R F       ++  + AGPL N  +AI+ F   F   GV
Sbjct: 62  GFVRMAGMQPDEEGLEDVPPERRFLGRPLGDRVKIIAAGPLMNVALAIVLFALVFAVIGV 121

Query: 118 --MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
              +PVV  V P  PAA AG++ GD I+++DG  V ++++V   +RE     + L + R+
Sbjct: 122 PVARPVVGEVVPGYPAAEAGLQPGDRIVAIDGRPVESWDQVVAAIREAAGRPVQLTIQRQ 181

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
               L ++V PR        G+      VGI    +  +     V+++ SRG      + 
Sbjct: 182 GRE-LAVQVTPRSDPRRPGTGV------VGIRPLVETVRT---GVVEAVSRGAQATWQVA 231

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
            GF+  L          + I GPVGI +        G +  +   A+ S  +  +NLLP+
Sbjct: 232 AGFVTALVHMLTGRGGFDVI-GPVGIGQQIGEAAQVGLSQVVLLAAILSANLALVNLLPV 290

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335
           P LDGG L+  ++E +RG+ +      +I  +G  +++ L
Sbjct: 291 PALDGGRLVFLVVEAVRGRPVDPEQENLIHFVGFALLMLL 330


>gi|315499836|ref|YP_004088639.1| membrane-associated zinc metalloprotease [Asticcacaulis excentricus
           CB 48]
 gi|315417848|gb|ADU14488.1| membrane-associated zinc metalloprotease [Asticcacaulis excentricus
           CB 48]
          Length = 400

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 115/389 (29%), Positives = 179/389 (46%), Gaps = 49/389 (12%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           +F++    L+ + + +IV  HE GH+ VARL   ++  FSVGFGP +     ++GV W +
Sbjct: 2   IFYILAIPLFLLVISLIVTFHELGHFSVARLFKTKIERFSVGFGPVIWSKRDKNGVLWCL 61

Query: 61  SLIPLGGYVSFSED-------------EKDMR------------SFFCAAP-WKKILTVL 94
           S +PLGGYV FS D             EK  R            ++F   P W++ L VL
Sbjct: 62  SALPLGGYVKFSCDEHVSSMSPDAEELEKARRAIREREGPGAELAYFHFKPVWQRFLIVL 121

Query: 95  AGPLANCVMAILFFTFFFYNTGV-MKP--VVSNVSPASPAAIAGVKKGDCIISLDGITVS 151
           AGP+AN V+AI+ F   F   G  M P  V+    P  P A +G+K GD  + +DG  V 
Sbjct: 122 AGPVANFVLAIIIFAAVFMIVGKGMAPGTVMGFSEPNGPGARSGLKVGDQFVRIDGREVK 181

Query: 152 AFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVG--ISFS 209
             E+V   VR    +E + V  R    ++ L V P  +   +   + + VP+    ++  
Sbjct: 182 TSEDVIMLVRMRG-NEPTAVDVRRDGEIVRLTVTPERRLIAE---VSQHVPTYAGVLAVK 237

Query: 210 YDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFF 269
             + + H+    ++   G  +   +    L  +   F      +Q+SG +G+ +   +  
Sbjct: 238 IGDGEPHTPWPHEALWLGTQKTIGVLDTTLTYIGRIFTGKENGDQLSGIIGMTKATGDLT 297

Query: 270 DH-----------GFNAYIAFLAM---FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKS 315
                         F+  +  L M    S  IGF+NLLPIP+LDGGHL+ +  E I  + 
Sbjct: 298 AEVASVKAAPGQMAFSLLLTLLQMAAFVSVGIGFVNLLPIPVLDGGHLVFYTYEAIARRP 357

Query: 316 LGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L  +V  +  R GL  +L L      ND+
Sbjct: 358 LSATVQGLGYRFGLVALLGLMLFATWNDL 386


>gi|254697514|ref|ZP_05159342.1| RIP metalloprotease RseP [Brucella abortus bv. 2 str. 86/8/59]
 gi|260761940|ref|ZP_05874283.1| membrane metalloproteinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260672372|gb|EEX59193.1| membrane metalloproteinase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 261

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 113/206 (54%), Gaps = 20/206 (9%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GHY+VAR C I   +FS+GFGPEL+G T R G RWK+S IPLGGYV F  DE +   
Sbjct: 33  HEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLGGYVKFIGDESETSS 92

Query: 79  ---------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF--YNTGVMKPV 121
                          R+F     WK+  TV AGP  N ++ I  F+ FF  Y   +  P+
Sbjct: 93  PVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPL 152

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           ++ V P SPAA AG + GD  +S++G  ++ F +V   V      +++  + R+   ++ 
Sbjct: 153 IAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGK-MVD 211

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGIS 207
           L+ +P++ +  D  G K ++ ++G+ 
Sbjct: 212 LQAVPKIVERTDPLGNKVKLGAIGVE 237


>gi|330993380|ref|ZP_08317315.1| Putative zinc metalloprotease [Gluconacetobacter sp. SXCC-1]
 gi|329759410|gb|EGG75919.1| Putative zinc metalloprotease [Gluconacetobacter sp. SXCC-1]
          Length = 369

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 100/361 (27%), Positives = 176/361 (48%), Gaps = 28/361 (7%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           L +++ L ++V IHE GHY+ AR   + V  FS+GFG  L+      G  W++  +PLGG
Sbjct: 9   LAFSLVLGVLVFIHELGHYLAARWRGVHVEVFSIGFGRPLLRWHDSVGTEWRLCPVPLGG 68

Query: 68  YV---------SFSEDEKDM----RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN 114
           YV           +E++K      R+F       + + ++AGP+ N ++AI+ FT  F  
Sbjct: 69  YVRPHGFEGPEDATEEQKAAWQPGRTFHDKPVLSRAIVIMAGPVFNFLLAIVLFTGLFAT 128

Query: 115 TGVMKP----VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
            G  +P     V+ V P S AA AGV+KGD I+ +    V    ++  +V      + +L
Sbjct: 129 VG--QPHILNQVAQVVPGSAAAAAGVEKGDVILRVGDHVVRDVADLQSFVSGQAGAQTTL 186

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
            ++R   G     +   +    ++ G+      +G+SF+ +      R++  +F   + E
Sbjct: 187 TVHR---GDADTTLPVHIGSVAEKGGMPHG--QIGVSFAMEMGS--PRSLPAAFVAAVRE 239

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
             +++   L  L            + GP+ IA+++     +G  + ++F+A+ S  +G +
Sbjct: 240 TWNVSVQTLQGLWQMITGQHSTRDLGGPLRIAQMSGQVAQYGLPSLVSFMALLSINLGLI 299

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI--YGLM 348
           NL P+PILDGG L+ ++ E I G+ +   V  +  + G  +I  LF     ND+  +GL 
Sbjct: 300 NLFPVPILDGGRLVFYIFEAILGRPVSRRVQEISFQAGFALIAGLFLFSTFNDLSHFGLF 359

Query: 349 Q 349
           Q
Sbjct: 360 Q 360


>gi|157737117|ref|YP_001489800.1| membrane-associated zinc metalloprotease, putative [Arcobacter
           butzleri RM4018]
 gi|157698971|gb|ABV67131.1| membrane-associated zinc metalloprotease, putative [Arcobacter
           butzleri RM4018]
          Length = 352

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 104/344 (30%), Positives = 175/344 (50%), Gaps = 27/344 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS---- 72
           +V  HE GH++ A+   ++V +FS+GFG ++     + G  W+++LIPLGGYV       
Sbjct: 13  LVFFHELGHFLAAKFFGVKVHTFSIGFGKQIYSKYWK-GTTWQIALIPLGGYVKMKGQDD 71

Query: 73  ------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNV 125
                 ED +D  S+    PW++I+ + AGP AN ++A IL+F             V +V
Sbjct: 72  SNPALIEDGED--SYNAKKPWQRIIILFAGPFANFILAAILYFIIALSGANTWAAQVGSV 129

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
              SPA IA +K  D II ++ I + ++EE+   +       +   + R++  VL   + 
Sbjct: 130 QENSPAFIADIKANDEIIRINDIDIKSWEEIGKVITTTQ-GALQFFIKRDN-QVLIKTIN 187

Query: 186 PRLQDTVDRF--GIKRQVPSVGISFSYDETKLH---SRTVLQSFSRGLDEISSITRGFLG 240
           P + D+ + F   IK+++  +GIS S     L    S++++ ++ + +   + I +G   
Sbjct: 188 PEISDSQNMFRENIKKRM--IGISPSGKIITLDLSFSQSLVFAYEKTIFASTVIFQGVQK 245

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
           ++S         ++I G + I ++  +  +    A +   A+ S  +G +NLLPIP LDG
Sbjct: 246 LISGI----VPTSEIGGVISIGKVISDASESSIIALLTITALISVNLGVLNLLPIPALDG 301

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GH++  L EMI  K     V   +T MG  I+  L  LGI NDI
Sbjct: 302 GHIMFNLYEMIVRKKPSDRVFVFLTIMGWMILGSLMLLGIYNDI 345


>gi|28210955|ref|NP_781899.1| membrane metalloprotease [Clostridium tetani E88]
 gi|28203394|gb|AAO35836.1| membrane metalloprotease [Clostridium tetani E88]
          Length = 340

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/333 (27%), Positives = 165/333 (49%), Gaps = 17/333 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---- 71
           ++V++HE GH+ +A+L  + V  FS+G GP++ G   +    + +  +P+GGY+      
Sbjct: 15  LLVLVHELGHFTLAKLNGVAVEEFSIGMGPKIWGF-KKGETEYVIKALPIGGYIKMLGEE 73

Query: 72  SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPA 131
            E+  D R+F   +  +K+  V AGP  N V+AI+ F    +N G   P+V  V   +PA
Sbjct: 74  GEETYDERAFSNKSSLRKLSIVAAGPFMNLVLAIVLFGIISFNKGFAVPIVGEVIENNPA 133

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDT 191
            +AG++KGD I+ ++   +  +++    + +N  + ++ V Y  +  +   KV+P     
Sbjct: 134 YVAGLQKGDKIVEVNNKKIKTWDDFITQIYKNEGNILN-VSYERNNKLNAAKVVPVKNKE 192

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
            +R+        +GI      T + + +V +S S G  E  S+ +     L + F     
Sbjct: 193 ENRY-------VIGIY----PTLVENPSVGESISHGFSESISLVKQTFMFLGTLFKGKAS 241

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
            +   GP+ I +++      GF + ++F A  S  +   N++P P LDGG +  FL+E+I
Sbjct: 242 ASDFGGPITIIKVSGAAAKAGFWSLLSFAAYLSVQLAIFNVIPFPALDGGWITFFLIEII 301

Query: 312 RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             K L  +   VI  +G  I++ L  L    DI
Sbjct: 302 TRKKLNSNKIGVINYIGFAILMTLMVLVTVKDI 334


>gi|319774881|ref|YP_004134150.1| membrane-associated zinc metalloprotease [Thermovibrio ammonificans
           HB-1]
 gi|317115229|gb|ADU97718.1| membrane-associated zinc metalloprotease [Thermovibrio ammonificans
           HB-1]
          Length = 325

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 102/333 (30%), Positives = 165/333 (49%), Gaps = 29/333 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRS 80
           HE GH++ AR   +RV +FS+GFGP+++         + VSLIPLGGYV  + +  D   
Sbjct: 17  HELGHFIAARAFGVRVETFSIGFGPKVLKFRC-CDTEFAVSLIPLGGYVKTANESPD--- 72

Query: 81  FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP--VVSNVSPASPAAIAGVKK 138
                PW++I+  LAGPL N ++A++ FT   Y +GV+ P   V  V P SPA  AG+K 
Sbjct: 73  ---TPPWQRIVIALAGPLMNLLLAVICFTAV-YLSGVVIPDSKVVKVLPGSPAYEAGIKS 128

Query: 139 GDCIISLDGITV--SAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           GD I+ ++G     S FE+     +E     + L + R+  G L + + P   +   R  
Sbjct: 129 GDRILKVNGEPFRWSLFEKAVESGKE-----VKLTILRDGKG-LSVTLKPVFMEKFHRR- 181

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
                   G+  +Y +    S  + ++  +GL E + ++  F   L         L  I 
Sbjct: 182 ------ISGVFLNYRKV---SYPLPEALKKGLQEYAKLSALFFKTLYKLATGKVSLRSIG 232

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GP+   +  +     G  A + +    S  +G+ NLLP+P+LDGG ++  L E +RG   
Sbjct: 233 GPILSTQELQRAVHQGITALLLYAGFISLQLGYFNLLPLPVLDGGAILLHLAEALRGGRP 292

Query: 317 GVSVTR-VITRMGLCIILFLFFLGIRNDIYGLM 348
             +V R V   +GL ++  +  +G+ ND+  L+
Sbjct: 293 VPAVARAVFNLIGLALLAAVVLIGLANDLKRLL 325


>gi|322378876|ref|ZP_08053293.1| putative metalloprotease [Helicobacter suis HS1]
 gi|321148686|gb|EFX43169.1| putative metalloprotease [Helicobacter suis HS1]
          Length = 337

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/338 (26%), Positives = 174/338 (51%), Gaps = 10/338 (2%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           LL   +L  +++ HEFGH+ +ARLC + V  FS+GFGP+L  I      ++ + LI LGG
Sbjct: 4   LLAIGALAFLIIFHEFGHFCMARLCKVEVEVFSLGFGPKLF-IKQHKNTKYCLCLILLGG 62

Query: 68  YVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNVS 126
           YV+  ++ +    +    P +K L +L GPL N ++A +++   F   +  + P+V +V 
Sbjct: 63  YVALKQEGEG--GYLAKTPIQKSLILLGGPLFNLLLAGLIYLALFLTPSPHLAPIVGSVL 120

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
           P  PA  AG++  D I+S++  ++  ++++   +++     +SL + R++  +LHL+ +P
Sbjct: 121 PNMPAKQAGLQPKDQILSINHKSIRNWQDLQSAIQQK--GSLSLEIKRQN-QILHLQALP 177

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF 246
           + Q + + F     +  +GI+ S  +  + S   L++ +R   ++  +    L  +    
Sbjct: 178 KEQKSFNAFKEPILIKMLGITPS-KQIVMISYPFLEALNRAYKQVQEMIVLTLKGIKKLL 236

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
                L++++  VGI              +   +A  S  +G +NL PIP+LDGG L   
Sbjct: 237 IGALPLSEVNSVVGIVDFLST--QSQLQTWSLSVAFISINLGLLNLFPIPLLDGGQLFLL 294

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            LE +  + +     +++  +G   +L L  LG+ ND+
Sbjct: 295 WLETLIQRKISPQTMQLLNALGFAFLLSLMGLGLFNDL 332


>gi|126726884|ref|ZP_01742723.1| Putative membrane-associated zinc metalloprotease [Rhodobacterales
           bacterium HTCC2150]
 gi|126703842|gb|EBA02936.1| Putative membrane-associated zinc metalloprotease [Rhodobacterales
           bacterium HTCC2150]
          Length = 448

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 118/431 (27%), Positives = 179/431 (41%), Gaps = 93/431 (21%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L + V+L IIV +HE+GHY+V R C I+   FS+GFGP L     + G RW+++ +P 
Sbjct: 14  AILAFIVALSIIVTVHEYGHYIVGRWCGIKAEVFSLGFGPVLFSRHDKHGTRWQLAALPF 73

Query: 66  GGYVSFS-----------------EDEKDMRSFFCAAPWKK------------ILTVL-- 94
           GGYV F                   DE   +S F AA W++            +LT++  
Sbjct: 74  GGYVKFLGDANAASQPDGEAVAALSDEDAAKSMFGAALWRRALTVLAGPVFNFVLTIIIF 133

Query: 95  ------------------------------AGPLA---NCVMAILFFTFFFYNTGVMKPV 121
                                         AG L    N V    +  FF  +  + +P 
Sbjct: 134 AVIALSRGLPVDEPKIGAIKNNPAGVSELQAGDLILELNGVPVDSYKAFFSQSDTIEQPT 193

Query: 122 VS---------------NVSPA--------SPAAIAGVKKGDCIISLDGITVSAFEEVAP 158
           V                N SPA        S A  AG+++GD II+++   V+ F+ +  
Sbjct: 194 VDYLVERKGATMAITGPNPSPALVDRVSFGSAAEDAGLEEGDVIIAVNDAPVATFQNLMA 253

Query: 159 YVRENPLHEISLVLYR-----EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD-E 212
            V E     + L ++R     +      +++ PR  D     G       +GIS S   E
Sbjct: 254 IVAELDGAPMRLTIWRADADGQGATEFDVELAPRRSDLPLPEGGFETRWLIGISGSTLFE 313

Query: 213 TKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHG 272
             L + +V  S S G   + SI  G L  LS           + GP+GIA  + N   +G
Sbjct: 314 PVLEAPSVWGSVSYGASRVWSIVTGSLSALSHIVSGAISTCNLQGPIGIAETSGNVASNG 373

Query: 273 FNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCII 332
              ++  +A+ S AIG MNL PIP+LDGGHL+ +  E + G        R++   G+ ++
Sbjct: 374 ILDFVILIAVLSTAIGMMNLFPIPVLDGGHLLFYAYEAVTGNPPPEKALRLLFAAGMALV 433

Query: 333 LFLFFLGIRND 343
           L +    + ND
Sbjct: 434 LGMMIFSVFND 444


>gi|325661702|ref|ZP_08150325.1| RIP metalloprotease RseP [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471955|gb|EGC75170.1| RIP metalloprotease RseP [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 344

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 99/344 (28%), Positives = 162/344 (47%), Gaps = 27/344 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           IV++HE GH+++A+   I V  FS+G GP ++    R G R+   L+P GG     EDE 
Sbjct: 13  IVIVHELGHFLLAKKNGIDVSEFSLGMGPRILSF-ERGGTRYSWKLLPFGGSCMMGEDEI 71

Query: 77  DMRS---FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           D +S   F   + W +I  + AGP+ N ++A +F        G    V   V P S A  
Sbjct: 72  DDQSAGSFNSKSVWARISVIAAGPVFNFILAFIFAVILVAWVGYDPAVADEVIPGSAAEE 131

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLH--EISLVLYREHVGVLHLKVMPRLQDT 191
           AG++KGD I+ ++   ++ + EV  Y   N +H  E   V Y       H+ + PR+ + 
Sbjct: 132 AGLQKGDVIVKMNHKDINLWREVQVY---NQMHQGETVTVTYERDGKEHHVDIKPRMDEE 188

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
              +        +G++    + +      L++   G+ E+       L  L         
Sbjct: 189 TGMY-------LLGLT---GKAQNEEADGLKALQYGVYEVKYWICTTLDGLKMLVTGKVG 238

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFL--------AMFSWAIGFMNLLPIPILDGGHL 303
           L+Q++GPVGI  +  + ++    A +A +         + S  +G MNLLPIP LDGG L
Sbjct: 239 LDQMAGPVGIVNLVDDTYEAAKPAGMAIVFLNLMNIGILLSANLGVMNLLPIPALDGGRL 298

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +  +LE+IRGK +      ++   G  ++  L  L + ND+  L
Sbjct: 299 VFLILEVIRGKRIAPEKEGMVHFAGFVLLFGLMILILFNDVKNL 342


>gi|322380399|ref|ZP_08054605.1| zinc metalloprotase [Helicobacter suis HS5]
 gi|321147189|gb|EFX41883.1| zinc metalloprotase [Helicobacter suis HS5]
          Length = 337

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/338 (26%), Positives = 174/338 (51%), Gaps = 10/338 (2%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           LL   +L  +++ HEFGH+ +ARLC + V  FS+GFGP+L  I      ++ + LI LGG
Sbjct: 4   LLAIGALAFLIIFHEFGHFCMARLCKVEVEVFSLGFGPKLF-IKQHKNTKYCLCLILLGG 62

Query: 68  YVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNVS 126
           YV+  ++ +    +    P +K L +L GPL N ++A +++   F   +  + P+V +V 
Sbjct: 63  YVALKQEGEG--GYLAKTPIQKSLILLGGPLFNLLLAGLIYLALFLTPSPHLAPIVGSVL 120

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
           P  PA  AG++  D I+S++  ++  ++++   +++     +SL + R++  +LHL+ +P
Sbjct: 121 PNMPAKQAGLQPKDQILSINHKSIRDWQDLQSAIQQK--GSLSLEIKRQN-QILHLQALP 177

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF 246
           + Q + + F     +  +GI+ S  +  + S   L++ +R   ++  +    L  +    
Sbjct: 178 KEQKSFNAFKEPILIKMLGITPS-KQIVMISYPFLEALNRAYKQVQEMIVLTLKGIKKLL 236

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
                L++++  VGI              +   +A  S  +G +NL PIP+LDGG L   
Sbjct: 237 IGALPLSEVNSVVGIVDFLST--QSQLQTWSLSVAFISINLGLLNLFPIPLLDGGQLFLL 294

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            LE +  + +     +++  +G   +L L  LG+ ND+
Sbjct: 295 WLETLIQRKISPQTMQLLNALGFAFLLSLMGLGLFNDL 332


>gi|212696919|ref|ZP_03305047.1| hypothetical protein ANHYDRO_01482 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676209|gb|EEB35816.1| hypothetical protein ANHYDRO_01482 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 337

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/330 (29%), Positives = 157/330 (47%), Gaps = 24/330 (7%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   ++  V  + +++IHEFGH++VA+   I+V  F++G GP++     +    + ++L 
Sbjct: 1   MKSVIISIVMFLFLILIHEFGHFIVAKKSGIKVNEFAIGMGPKIFS-KQKGETLYSINLF 59

Query: 64  PLGGYVSFS-EDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
           P+GGY +   ED +  D RSF  A  +K+ LT+LAGPL N + A L F+   +NTG    
Sbjct: 60  PIGGYCAMEGEDNESDDERSFDKAPAYKRFLTILAGPLTNLIFAGLLFSLVSFNTGKPSK 119

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAP-----YVRENPLHEISLVLYRE 175
           +V   +  SP    G K  D I+ ++   +  F +++      Y   N   EISL + R 
Sbjct: 120 IVGEFTENSPIKSQGFKVNDEILKINNKEIKEFSDISKNLEDFYKNHNKNDEISLTVKRN 179

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
           +  V         ++   +F  KR  P +G      +       V+     G+ ++ S+ 
Sbjct: 180 NKEVE--------KNVRVKFEGKR--PILGFIPKNQKVGFFEAIVI-----GIKQVGSMI 224

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
              + VL S F      + +SGPVG+ +      + G    I FL   S  +GF NLLPI
Sbjct: 225 SMMVLVLKSLFTGQLGFSALSGPVGVVKEMGRQANLGIMNLIFFLGYISVNLGFFNLLPI 284

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVIT 325
           P LDG  + T L EMI  K +   +    T
Sbjct: 285 PALDGSKIFTSLFEMITKKRVNKKIEEKFT 314


>gi|188586062|ref|YP_001917607.1| membrane-associated zinc metalloprotease [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179350749|gb|ACB85019.1| membrane-associated zinc metalloprotease [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 338

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 100/349 (28%), Positives = 176/349 (50%), Gaps = 26/349 (7%)

Query: 8   LLYTVSLI-IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           L+Y++ +  +++ +HEFGH+++A+L  + VL F++GFGP+L+G   +   ++ + +IPLG
Sbjct: 4   LIYSIIIFGLLIFMHEFGHFIIAKLNKVSVLEFAMGFGPKLVGF-QKGETKYSLRIIPLG 62

Query: 67  GYVSF---SEDEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP-- 120
           GY        DE D   SF  A P ++I  + AG + N V+AI+  +  +   GV     
Sbjct: 63  GYCRMKGEDPDESDEEGSFLKATPLQRIAILAAGSIMNFVLAIILLSTLYGTLGVPGDDP 122

Query: 121 -VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
             V ++     A  AG++ GD I  ++   + ++E++   + ENP  E+ L ++R     
Sbjct: 123 NEVGHIVEDGVADEAGIEPGDEITRVNDTEIDSWEQLVTIINENPGEELELSIHRNGDN- 181

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG-F 238
             L V+P  +    R G+      +GI      T L   +   +  +G +E    T   F
Sbjct: 182 FQLTVVPEEEPETGR-GL------IGI------TNLQEASFFAAIRQGAEETWWFTTMIF 228

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
           +G+     G+      ++GPVGI  +     + G    + F A  S  +G +NLLPIP L
Sbjct: 229 VGLYQMITGQIEA--DVAGPVGIVHMIGEVAETGLVNLLPFAAFLSINLGILNLLPIPAL 286

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           DG  +I  L+E+IRG+ +  +    +  +G   ++ L F+ + ND+  L
Sbjct: 287 DGSRIIFSLVELIRGRPVDPTKENFVHFIGFAFLIMLMFVILYNDLMRL 335


>gi|325847064|ref|ZP_08169890.1| RIP metalloprotease RseP [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325481036|gb|EGC84081.1| RIP metalloprotease RseP [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 337

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 97/330 (29%), Positives = 157/330 (47%), Gaps = 24/330 (7%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   ++  +  + +++IHEFGH++VA+   I+V  F++G GP++     +    + ++L 
Sbjct: 1   MKSVIISIIMFLFLILIHEFGHFIVAKKSGIKVNEFAIGMGPKIFS-KQKGETLYSINLF 59

Query: 64  PLGGYVSFS-EDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
           P+GGY +   ED +  D RSF  A  +K+ LT+LAGPL N + A L F+   +NTG    
Sbjct: 60  PIGGYCAMEGEDNESDDERSFDKAPAYKRFLTILAGPLTNLIFAGLLFSLVSFNTGKPSK 119

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAP-----YVRENPLHEISLVLYRE 175
           +V   +  SP    G K  D I+ ++   +  F +++      Y   N   EISL + R 
Sbjct: 120 IVGEFTENSPIKSQGFKVNDEILEINNKEIKEFSDISKSLEDFYKNHNKNDEISLTVKRN 179

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
           +  V         ++   +F  KR  P +G      +       V+     G+ ++ S+ 
Sbjct: 180 NKEVE--------KNVRVKFEGKR--PILGFIPKNQKVGFFEAIVI-----GIKQVGSMI 224

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
              + VL S F      + +SGPVG+ +      + G    I FL   S  +GF NLLPI
Sbjct: 225 SMMVLVLKSLFTGQLGFSALSGPVGVVKEMGRQANLGIMNLIFFLGYISVNLGFFNLLPI 284

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVIT 325
           P LDG  + T L EMI  K +   +    T
Sbjct: 285 PALDGSKIFTSLFEMITKKRVNKKIEEKFT 314


>gi|323142326|ref|ZP_08077158.1| RIP metalloprotease RseP [Phascolarctobacterium sp. YIT 12067]
 gi|322413210|gb|EFY04097.1| RIP metalloprotease RseP [Phascolarctobacterium sp. YIT 12067]
          Length = 338

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 103/343 (30%), Positives = 171/343 (49%), Gaps = 33/343 (9%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSFS-- 72
           ++V +HEFGH++ A+L  +RV  F++GFGP+L     + G   + +  IPLGGY   +  
Sbjct: 13  VLVTVHEFGHFITAKLTGMRVDEFAIGFGPKLY--QQKDGDTLYSLRAIPLGGYNKIAGM 70

Query: 73  --EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG----VMKPVVSNVS 126
             +D  +  +F       ++L +LAG L N ++ I+ F+  F   G    V +P++  V 
Sbjct: 71  DPDDPPEPGTFKSKPIPSRMLVILAGALMNFLLPIILFSGIFMLEGRQELVNEPILGTVV 130

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
               A  AG++ GD I++++   V+ + EV   +R +  + ++L    E  G +    M 
Sbjct: 131 DGMAAERAGLRNGDRILTINNKPVATWTEVVTNLRASGTNPVTLT--AESKGAVKSYTMT 188

Query: 187 RLQD-TVDR--FGIKRQVPSVGISF--SYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
            + D    R   GI  +   V + F  S  E  ++++ ++ S   GL +I S        
Sbjct: 189 PVYDREAGRPLIGISPKFNKVSLGFFGSIKEGCVYTKNIIVSMLNGLYKIVS-------- 240

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
                GK     +++GP+G+A++A    + G    I F+A  S  +G +NLLP+P LDGG
Sbjct: 241 -----GKAPA--EVAGPIGVAQMAGQVAEKGMLPLITFVAFLSINLGVINLLPLPALDGG 293

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           H +  LLE +RGK LG      I  +G+ +IL L       DI
Sbjct: 294 HFVLLLLEGLRGKPLGSKAMTNIQMVGIALILALTVFSTFKDI 336


>gi|150016080|ref|YP_001308334.1| membrane-associated zinc metalloprotease [Clostridium beijerinckii
           NCIMB 8052]
 gi|149902545|gb|ABR33378.1| putative membrane-associated zinc metalloprotease [Clostridium
           beijerinckii NCIMB 8052]
          Length = 336

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 167/335 (49%), Gaps = 22/335 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +++++HE GH+ +A+L  +RV  FS+G GP++     +   ++ + L P+GGYV    +E
Sbjct: 12  VLIIVHELGHFTLAKLNGVRVEEFSIGMGPKIFSNQGKE-TQYSLRLFPIGGYVKMMGEE 70

Query: 76  K---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           +   D RSF   +P ++I  ++AG   N V+AI+ FTFF +  G    + + V+P SPA+
Sbjct: 71  ESVEDERSFSAKSPLRRISIIIAGVFMNYVLAIVIFTFFIHAFGYTNKIPTGVTPDSPAS 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYV---RENPLHEISLVLYREHVGVLHLKVMPRLQ 189
            AG+  GD I+ ++G+   +++ ++  +     NP+ +IS+    E   V          
Sbjct: 131 EAGILPGDKIVKVNGMRAFSYDNISAGIVLANGNPV-DISIERNGEKKDV---------- 179

Query: 190 DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKD 249
            TV     ++    +G++F   +   +S +  QSF++    +S   +G   + +   GK 
Sbjct: 180 -TVTPMKNEQGQLLIGLNFERIQNPGYSESFKQSFNQTASLVSQTFKGLEMIFT---GKA 235

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
                + GP+ I +I+      G    + F A  S  +   NLLP P LDGG  +  L+E
Sbjct: 236 NLKTDVGGPLTIVKISAETAKAGIWPLLYFTAFLSVNLAVFNLLPFPALDGGWCVILLIE 295

Query: 310 MIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +I  + +   +  V+  +G   ++ L  L    DI
Sbjct: 296 LITRRKVPDKIVGVLNYIGFAALIGLMILVTIKDI 330


>gi|225375370|ref|ZP_03752591.1| hypothetical protein ROSEINA2194_00995 [Roseburia inulinivorans DSM
           16841]
 gi|225212859|gb|EEG95213.1| hypothetical protein ROSEINA2194_00995 [Roseburia inulinivorans DSM
           16841]
          Length = 346

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 102/342 (29%), Positives = 162/342 (47%), Gaps = 25/342 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           II++ HE GH+++A+   IRV  FS+G GP L GI  +   ++ + L+P GG      ++
Sbjct: 12  IIILFHELGHFLLAKANGIRVNEFSLGLGPTLFGI-QKGETKYSIKLLPFGGACMMEGED 70

Query: 76  ---KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
              +D ++F   + W +I  V AGP+ N +MA +F       TG   PV+S+VS    A 
Sbjct: 71  SESQDNKAFNNKSVWARISVVAAGPIFNFIMAFIFSFILVCCTGYDLPVLSDVSEGYAAE 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            AG++ GD I+ +    +  + EV+ Y   +    +  V Y         ++ P+  +T 
Sbjct: 131 EAGLQAGDTIVKMGNKHIHFYREVSAYSMYHAGEPVK-VTYERDGERYTTELTPKYDETT 189

Query: 193 DR--FGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDT 250
            R  +G         I  +  E   ++   L  +S    E+       LG L   F    
Sbjct: 190 GRYLYGF--------IGMAAREKTTNNVFTLAKYSA--YEVEYWIYTTLGSLKMLFTGGV 239

Query: 251 RLNQISGPVGIARIAKNFFDH--GFNAYIAFLAM------FSWAIGFMNLLPIPILDGGH 302
            +N +SGPVGI     + ++    +  + AFL M       S  +G MNLLP+P LDGG 
Sbjct: 240 TVNDMSGPVGIVSAIGDSYEQSVSYGYFYAFLQMLYISILLSANLGVMNLLPLPALDGGR 299

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L+  L+E IRGK +      ++   G+ I+  L  L + NDI
Sbjct: 300 LVFLLVEAIRGKKVDPEKEGMVHFAGIMILFALMILIMFNDI 341


>gi|148265746|ref|YP_001232452.1| putative membrane-associated zinc metalloprotease [Geobacter
           uraniireducens Rf4]
 gi|146399246|gb|ABQ27879.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Geobacter
           uraniireducens Rf4]
          Length = 355

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 101/347 (29%), Positives = 168/347 (48%), Gaps = 22/347 (6%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++L  ++ IHE GH++ A+L  + V  FS+GFGP+++G        + +S  PLGGYV  
Sbjct: 9   IALGALIFIHELGHFIFAKLFGVGVEKFSLGFGPKIVG-KKVGETEYLLSAFPLGGYVKM 67

Query: 72  S--------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF----YNTGVMK 119
                     D    RSF    P K+I+ V AGP+ N     LFF +F     Y  GV  
Sbjct: 68  VGEGDGADLSDADKSRSFAEKPPLKRIVIVAAGPVFN-----LFFAWFIFIVVYMVGVPA 122

Query: 120 PV--VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
               +  V    PAA AG+   D + +++G  V+ +EE+A  + E     + L + R   
Sbjct: 123 ATTKIGEVVKDKPAARAGLMAKDVVTAINGKAVNRWEELAKNIAEGKGQPVELQVNR-GT 181

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
             L  +V+P  +   +  G     P +G+  S  E  +     L +  +G  +  ++ R 
Sbjct: 182 ATLVFRVVPESRTVKNLLGDTVTSPVLGV-VSAGEVVIDRFGPLDALVKGSGQTWNVIRI 240

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
            +  L     +   L+ I GP+ I ++A      G  +++AF+A+ S  +G +NLLP+PI
Sbjct: 241 TVLSLVKLVERAIPLDTIGGPIMIVKMAGQQASEGGVSFLAFVALLSINLGVLNLLPVPI 300

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LDGGHL  +  E++  + +      +  ++GL +++ L  L   NDI
Sbjct: 301 LDGGHLFFYFWELVFRRPVSPKAREIAQQVGLVLLISLMILAFYNDI 347


>gi|304439995|ref|ZP_07399888.1| RIP metalloprotease RseP [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371487|gb|EFM25100.1| RIP metalloprotease RseP [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 330

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 94/339 (27%), Positives = 164/339 (48%), Gaps = 25/339 (7%)

Query: 15  IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-- 72
           ++++++HE GH + A+   I+V  F+VG GP++ G   +    + +  +P+GGY +    
Sbjct: 12  LLVILLHEAGHLVAAKASGIKVNEFAVGMGPKIFG-KQKGETLYSLRALPIGGYCAMEGE 70

Query: 73  -EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPA 131
            ED +D R+F   +  ++++T+LAG   N V+AI+ FT      GV    +  + P SPA
Sbjct: 71  GEDSEDPRAFNNVSIGRRMVTILAGAFMNFVLAIVAFTIIAGFNGVPSTTIGEIVPGSPA 130

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLK-VMPRLQD 190
              G   GD ++ +D   +  F ++   +       + +   RE  G L+ + V    +D
Sbjct: 131 EQMGFVPGDKVVVIDHTEIKEFSDIPKTIAAAQKDTVRVYAVRE--GRLYAQNVKVEEKD 188

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDT 250
                GIK ++               +R    S   G  + +++ +    VL   F    
Sbjct: 189 GQKMIGIKPKI---------------NRGATYSVRYGFKQTANVVKEVFQVLGMLFTGKL 233

Query: 251 RLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEM 310
            L+++SGPVG+ ++       GF   +A L + S  +G +NLLPIP LDGG  +  L+E 
Sbjct: 234 ALSRLSGPVGVIKVIGQSAKFGFLNVLAILGLISANLGVVNLLPIPALDGGRFVMLLIEK 293

Query: 311 IRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           +RGK L   V   I  +G    +F+F + I   I+G ++
Sbjct: 294 LRGKPLSEKVEYYINLVGF---IFVFSIMIYVTIFGDLK 329


>gi|312143671|ref|YP_003995117.1| membrane-associated zinc metalloprotease [Halanaerobium sp.
           'sapolanicus']
 gi|311904322|gb|ADQ14763.1| membrane-associated zinc metalloprotease [Halanaerobium sp.
           'sapolanicus']
          Length = 357

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 176/366 (48%), Gaps = 44/366 (12%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L + V L ++V IHEFGHY+ A+   I V  F++GFGP+LI         + +  IPL
Sbjct: 4   TILSFIVVLGLLVFIHEFGHYITAKKSGIMVSEFALGFGPKLI-YKKVGETLYSIRAIPL 62

Query: 66  GGYV----------SFSEDEK--------DMRSFFCAAPWKKILTVLAGPLANCVMAILF 107
           GG+           S  E EK        D R F   + + ++  +L GP+ N ++A+L 
Sbjct: 63  GGFCNMVGEFPADESMGEKEKKIYDKAKEDGRLFTQKSAFTRLAVILMGPIMNFLLALLI 122

Query: 108 FTFFFYNTGVM-----KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE 162
           F F F   GV      + V+  V P  PAA AG++  D I+ +DG  V ++EE+A  +RE
Sbjct: 123 FIFAFSVFGVPTSITGEAVLGEVIPEQPAAEAGLRANDRILEIDGTEVESWEEMAALIRE 182

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDR--FGIKRQV--PSVGISFSYDETKLHSR 218
           N   EI+ + Y+ +  V  L + P     V+    GI  Q+   SVG+   +    L + 
Sbjct: 183 NEGREIT-IRYQRNESVDTLSITPVSSADVEGGVIGIYPQLIRESVGV---FQAISLGAA 238

Query: 219 TVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA 278
              Q FS       +IT GF  ++S+   +D     I GPV IA I       G    + 
Sbjct: 239 QTYQIFSM------TIT-GFAQMISTRSAED-----IGGPVMIASIIGQAARVGIINVLN 286

Query: 279 FLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
           + A+ S  +G +NLLP P LDGG +   ++E++RGK +       +  +G  ++L L   
Sbjct: 287 WTAIISINLGIINLLPFPALDGGRITFIVIELLRGKPVDPEKESYVHLVGFAVLLLLMVF 346

Query: 339 GIRNDI 344
            I  D+
Sbjct: 347 IIYRDV 352


>gi|317121848|ref|YP_004101851.1| membrane-associated zinc metalloprotease [Thermaerobacter
           marianensis DSM 12885]
 gi|315591828|gb|ADU51124.1| membrane-associated zinc metalloprotease [Thermaerobacter
           marianensis DSM 12885]
          Length = 344

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 96/341 (28%), Positives = 162/341 (47%), Gaps = 24/341 (7%)

Query: 7   FLLYTVSL-IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
            +++T+++  +++VIHE GH+  A+   + V  F++GFGP L     R    + + L+PL
Sbjct: 1   MVVWTIAVFALLIVIHELGHFWAAKRSGVLVHEFALGFGPRL-AYVRRGETEYSLRLLPL 59

Query: 66  GGYVSFS---------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GG+V  +         ED    R F       ++  + AGP+ N V+A++ FT  F   G
Sbjct: 60  GGFVRMAGMQPDEEGLEDVPPPRRFLGRPLGDRLKIIAAGPVMNVVLAVVLFTLVFAVIG 119

Query: 117 V--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
           V   +PVV  V    PAA AG++ GD I+++DG  V ++E+V   ++      + + + R
Sbjct: 120 VPVARPVVGEVVAGYPAAEAGLRPGDRIVAIDGQPVESWEQVVEGIQGAGQRPVEITVRR 179

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI 234
                L ++V PR            Q P VG+     + +     V+++  RG      +
Sbjct: 180 GE-ATLTVRVTPRPDP---------QRPGVGVVGIRPQVETARTGVVEAVVRGAQATYQV 229

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
             GF+  L          + I GPVGI R        G +  +   A+ S  +  +NLLP
Sbjct: 230 AAGFVLALVHLITGQGGFD-IIGPVGIGRQIGEAARVGLSQVVLLAAVLSANLALVNLLP 288

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335
           IP LDGG L+   +E +RG+ +      +I  +G  +++ L
Sbjct: 289 IPALDGGRLLFLAVEAVRGRPVDPEQENLIHFVGFALLMLL 329


>gi|313888292|ref|ZP_07821963.1| RIP metalloprotease RseP [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845695|gb|EFR33085.1| RIP metalloprotease RseP [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 336

 Score =  139 bits (350), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 164/328 (50%), Gaps = 19/328 (5%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK---D 77
           HE GH+ VA+L  I+V  FS+G GP++     +    + + ++P+GGYV+   +E+   D
Sbjct: 18  HELGHFTVAKLSGIKVNEFSIGMGPKIYQ-KEKGETFYSLRILPVGGYVAMEGEEENSHD 76

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
            R+F     +K++  VLAG   N V+  L FT  F   G     +  V   SPA  +G+K
Sbjct: 77  PRAFNNVHIFKRMAVVLAGAFMNFVLGFLAFTIIFSIVGYGSNEIDKVIENSPAMTSGLK 136

Query: 138 KGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGI 197
            GD II ++G       ++   + +N   E++  + R+   +L   + P+  +       
Sbjct: 137 TGDKIIKINGSPTRDIYDINSVISKNNDKEMNFFIDRKGE-LLKFSIKPQFSE------- 188

Query: 198 KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISG 257
           + ++  +GI+   D       + L+S S G D    +++  +  +   F    ++  +SG
Sbjct: 189 ENKMYLIGITSKID------HSFLKSISLGADRTLQMSKMIIQSIKMMFSGSFKMEYLSG 242

Query: 258 PVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLG 317
           PVG+ ++  +    GF  ++  L + S  +G  NLLPIP LDGG  +  L+E I GK + 
Sbjct: 243 PVGVVQLIGSESSKGFLNFLQILGLISVNLGVFNLLPIPALDGGKFLFLLIEAIMGKPIN 302

Query: 318 VSVTRVITRMGLCIIL-FLFFLGIRNDI 344
             + + ++ +G+ ++   + ++ I NDI
Sbjct: 303 EKIEQGLSLIGISLLFSLMIYVTIFNDI 330


>gi|110803066|ref|YP_698980.1| membrane-associated zinc metalloprotease [Clostridium perfringens
           SM101]
 gi|110683567|gb|ABG86937.1| RIP metalloprotease RseP [Clostridium perfringens SM101]
          Length = 335

 Score =  139 bits (350), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 164/332 (49%), Gaps = 18/332 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED 74
           ++++HE GH++VA+L  I V  F++G GP+L G+       + + ++P GG+V     ED
Sbjct: 13  LILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGE-TEYNLRILPFGGFVKMLGEED 71

Query: 75  E-KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           E  D RS     P ++IL + AG   N V+A++ F     ++G  +  V++V P SPA  
Sbjct: 72  ESDDSRSLNAKTPIQRILVMGAGAFMNYVLALIIFIGLAMSSGFAENKVASVVPNSPAQE 131

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVD 193
            G+K+GD  + +DG  +   ++    +     + + L + R +  VL   V P L D+  
Sbjct: 132 IGIKQGDEFLKIDGNKIHTTDDFRMGLALAKGNSVELEIKRGN-DVLTKTVQPILNDS-- 188

Query: 194 RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS-ITRGFLGVLSSAFGKDTRL 252
                  +  VGIS++  E      T+LQ   +G +E  S +++ F+ + +   G+    
Sbjct: 189 ------GMYQVGISYALVEKP----TLLQGIKQGFNETRSLVSQSFIALKTIVTGEANLK 238

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
             + GPV I +++      G N  + F+A  S  +   NLLP P LDGG +   L++MI 
Sbjct: 239 TDVGGPVTIIKMSGQAAKAGANTLLWFMAFLSVQLAVFNLLPFPALDGGRIFIELIQMII 298

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            K +       +  +G  +++ L  L    DI
Sbjct: 299 RKEIPAKYIEAVNTVGFMLLMGLMVLVTIKDI 330


>gi|328948070|ref|YP_004365407.1| membrane-associated zinc metalloprotease [Treponema succinifaciens
           DSM 2489]
 gi|328448394|gb|AEB14110.1| membrane-associated zinc metalloprotease [Treponema succinifaciens
           DSM 2489]
          Length = 370

 Score =  139 bits (349), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 115/389 (29%), Positives = 174/389 (44%), Gaps = 76/389 (19%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
            F+L  + L  +V  HE GH++ AR+  ++V +FS+G GP L+  T +    +++SLIPL
Sbjct: 2   TFVLGILGLGFLVFFHELGHFIAARIFGVKVEAFSIGMGPVLVHRTWKE-TDYRISLIPL 60

Query: 66  GGYVSFSED-------EKDMR-------SFFCAAPWKKILTVLAGPLANCVMAIL-FFT- 109
           GGY +   +       EK+++       SF+   P K++    AGP AN +   L FFT 
Sbjct: 61  GGYCAMKGEKDFQDAMEKNLKEIQGEKDSFYGIHPLKRLAIAFAGPFANFLFGFLAFFTI 120

Query: 110 ----FFFYNTGVMKPVVSNVSPA--SPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN 163
               + +Y+ G    +   + P   SPA  AG++ GD I+SL+G  V+ F E+A ++  +
Sbjct: 121 AIIGYTYYSAGTKVSMADEIYPELYSPAHNAGMESGDKILSLNGTAVNDFSEIAAFISTH 180

Query: 164 PLHEISLVLYREHVGVLHLKVMPRL--QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVL 221
           P   I + + RE   +L   V   L  +  + + GI     SV               V 
Sbjct: 181 PDENIQIEVERED-KILFFNVKTELDKETGIGKLGIVSDPESV---------------VA 224

Query: 222 QSFSRGLDEISSITRGFLGVLSSAF----------GKDTRL--------NQISGPVGIAR 263
             + R          GF G     F          GK  R+        N +SGPV I  
Sbjct: 225 HEYPR---------HGFFGACKEGFVQSAKIIALTGKSIRILFKGVNLTNAVSGPVRITS 275

Query: 264 IAKNFFDHGFNA--------YIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKS 315
           I       GF A         + FLA+ S ++   NLLPIP+LDGG ++  L+E +  K 
Sbjct: 276 ILGTTVKQGFAAGFKEGVVSTLEFLALISISLFLTNLLPIPVLDGGLILFALIEFLARKK 335

Query: 316 LGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +   V   I  +G+  I  LF   I  DI
Sbjct: 336 INPKVLYYIQFVGIFFIALLFIFAITGDI 364


>gi|260892488|ref|YP_003238585.1| membrane-associated zinc metalloprotease [Ammonifex degensii KC4]
 gi|260864629|gb|ACX51735.1| membrane-associated zinc metalloprotease [Ammonifex degensii KC4]
          Length = 347

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 102/331 (30%), Positives = 161/331 (48%), Gaps = 28/331 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---- 71
           +I+ IHE GH++ ARL  + V  FS+GFGP L G   R    + + L+PLGGYV      
Sbjct: 16  LIIFIHEAGHFLAARLVGVGVYEFSLGFGPRLGGF-KRHKTEYNLRLVPLGGYVRLVGMD 74

Query: 72  -SEDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV----VSNV 125
             + E++    F   P W ++L +LAGP  N  +A+L     F+  G+  PV    ++ V
Sbjct: 75  PEDKEREAPYSFARKPVWSRMLVILAGPFMNFFLAVLMLAIVFFWQGI--PVATTRIAEV 132

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM 185
            P  PAA AG K GD I+++DG  V++++E+A  +   P  E ++ + R+    ++L V 
Sbjct: 133 LPHYPAAAAGFKPGDRIVAIDGQPVNSWKEIAKIIGSGPSQERTITVERDG-KFINLVVS 191

Query: 186 PRLQDT-VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSS 244
           P+  +T  ++ GI   VP V               +L S  +G+   +++ +     L  
Sbjct: 192 PQPDETGKNKIGI---VPVV---------VTEHPGLLGSLKQGVVATANMIKLIFLFLGH 239

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
                   + I GPV IA         G +  + F A  S  +GF NLLPIP LDG   +
Sbjct: 240 LLLHQAPAD-IGGPVRIAVETGKVAQMGLSPLLQFTAFLSINVGFFNLLPIPALDGARFL 298

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335
             L E +  + L      ++  +G  ++LFL
Sbjct: 299 FLLWEGVTRRPLDPKKENLVHLVGFALLLFL 329


>gi|297617179|ref|YP_003702338.1| membrane-associated zinc metalloprotease [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145016|gb|ADI01773.1| membrane-associated zinc metalloprotease [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 345

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 171/349 (48%), Gaps = 31/349 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           IIV++HE GH++ A+   + V  FS+GFGP LIGI  R   R+ + L+PLGG+V  +   
Sbjct: 12  IIVMVHEIGHFVAAKWQGVEVQEFSIGFGPSLIGI-KRGETRYSLRLLPLGGFVRMAGMG 70

Query: 73  ---EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG----VMKPVVSNV 125
              ED+ + + F    P +K+  + AGP  N ++A L F + F   G    V  PV+  V
Sbjct: 71  AQDEDQDNPQGFNRKTPLQKVEVLAAGPGMNFLLAALIFVYTFTFVGIPHAVESPVIGEV 130

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE-NPLHEISLVLYREHVGVLHLKV 184
               PA  AG++  D ++S++G  +S + E    VR+  P   IS+ + R    +  L V
Sbjct: 131 IQGKPAYEAGLRAQDRVVSVNGENISTWNEFVAEVRKAEPGQPISMTVVRNGQKI-ELTV 189

Query: 185 MPRL--QDTVDRFGIKRQVP--SVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240
            P    +      G+++ +    VGI   +D  KL      Q+F      +S + +   G
Sbjct: 190 RPEFDREQKTSIIGVRQTIEFERVGI---WDGLKL---GFYQTFHITWLLLSGLGQLLTG 243

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
             SSA         ++GPVGI R+  +  + G      F A+ S  +G +NLLPIP LDG
Sbjct: 244 AASSA--------DLAGPVGITRMIGDAAEGGLVYLANFTALLSINLGILNLLPIPALDG 295

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
             ++  ++E IR K +       I  +G   ++ L  L   NDI  L++
Sbjct: 296 SRIVFAVIEGIRRKPVEPERENFIHFLGFVFLMVLILLVTYNDIVRLVR 344


>gi|305431901|ref|ZP_07401068.1| RIP metalloprotease RseP [Campylobacter coli JV20]
 gi|304444985|gb|EFM37631.1| RIP metalloprotease RseP [Campylobacter coli JV20]
          Length = 367

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 100/362 (27%), Positives = 180/362 (49%), Gaps = 25/362 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ A+   ++V  FS+GFG  L     + G ++++S
Sbjct: 17  FYSIEFLATILVISFLIFFHELGHFLAAKSLGVKVEIFSIGFGQSLFEREFK-GTKYRLS 75

Query: 62  LIPLGGYVSFS-EDE-------KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY 113
            +PLGGYV    +D+       +D  S+   +P KKI  + AGP  N  +A L +     
Sbjct: 76  ALPLGGYVKLKGQDDMQPGLENQDQDSYSILSPMKKIYILFAGPFFNLFLAFLLY-IAIG 134

Query: 114 NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV 171
           N G+ K  P + N++P S AA+AG++  D I++++GI + +F+E++ ++   PL     +
Sbjct: 135 NLGIQKLSPQIGNIAPNSAAALAGLENNDTILAINGIKIQSFDEISNHLSLEPLK----I 190

Query: 172 LYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
           L       L   + P+L    + FG       +G+S S   T ++ +  +QS +  LDE 
Sbjct: 191 LIDRKGENLEFLITPKLGQAYNDFGQVVSKAQLGVSPSGSTTIIYHQG-MQSINYALDES 249

Query: 232 ----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
               + I +G + ++S     +     + G + +  +     +      +   A+ S  +
Sbjct: 250 IKASTLIVKGIIKLISG----EVEAKNLGGIITMTELTSKAAEKSLVVLLFITALISINL 305

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ ++L L      NDI  +
Sbjct: 306 GILNLLPIPMLDGGHILFNLYEMIFRRKVPPRAFEYLSYGGMALLLSLMVFATFNDIMRV 365

Query: 348 MQ 349
           MQ
Sbjct: 366 MQ 367


>gi|154506083|ref|ZP_02042821.1| hypothetical protein RUMGNA_03625 [Ruminococcus gnavus ATCC 29149]
 gi|153793582|gb|EDN76002.1| hypothetical protein RUMGNA_03625 [Ruminococcus gnavus ATCC 29149]
          Length = 344

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 104/340 (30%), Positives = 154/340 (45%), Gaps = 32/340 (9%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKD--- 77
           HE GH+ +A+L  IRV  FS+G GP L G   + G ++ + L+PLGG     ED+ D   
Sbjct: 17  HELGHFTLAKLNGIRVDEFSLGMGPTLFGKEFK-GTKFSLKLLPLGGACMMGEDDADDTS 75

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
             SF   + W +I  + AGPL N ++A+L         G   PV+  V   S  +  G+K
Sbjct: 76  EGSFNSKSVWARISVIAAGPLFNFILALLMSAILVGAAGYAVPVIQEVESGSSGSEQGLK 135

Query: 138 KGDCIISLDGITVSAFEEVAPYVRENPLHEISLV--LYREHVGVLHLKVMPRLQ---DTV 192
           KGD I  ++G  +  +EE   Y   N  H  S    L  E  G  H   M + Q   +T 
Sbjct: 136 KGDVITEINGKKIHIYEEFQLY---NLTHSTSDTAELTFERDGKEHTIQMEKRQFGDETT 192

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
            R G           F+Y   ++      +S   G           L  L      +  +
Sbjct: 193 KRMG-----------FTYS-AEVEKPGFFKSIQYGAYTAKYWVEYTLECLKMLLTGEVGV 240

Query: 253 NQISGPVGIARIAKNFFD----HGFNAYIAFLA----MFSWAIGFMNLLPIPILDGGHLI 304
           NQ+SGPVGI  +  + +D     G++A I  +     + S  +G MNLLPIP LDGG L+
Sbjct: 241 NQLSGPVGIVEVVNDTYDAAAPSGWSAVILSMMNLGILISANLGVMNLLPIPALDGGRLV 300

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             L+E +R K +      ++  +G   ++ L    + NDI
Sbjct: 301 FLLIEAVRRKRIAPEKEGMVHFIGFAALMALMVFVMYNDI 340


>gi|168187914|ref|ZP_02622549.1| RIP metalloprotease RseP [Clostridium botulinum C str. Eklund]
 gi|169294243|gb|EDS76376.1| RIP metalloprotease RseP [Clostridium botulinum C str. Eklund]
          Length = 345

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 99/328 (30%), Positives = 153/328 (46%), Gaps = 23/328 (7%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           VS  I+++IHEFGH+ +A+L  ++V  F++G GP+L GI  +  + +   +IP+GGYV  
Sbjct: 12  VSFSILIIIHEFGHFALAKLNGVKVEEFAIGMGPKLFGIRGKETL-YAFRVIPIGGYVKM 70

Query: 72  ---SEDEK----DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSN 124
               EDE+    D RSF   +P +++  V AGP+ N V+AI+ F    +  G   P+VS 
Sbjct: 71  LGEGEDEEVPVDDERSFSNKSPLRRLSIVAAGPIMNFVLAIVLFAIIGHMRGFSVPIVSE 130

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V P SPA  AG+K GD I  ++   ++ +E+V   +  +    I + L         + +
Sbjct: 131 VIPNSPAIKAGIKPGDTITKVNNKKINTWEDVIGQINMSKGSPIDVQLLTNKNEQKSVSI 190

Query: 185 MP--RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVL 242
           +P    +D     GI   + +   SFS            QS   GL E  S  +     L
Sbjct: 191 LPIKNSKDGTYMLGICSSIVAKP-SFS------------QSVKYGLQETGSTIKQTFQSL 237

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
              F      N   GPV I R+       G    + F A  S  +G  NLLP P LDG  
Sbjct: 238 GMIFKGKASKNDFGGPVTILRVTWAVSKAGLMNLVLFSAFISIQLGIFNLLPFPALDGFW 297

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLC 330
           +   L +++  + +  +   VI  +G  
Sbjct: 298 IFVSLYQIVTKREINKNRIGVINTIGFA 325


>gi|331084705|ref|ZP_08333793.1| RIP metalloprotease RseP [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330410799|gb|EGG90221.1| RIP metalloprotease RseP [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 344

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 98/344 (28%), Positives = 160/344 (46%), Gaps = 27/344 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           IV++HE GH+++A+   I V  FS+G GP ++    R G R+   L+P GG     EDE 
Sbjct: 13  IVIVHELGHFLLAKKNGIDVSEFSLGMGPRILSF-ERGGTRYSWKLLPFGGSCMMGEDEI 71

Query: 77  DMRS---FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           D +S   F   + W +I  + AGP+ N ++A +F        G    V  +V P S A  
Sbjct: 72  DDQSAGSFNSKSVWARISVIAAGPVFNFILAFIFAVILVAWVGYDPAVADDVIPGSAAEE 131

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLH--EISLVLYREHVGVLHLKVMPRLQDT 191
           AG++K D I+ ++   ++ + EV  Y   N +H  E   V Y        + + PR+ + 
Sbjct: 132 AGLQKDDVIVKMNHKDINLWREVQVY---NQMHQGETVTVTYERDGKEHQVDIKPRMDEE 188

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
              +        +G++      K      L++   G+ E+       L  L         
Sbjct: 189 TGMY-------LLGLTGKAQNEKADG---LKALQYGVYEVKYWICTTLDGLKMLVTGKVG 238

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFL--------AMFSWAIGFMNLLPIPILDGGHL 303
           L+Q++GPVGI  +  + ++    A +A +         + S  +G MNLLPIP LDGG L
Sbjct: 239 LDQMAGPVGIVNLVDDTYEAAKPAGMAIVFLNLMNIGILLSANLGVMNLLPIPALDGGRL 298

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           +  +LE+IRGK +      ++   G  ++  L  L + ND+  L
Sbjct: 299 VFLILEVIRGKRIAPEKEGMVHFAGFVLLFGLMILILFNDVKNL 342


>gi|118443163|ref|YP_878215.1| membrane-associated zinc metalloprotease [Clostridium novyi NT]
 gi|118133619|gb|ABK60663.1| membrane-associated zinc metalloprotease, putative [Clostridium
           novyi NT]
          Length = 345

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 95/323 (29%), Positives = 149/323 (46%), Gaps = 23/323 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---SE 73
           +V+IHEFGH+ +A+L  ++V  F++G GP+L GI  +  + +   +IP+GGYV      E
Sbjct: 17  LVIIHEFGHFALAKLNGVKVEEFAIGMGPKLFGIKGKETL-YAFRIIPIGGYVKMLGEGE 75

Query: 74  DEK----DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPAS 129
           +E+    D RSF   +P +++  V AGP+ N V+AI+ F    +  G   P+VS V P S
Sbjct: 76  EEEVPIDDERSFSNKSPLRRLSIVAAGPIMNFVLAIVLFAIIGHMRGFSVPIVSEVIPNS 135

Query: 130 PAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP--R 187
           PA  AG+K GD I  ++   ++ +E+V   +  +    I + L  ++     + ++P   
Sbjct: 136 PAIKAGIKPGDTITKVNNNKINTWEDVIGQINMSKGSPIDVQLLTKNNEQKSVSIVPIKN 195

Query: 188 LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFG 247
            +D     GI   +             +      QS   GL E SS  +     L   F 
Sbjct: 196 SKDGTYMLGICSSI-------------VEKPNFFQSVKYGLQETSSTIKQTFQSLGMIFK 242

Query: 248 KDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFL 307
                N   GPV I R+       G    + F A  S  +G  NLLP P LDG  +   L
Sbjct: 243 GKASKNDFGGPVTILRVTWAVSKAGLMNLVLFSAFISIQLGIFNLLPFPALDGFWIFVSL 302

Query: 308 LEMIRGKSLGVSVTRVITRMGLC 330
            ++I  + +      VI  +G  
Sbjct: 303 YQIITKREINKDRIGVINTIGFA 325


>gi|187251099|ref|YP_001875581.1| putative membrane-associated zinc metalloprotease [Elusimicrobium
           minutum Pei191]
 gi|186971259|gb|ACC98244.1| Putative membrane-associated zinc metalloprotease [Elusimicrobium
           minutum Pei191]
          Length = 376

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 108/338 (31%), Positives = 168/338 (49%), Gaps = 36/338 (10%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + V+L  IV+IHEFGH++V RL  IRVL FS GFG +++  T +   ++ +  IP GG+V
Sbjct: 15  FLVALSPIVLIHEFGHFIVCRLVGIRVLEFSFGFG-KVLWSTKKGHTQYSIRAIPFGGFV 73

Query: 70  SFSE----DEKDMRS------FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK 119
           + +     D KD ++      F   + WKK+L V++G L N V+A + FT   + TGV  
Sbjct: 74  NPAGEMFVDNKDGKNTPKDYEFASKSWWKKLLMVISGALMNYVLAFIVFTSLVFVTGV-- 131

Query: 120 PVV-SNVSPA--------SPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
           PV  S  +PA         PA   G++  D I+ ++   V+ +++V   V         L
Sbjct: 132 PVTDSKATPAVLGEVVANYPAQKHGLEAQDKILKINETPVNNWQDVLNSVAS---LNTDL 188

Query: 171 VLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
            L  E  G +    +P      D        P +GI+    +T   S T LQ+F  GL +
Sbjct: 189 NLKYERNGEIRSLTIPFSDFNKDN-------PKLGIAV---QTLYTSATPLQAFRSGLYQ 238

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
               T+  L  L  A  K  +L +++GP+GI         +G+  ++  + + S A+G  
Sbjct: 239 CWFWTKLSLTELYKAVSKTKKL-EVAGPIGIFHRVHQATQNGWMDFVWLIGLLSLAVGMF 297

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMG 328
           NL PIP+LDGG+ + F+ E I GK   V V  +   +G
Sbjct: 298 NLFPIPVLDGGYAVVFIWEGITGKLPSVKVVNIALNVG 335


>gi|320529255|ref|ZP_08030347.1| RIP metalloprotease RseP [Selenomonas artemidis F0399]
 gi|320138885|gb|EFW30775.1| RIP metalloprotease RseP [Selenomonas artemidis F0399]
          Length = 346

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 100/339 (29%), Positives = 169/339 (49%), Gaps = 23/339 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           ++V +HE GH++ A+L  +RV  F++GFGP L+       V + + ++PLGG+      +
Sbjct: 14  LLVFVHELGHFITAKLTGMRVDEFAIGFGPRLLSFRYGETV-YSIRIVPLGGFNDIAGMT 72

Query: 73  EDEKDM-RSFFCAAP-WKKILTVLAGPLANCVMAI-LFFTFFFY---NTGVMKPVVSNVS 126
            D+ D     +C  P   ++  +LAG   N ++ + LFF  FF+    T    PV+  V 
Sbjct: 73  PDDNDAGERGYCRKPILSRMFVILAGSAMNLILPVVLFFGIFFFAGVQTPNPAPVLGTVL 132

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV-LHLKVM 185
              PAA AG+   D I+++DG  V  ++ +   +R N    + L +  +  G  L + V 
Sbjct: 133 ADQPAAQAGLLPQDRIVAIDGTPVETWQSMVEMIRGNQ-GNVPLTMQIDRTGQNLTVSVT 191

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           PR   T +R         +GI  ++D T        QS +  ++    I    L  L   
Sbjct: 192 PRYDATQNRG-------YIGIVNAFDSTY---PGFFQSLTMAVERTGVIIVMMLDALYHI 241

Query: 246 FGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLIT 305
              +   ++++GP+G+A++A    + G    + F A+ S  +G +NLLP+P LDGGH +T
Sbjct: 242 I-LELSGSELAGPIGVAQMAGEVAEMGIVPLLNFAALLSLNLGIINLLPVPALDGGHFLT 300

Query: 306 FLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             +E +RGK L   V   I   G+ +I+ L  L ++ND+
Sbjct: 301 LCVEAVRGKPLSPKVMHYIQNAGVGLIILLMLLAMKNDV 339


>gi|168216980|ref|ZP_02642605.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens NCTC 8239]
 gi|182380975|gb|EDT78454.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens NCTC 8239]
          Length = 335

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 97/335 (28%), Positives = 165/335 (49%), Gaps = 24/335 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED 74
           ++++HE GH++VA+L  I V  F++G GP+L G+       + + ++P GG+V     ED
Sbjct: 13  LILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGE-TEYNLRILPFGGFVKMLGEED 71

Query: 75  E-KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           E  D RS     P ++IL + AG   N V+A++ F     ++G  +  V++V P SPA  
Sbjct: 72  ESDDSRSLNAKTPIQRILVMGAGAFMNYVLALIIFIGLAMSSGFAENKVASVVPNSPAQE 131

Query: 134 AGVKKGDCIISLDGI---TVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQD 190
            G+++GD  + +DG    T+  F       + NP   + L + R +  VL   V P L +
Sbjct: 132 IGIEQGDEFLKIDGNKIHTIDDFRMGLALAKGNP---VELEIKRGN-DVLTKTVQPILNE 187

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS-ITRGFLGVLSSAFGKD 249
           +         +  VGIS++  E      T+LQ   +G +E  S +++ F+ + +   G+ 
Sbjct: 188 S--------GMYQVGISYALVEKP----TLLQGIKQGFNETRSLVSQSFIALKTIVTGEA 235

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
                + GPV I +++      G N  + F+A  S  +   NLLP P LDGG +   L++
Sbjct: 236 NLKTDVGGPVTIIKMSGQAAKAGANTLLWFMAFLSVQLAVFNLLPFPALDGGRIFIELIQ 295

Query: 310 MIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           MI  K +       +  +G  +++ L  L    DI
Sbjct: 296 MIIRKEIPAKYIEAVNTVGFMLLMGLMVLVTIKDI 330


>gi|166031000|ref|ZP_02233829.1| hypothetical protein DORFOR_00681 [Dorea formicigenerans ATCC
           27755]
 gi|166029267|gb|EDR48024.1| hypothetical protein DORFOR_00681 [Dorea formicigenerans ATCC
           27755]
          Length = 343

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 100/342 (29%), Positives = 162/342 (47%), Gaps = 30/342 (8%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           IV  HE GH+ +A+L  I V  F++G GP L       G  + V L+P+GG+ +  ED++
Sbjct: 13  IVFFHELGHFTLAKLNGIDVQEFAIGMGPTLFS-KEYKGTVYAVHLLPIGGFCAMGEDDE 71

Query: 77  DMRS---FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           +  S   F   + W +I  + AGP+ N +MA +         G  KPV+S+V     AA 
Sbjct: 72  ETESPGNFNKKSVWARISVIAAGPIFNFIMAFVLAVILTAMVGYDKPVISSVEEGYSAAE 131

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV-LYREHVGVLHLKVM-PRLQDT 191
           AG+++GD I+ + G  ++ F E+  Y   N  H+   V +   H G  H   + P++ D 
Sbjct: 132 AGIQEGDTIVRMGGKKINVFREITYY---NQFHQGETVKVTYLHDGEKHTATLVPKMDDE 188

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
           +  +        +GIS     TK ++ T +Q    G  E+          L      +  
Sbjct: 189 LGYY-------RIGISGG-GNTKANAWTSVQ---YGAYEVKFWVCTTFESLKQLVTGNVG 237

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLA---------MFSWAIGFMNLLPIPILDGGH 302
           + Q+SGPVGI  +    ++    +Y  F+          + S  +G MNLLP+P LDGG 
Sbjct: 238 VKQLSGPVGIVNMVDTTYNES-KSYGVFIVIAQFLNIGILLSANLGVMNLLPLPALDGGR 296

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L+  L+E IR K +       +   G+ +++ L  + + NDI
Sbjct: 297 LVFLLIEAIRRKRIPPEKEGYVHLAGMALLMILMVVVMYNDI 338


>gi|313896174|ref|ZP_07829727.1| RIP metalloprotease RseP [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312974973|gb|EFR40435.1| RIP metalloprotease RseP [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 346

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 98/339 (28%), Positives = 169/339 (49%), Gaps = 23/339 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           ++V +HE GH++ A+L  +RV  F++GFGP L+       V + + ++PLGG+   +   
Sbjct: 14  LLVFVHELGHFITAKLTGMRVDEFAIGFGPRLVSFRYGETV-YSIRIVPLGGFNDIAGMT 72

Query: 73  -EDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAI-LFFTFFFY---NTGVMKPVVSNVS 126
            +D +     +C  P   ++  +LAG   N ++ + LFF  FF+    T    PV+  V 
Sbjct: 73  PDDNEAGERGYCRKPILSRMFVILAGSAMNLILPVVLFFGIFFFAGVQTPNPAPVLGTVL 132

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV-LHLKVM 185
              PAA AG+   D I+++DG  +  ++ +   +REN    + L +  +  G  L + V 
Sbjct: 133 ADQPAAQAGLLPQDRIVAIDGKPIDTWQSMVEMIRENQ-GNVPLTMQIDRAGQDLTVSVT 191

Query: 186 PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           PR     +R         +GI  +++ T       LQS +   +    I    L  L   
Sbjct: 192 PRYDAAQNRG-------YIGIVNAFNSTY---PGFLQSLTMAFERTGMIIVMMLDALYRI 241

Query: 246 FGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLIT 305
              +   ++++GP+G+A++A    + G    + F A+ S  +G +NLLP+P LDGGH +T
Sbjct: 242 I-LELSGSELAGPIGVAQMAGEVAEMGIVPLLNFAALLSLNLGIINLLPVPALDGGHFLT 300

Query: 306 FLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             +E +RGK L   V   I   G+ +I+ L  L ++ND+
Sbjct: 301 LCVEAVRGKPLSPKVMHYIQNAGVGLIILLMLLAMKNDV 339


>gi|283954629|ref|ZP_06372147.1| putative membrane-associated zinc metalloprotease [Campylobacter
           jejuni subsp. jejuni 414]
 gi|283793821|gb|EFC32572.1| putative membrane-associated zinc metalloprotease [Campylobacter
           jejuni subsp. jejuni 414]
          Length = 368

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 171/358 (47%), Gaps = 27/358 (7%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ AR   ++V  FS+GFG  LI    + G  +++S
Sbjct: 17  FYSIEFLATILVISFLIFFHELGHFLAARSLGVKVEVFSIGFGKSLIERNFK-GTNYRLS 75

Query: 62  LIPLGGYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
            +PLGGYV   + + DMR         S+   +P+KKI  + AGP  N ++A     FF 
Sbjct: 76  ALPLGGYVKL-KGQDDMRPGFENLDKDSYSILSPFKKIYILFAGPFFNLILA-----FFL 129

Query: 113 Y----NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH 166
           Y    N G+ K  P + N++P S A  A ++K D I+ ++ I + +F+E+  ++   PL 
Sbjct: 130 YIIIGNLGINKLAPQIGNIAPNSAAQQAKLQKNDIILEINDIKIQSFDEIPKHLSLEPL- 188

Query: 167 EISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR 226
              +++ RE    L   + P+L    + FG     P +G+S +   T L     L+S   
Sbjct: 189 --KILINREGKN-LEFVLTPKLGQGYNDFGQIVSKPQLGVSPNGVST-LVKHQGLESLRY 244

Query: 227 GLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
            + E    +   +  +      +     + G + +  I      + F   +   A+ S  
Sbjct: 245 AVQESFQASTLIIKGIGKLISGEVDAKNLGGIITMTEITSKAAQNSFTLLLFITALISIN 304

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +G +NLLPIP+LDGGH++  L E+I  + +       ++  G+ ++L L      NDI
Sbjct: 305 LGILNLLPIPMLDGGHILFNLYEIIFRRKVPQRAFEYLSYAGIVVLLSLMIFATYNDI 362


>gi|57167949|ref|ZP_00367088.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           coli RM2228]
 gi|57020323|gb|EAL56992.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           coli RM2228]
          Length = 367

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 180/362 (49%), Gaps = 25/362 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL   + +  ++  HE GH++ A+   ++V  FS+GFG  L     + G ++++S
Sbjct: 17  FYSIEFLATILVISFLIFFHELGHFLAAKSLGVKVEIFSIGFGQSLFEREFK-GTKYRLS 75

Query: 62  LIPLGGYVSFS-EDE-------KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY 113
            +PLGGYV    +D+       +D  S+   +P KKI  + AGP  N  +A L +     
Sbjct: 76  ALPLGGYVKLKGQDDMQPGLENQDQDSYSILSPMKKIYILFAGPFFNLFLAFLLY-IAIG 134

Query: 114 NTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV 171
           N G+ K  P + N++P S AA+AG++  D I++++GI + +F+E++ ++   PL     +
Sbjct: 135 NLGIQKLSPQIGNIAPNSAAALAGLENNDTILAINGIKIQSFDEISNHLSLEPLK----I 190

Query: 172 LYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
           L       L   + P+L    + FG       +G+S S   T ++ +  +QS +  LDE 
Sbjct: 191 LIDRKGENLEFLITPKLGQAYNDFGQVVSKAQLGVSPSGSTTIIYHQG-MQSINYALDES 249

Query: 232 ----SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
               + I +G + ++S     +     + G + +  +     +      +   A+ S  +
Sbjct: 250 IKASTLIVKGIIKLISG----EVEAKNLGGIITMTELTSKAAEKSLVVLLFITALISINL 305

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           G +NLLPIP+LDGGH++  L EMI  + +       ++  G+ ++L L      NDI  +
Sbjct: 306 GILNLLPIPMLDGGHILFNLYEMIFRRKVPPRAFEYLSYGGMALLLSLMVFATFNDIMRV 365

Query: 348 MQ 349
           +Q
Sbjct: 366 IQ 367


>gi|18310675|ref|NP_562609.1| hypothetical protein CPE1693 [Clostridium perfringens str. 13]
 gi|168208110|ref|ZP_02634115.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens E str. JGS1987]
 gi|168214474|ref|ZP_02640099.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens CPE str. F4969]
 gi|182627142|ref|ZP_02954857.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens D str. JGS1721]
 gi|20978812|sp|Q8XJR2|Y1693_CLOPE RecName: Full=Putative zinc metalloprotease CPE1693
 gi|18145356|dbj|BAB81399.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|170660604|gb|EDT13287.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens E str. JGS1987]
 gi|170714027|gb|EDT26209.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens CPE str. F4969]
 gi|177907479|gb|EDT70145.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens D str. JGS1721]
          Length = 335

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 97/335 (28%), Positives = 164/335 (48%), Gaps = 24/335 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED 74
           ++++HE GH++VA+L  I V  F++G GP+L G+       + + ++P GG+V     ED
Sbjct: 13  LILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGE-TEYNLRILPFGGFVKMLGEED 71

Query: 75  E-KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           E  D RS     P ++IL + AG   N V+A++ F     ++G  +  V++V P SPA  
Sbjct: 72  ESDDSRSLNAKTPIQRILVMGAGAFMNYVLALIIFIGLAMSSGFAENKVASVVPNSPAQE 131

Query: 134 AGVKKGDCIISLDGI---TVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQD 190
            G+++GD  + +DG    T   F       + NP   + L + R +  VL   V P L +
Sbjct: 132 IGIEQGDEFLKIDGNKIHTTDDFRMGLALAKGNP---VELEIKRGN-DVLTKTVQPILNE 187

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS-ITRGFLGVLSSAFGKD 249
           +         +  VGIS++  E      T+LQ   +G +E  S +++ F+ + +   G+ 
Sbjct: 188 S--------GMYQVGISYALVEKP----TLLQGIKQGFNETRSLVSQSFIALKTIVTGEA 235

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
                + GPV I +++      G N  + F+A  S  +   NLLP P LDGG +   L++
Sbjct: 236 NLKTDVGGPVTIIKMSGQAAKAGANTLLWFMAFLSVQLAVFNLLPFPALDGGRIFIELIQ 295

Query: 310 MIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           MI  K +       +  +G  +++ L  L    DI
Sbjct: 296 MIIRKEIPAKYIEAVNTVGFMLLMGLMVLVTIKDI 330


>gi|210615975|ref|ZP_03290875.1| hypothetical protein CLONEX_03094 [Clostridium nexile DSM 1787]
 gi|210149980|gb|EEA80989.1| hypothetical protein CLONEX_03094 [Clostridium nexile DSM 1787]
          Length = 342

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 101/354 (28%), Positives = 164/354 (46%), Gaps = 52/354 (14%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +IV IHE GH+++A+   I V  FS+G GP L    +    R+ + L+P+GG     ED+
Sbjct: 12  LIVTIHELGHFLLAKKNGIHVEEFSIGMGPRLFSKVA-GDTRYSIKLLPIGGSCMMGEDD 70

Query: 76  -KDMR--SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
            +DM   SF     W +I  + AGP+ N ++A +F        G  KPV+S V+P   A 
Sbjct: 71  VEDMSEGSFNTKPVWARISVIAAGPIFNFILAFIFAVILVAWVGYDKPVISGVTPGYSAE 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEV-------------APYVRENPLHEISLVLYREHVGV 179
           + G++ GD I+ ++G  ++ + EV               Y R+   HE+++   ++  G 
Sbjct: 131 VEGMQAGDRILKMNGKKINVWREVLYFNVFHPGETVDLTYERDGEKHEVTITPQKDENGA 190

Query: 180 LHLKVM-PRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
             L +M P   +  + F          + +   E K    T L+S       +  +  G 
Sbjct: 191 YKLGLMSPGKNEEANLF--------TALQYGAYEVKFWICTTLES-------LKMLVTGQ 235

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFD----HGFNAYIAFLA----MFSWAIGFM 290
           +GV           +Q+SGPVGI  +  N ++    +G +  I  L     + S  +G M
Sbjct: 236 VGV-----------DQLSGPVGIVDMVGNTYEQSKSYGLSVVIIELMNIAILLSANLGVM 284

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           NL+P P LDGG L+   +E IRGK +      ++   GL ++  L    + NDI
Sbjct: 285 NLIPFPALDGGRLVFLFIEAIRGKRVPPDKEGMVHFAGLMLLFALMIFVMFNDI 338


>gi|302342184|ref|YP_003806713.1| membrane-associated zinc metalloprotease [Desulfarculus baarsii DSM
           2075]
 gi|301638797|gb|ADK84119.1| membrane-associated zinc metalloprotease [Desulfarculus baarsii DSM
           2075]
          Length = 358

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 102/334 (30%), Positives = 167/334 (50%), Gaps = 13/334 (3%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED------ 74
           HE GH++VA+   + V  FS+GFGP L G   R    +++S IPLGG+V    +      
Sbjct: 19  HELGHFLVAKRLGVGVSVFSLGFGPRLAGF-KRGETDYRLSAIPLGGFVRMIGESPGEPV 77

Query: 75  --EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFF--TFFFYNTGVMKPVVSNVSPASP 130
             E   RSF     W+++  V AGPL+N + A L +     F+   ++   V ++    P
Sbjct: 78  APEDLPRSFSHKGVWRRMAIVAAGPLSNVLFAFLLYYAVTLFWGQPMLTAQVGSLVDGMP 137

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQD 190
           A  AG++ GD I ++DG  +++++++   +R +    + L   R+    L L + P+  D
Sbjct: 138 AQAAGLRPGDVISAVDGRAIASWDDLREAIRASQGRRLMLTAQRDGQ-ALELAMSPKRVD 196

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDT 250
           T D FG    V  VG++ S  +    S   L++  R L +    ++  L  +     +  
Sbjct: 197 TKDIFGDVITVYQVGVAPS-GQVLTQSFGPLEAVGRALGQTIEASQLILVSVGKIATRQV 255

Query: 251 RLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEM 310
            +  + GP+ IA++A     HG NA +   A+ S  +  +NLLPIP LDGGHL+ FL E 
Sbjct: 256 PMESVGGPIFIAQVAGEAARHGLNALLGLAALISVNLAILNLLPIPALDGGHLLVFLFEA 315

Query: 311 IRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +  + +   V   I + G+  +L L  L + NDI
Sbjct: 316 VTRRPVSTRVRERIQQAGVFCLLLLTVLVLYNDI 349


>gi|291166152|gb|EFE28198.1| RIP metalloprotease RseP [Filifactor alocis ATCC 35896]
          Length = 343

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 100/337 (29%), Positives = 161/337 (47%), Gaps = 25/337 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           +V IHE GH++VA+  ++RV  F++G GP L   T    + + ++ IP+GG+V  S  E 
Sbjct: 16  LVFIHELGHFIVAKKNDVRVYEFAIGMGPSLFKKTYHDTI-YSINCIPMGGFVRMSPFED 74

Query: 77  D-------MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPAS 129
           D          F    P +KI   LAGP+ N + A++ F  F    G  K +V  V P  
Sbjct: 75  DGEEVCLPEEDFNNKRPMQKIAVALAGPVMNIIFAVIAFCLFIGIVGYEKNMVDQVLPNY 134

Query: 130 PAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQ 189
           PA  +G+ +GD I+S++G+    +E++        + E+S V  +  V V+ +    + +
Sbjct: 135 PAYQSGISEGDTIVSVNGVATKEWEDI--------MKELSKV-EKNSVIVIDILTKEQEE 185

Query: 190 DTVDRFGI-KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGK 248
            TV+   I K     +GI+      K+  R ++ S  RG     SI    L  L   F  
Sbjct: 186 KTVEMVPIFKEGRYMIGIT-----PKIEHR-LIPSVKRGFAMTLSIGTEMLVFLKQLFTG 239

Query: 249 DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLL 308
               N ++GP+GI ++  +    G    +    + S  +G +NLLPIP LDG  ++  ++
Sbjct: 240 RADTNDLAGPIGIIQVVSHTAKVGSEYLLYITGIISLNLGILNLLPIPALDGSRILISVI 299

Query: 309 EMI-RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           E++ RGK L +     I   G   +L L  L    DI
Sbjct: 300 EILRRGKKLSLKWENRINLAGFAFLLGLMILVTYKDI 336


>gi|154147904|ref|YP_001406194.1| RIP metalloprotease RseP [Campylobacter hominis ATCC BAA-381]
 gi|153803913|gb|ABS50920.1| RIP metalloprotease RseP [Campylobacter hominis ATCC BAA-381]
          Length = 370

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 101/356 (28%), Positives = 180/356 (50%), Gaps = 21/356 (5%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   F++  +S+  ++  HEFGH++VAR   ++V  FSVGFG E I   S  G  +++S
Sbjct: 17  FYGINFMVTVLSISFLIFFHEFGHFIVARRLGVKVNVFSVGFG-EKIWAKSWRGTEYRIS 75

Query: 62  LIPLGGYVSF--SEDEK------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF-F 112
            IPLGGYVS    ED K      D  S+   +P+++IL + AGP  N ++A L +    F
Sbjct: 76  AIPLGGYVSLKGQEDLKPELKNFDSDSYNSKSPFERILILFAGPFFNILLAFLIYIALGF 135

Query: 113 YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
                + P + +++  S A+   +KK D I+S++G  V  ++++A  V   PL+   L +
Sbjct: 136 IGVEKLAPKIGHIAENSAASTVELKKNDEILSINGEKVQEWDDIAKNVALKPLN---LEI 192

Query: 173 YREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQ---SFSRGLD 229
            R+   ++++ + P++ + ++ +  K Q P +GIS + +   ++   +     ++ + ++
Sbjct: 193 LRDG-KIINVVLTPKIGEKLNIWREKIQTPLIGISPNGEFVTIYHTGISSLKFAYLQTIE 251

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
               I  G    +S A        ++ G V I  I       G +  +  +A+ S  +G 
Sbjct: 252 ASKLIVIGLEKFVSGAVSP----KEMGGIVAITDITSKAVSFGISPLLLLIALISVNLGI 307

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           +NL PIP LDGGH+   L E+I  K +G       T  G+ ++  L    + ND +
Sbjct: 308 LNLFPIPALDGGHIFFNLYELIFRKPVGEKFFTRATYAGIFLLFALMIFTVINDFF 363


>gi|145589625|ref|YP_001156222.1| putative membrane-associated zinc metalloprotease [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048031|gb|ABP34658.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 377

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 103/369 (27%), Positives = 170/369 (46%), Gaps = 41/369 (11%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + V+L ++V  HEFGH++ AR C +RVL FS+GFG       + +   W ++ IPLGGYV
Sbjct: 10  FLVTLGVLVSFHEFGHFLAARACGVRVLRFSIGFGKPFFTYQANNKTEWTLAPIPLGGYV 69

Query: 70  SFSEDEKDMRSF--------FCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
              +     +S         +   P WK+ L V AGP AN  +AIL F   + +     P
Sbjct: 70  KLLDGRDRTQSISLVEQSEAYDYKPLWKRSLIVAAGPFANFFLAILLFAGLYLSGVPQLP 129

Query: 121 VVSNVSPA-SPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR----- 174
            V    P  S AA   ++ GD ++    +  S  + V        +   + + +R     
Sbjct: 130 AVLQAPPENSIAAQLDLRAGDQVLGWQQLD-SGVKSVPLSGEFKSIPSWNALRWRLMDAL 188

Query: 175 --------EHVG--------VLHLKVMPRLQ---DTVDRFGIKRQVPSVGISFSYDETKL 215
                   E +G        V   + +PRL    D V + GI   +P       + E KL
Sbjct: 189 AGEYGFELEMLGPDGQRFTKVFLAEDLPRLSPDADPVAKLGI---LPVATPLAGWKELKL 245

Query: 216 HSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNA 275
                + +     + +  I++  + V++      T   Q+ GP+ IA +A      G+  
Sbjct: 246 GP---IDAVCFAAERVYLISKLSVRVMAGIVTGKTSFKQLGGPLSIADMAGKTAQVGWQP 302

Query: 276 YIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335
           ++AFLA+ S +IG +NLLP P+LDGG L+    E++ GK + +S    + + G  +++F+
Sbjct: 303 FLAFLALMSISIGILNLLPFPMLDGGQLLYDAWELVAGKRISISRQEQLQKAGFFLLIFI 362

Query: 336 FFLGIRNDI 344
             L + ND+
Sbjct: 363 SLLALFNDL 371


>gi|167759669|ref|ZP_02431796.1| hypothetical protein CLOSCI_02028 [Clostridium scindens ATCC 35704]
 gi|167662700|gb|EDS06830.1| hypothetical protein CLOSCI_02028 [Clostridium scindens ATCC 35704]
          Length = 343

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 98/343 (28%), Positives = 161/343 (46%), Gaps = 32/343 (9%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           IV  HE GH+++A+   I V  F++G GP L+      G ++ V ++P+GG+ +  EDE+
Sbjct: 13  IVFFHELGHFVLAKKNGIDVEEFAIGMGP-LLYSREYKGTKYAVRILPIGGFCAMGEDEE 71

Query: 77  DM---RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
                 SF   + W +I  + AGP+ N ++A++F        G  KPV+  V    PAA 
Sbjct: 72  ATDSPNSFNNKSVWARISVIAAGPIFNFILALVFAVILTGMIGYDKPVIGEVEQGYPAAE 131

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLH--EISLVLYREHVGVLHLKVMPRLQDT 191
           AG+K+GD I+ +    ++ F E+  Y   N  H  E + + + +        + P++ + 
Sbjct: 132 AGIKEGDIIVRMGDKKINVFREINTY---NQFHQGEKTKITFIQDGETKTATLTPKMDEE 188

Query: 192 VD--RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKD 249
           ++  RFGI         S  Y +  L     L +   G  E+       L  L       
Sbjct: 189 LNYYRFGIS--------SSGYTKAGL-----LSALQYGTYEVKYWICTTLESLKMLLTGK 235

Query: 250 TRLNQISGPVGIARIAKNFFDH-----GFNAYIAFLA---MFSWAIGFMNLLPIPILDGG 301
             LNQ+SGPVGI  +  + +       GF   +  L    + S  +G MNLLP+P LDGG
Sbjct: 236 IGLNQLSGPVGIVDVVDDTYKASKSYGGFAVSVQLLNIAILLSANLGVMNLLPLPALDGG 295

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            L+   +E +R K +       +  +G+ +++ L    + NDI
Sbjct: 296 RLVFLFVEAVRRKRIPPEKEGYVHLVGIALLMVLMVFVMYNDI 338


>gi|292670560|ref|ZP_06603986.1| peptidase [Selenomonas noxia ATCC 43541]
 gi|292647726|gb|EFF65698.1| peptidase [Selenomonas noxia ATCC 43541]
          Length = 346

 Score =  136 bits (342), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 99/340 (29%), Positives = 173/340 (50%), Gaps = 25/340 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           ++V +HE GH++ A+L  +RV  F++GFGP L+       V + + ++PLGG+      +
Sbjct: 14  LLVFVHELGHFITAKLTGMRVDEFAIGFGPRLVRFRYGETV-YSIRVVPLGGFNDIAGMT 72

Query: 73  EDEKDM-RSFFCAAP-WKKILTVLAGPLANCVMAI-LFFTFFFY---NTGVMKPVVSNVS 126
            D+ D     +C  P   +++ +LAG   N ++ I LFF  FF+    T   +P++  V 
Sbjct: 73  PDDNDAGERGYCRKPILSRMIVILAGSAMNFILPIVLFFGIFFFAGVQTPNPQPIIGTVL 132

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLH-EISLVLYREHVGV-LHLKV 184
             +PAA AG+   D +I++DG  V  ++E+   +R N  H  + + +  +  G  L + V
Sbjct: 133 VGNPAAEAGLMANDRVIAIDGQPVETWQEMVDAIRLN--HGNVPMTMQVDRAGKELTVSV 190

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSS 244
           MP        +   +Q   +GI  +Y+ +      + QS S  L+    I       L  
Sbjct: 191 MPH-------YDAAQQRGYIGIVNAYESSY---PGLFQSISMALERTGMIIMMMFDALYR 240

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
               +   ++++GP+G+A++A    + G    + F A+ S  +  +NLLP+P LDGGH +
Sbjct: 241 II-LELSGSELAGPIGVAQMAGEVAEMGIVPLLNFAALLSLNLAIINLLPVPALDGGHFL 299

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           T  +E +RGK L   V   I   G+ +I+ L  L ++ND+
Sbjct: 300 TLCVEAVRGKPLSPKVMHYIQNAGVGLIILLMLLAMKNDV 339


>gi|313885316|ref|ZP_07819067.1| RIP metalloprotease RseP [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619422|gb|EFR30860.1| RIP metalloprotease RseP [Eremococcus coleocola ACS-139-V-Col8]
          Length = 432

 Score =  135 bits (341), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 149/283 (52%), Gaps = 26/283 (9%)

Query: 76  KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY---------NTGVMKPVVSNVS 126
           + MR +  A+ W K LT +AGPL N +++IL +T   +          +G  +PVV  VS
Sbjct: 156 RSMR-YESASVWHKFLTNMAGPLNNFILSILIYTLIAFLLPGVPVGTTSGESQPVVGQVS 214

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
             SPAA AG++  D I +++G T+  +E++   +++N   E+SL + R    V  +++ P
Sbjct: 215 QNSPAAAAGLQADDEIKAINGQTIETWEQLTQTIQDNGAKELSLTVERAGKDV-QVQLTP 273

Query: 187 RLQDTVDRFGIKRQVPSVGI----SFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVL 242
              D  D     R V  +GI    + SYD + L +R      + G  +  ++  G  GVL
Sbjct: 274 EKADN-DGGDPNRLV--IGIMQKSNVSYD-SSLGAR-----LTYGFTQTWAVVTGIFGVL 324

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
            S      +L+   GP+ +A++      +GF   ++F+A  S  +G  NLLPIP LDGG 
Sbjct: 325 GSMLVSGFKLDNFGGPIAMAQMTNQVVSYGFTTILSFMAYISANLGVFNLLPIPALDGGK 384

Query: 303 LITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIR-NDI 344
           ++  L+E +RGK L  S   +IT +G   ILF+F + +  NDI
Sbjct: 385 ILLNLVEAVRGKPLSQSKEGIITLVG-VFILFVFMIAVTWNDI 426



 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 4  LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
          +   L++ +   IIVVIHEFGH+  AR   IRV  FS+G GP+L     +    + + ++
Sbjct: 1  MKTLLVFLLIFSIIVVIHEFGHFYFARRAGIRVREFSIGMGPKLFAHQGKDHTAYTIRML 60

Query: 64 PLGGYVSFS--EDEKDMRS 80
          PLGGYV  +   +E+D+++
Sbjct: 61 PLGGYVRLAGLNEEEDLQA 79


>gi|302389808|ref|YP_003825629.1| membrane-associated zinc metalloprotease [Thermosediminibacter
           oceani DSM 16646]
 gi|302200436|gb|ADL08006.1| membrane-associated zinc metalloprotease [Thermosediminibacter
           oceani DSM 16646]
          Length = 333

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 91/323 (28%), Positives = 165/323 (51%), Gaps = 19/323 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
           +++ +HEFGH++ A+LC I+V  FS+GFGP +  +  +    + + ++PLGGYV    ED
Sbjct: 13  VLIFVHEFGHFITAKLCGIKVNEFSMGFGPGIFSV-KKGETLYSIRMLPLGGYVRMEGED 71

Query: 75  EK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           EK  D R+F       ++  ++AGPL N V+A++      +  GV    V+ V P SPA 
Sbjct: 72  EKTQDPRAFSNKPVPARMAVIIAGPLMNLVLAVILIAIIGFFAGVPTTKVT-VMPGSPAD 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
           I+G+K GD I+++D   V +++E    + + P   + + + R+       K+   ++ +V
Sbjct: 131 ISGIKDGDVILTVDDRKVGSWDEAVNLISQRPNQTLKVEVLRD-----GRKMAFNVKTSV 185

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
           D    KR +  +GI     +T +   ++L+S   G+ +   ++      +    G    +
Sbjct: 186 DP-DTKRGI--IGI-----KTVITRYSLLESLKSGIQKTLWVSSMIFASIPQLIGGKG-V 236

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
             + GP+GI  +       G    +   A  S  +G +NLLPIP +DG  L+  ++E +R
Sbjct: 237 ADLVGPLGIVHLVGEAAKVGVFNVLYLTAFISINLGLINLLPIPAMDGSRLVFLVVEFLR 296

Query: 313 GKSLGVSVTRVITRMGLCIILFL 335
           GK +      +I  +G  +++ L
Sbjct: 297 GKPVDPEKEGLIHFIGFALLMIL 319


>gi|182417566|ref|ZP_02948891.1| RIP metalloprotease RseP [Clostridium butyricum 5521]
 gi|237667648|ref|ZP_04527632.1| RIP metalloprotease RseP [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182378579|gb|EDT76107.1| RIP metalloprotease RseP [Clostridium butyricum 5521]
 gi|237655996|gb|EEP53552.1| RIP metalloprotease RseP [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 337

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 168/333 (50%), Gaps = 17/333 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +++ +HE GH+ +A++  +RV  FS+G GP++     +   ++ + L P+GGYVS   +E
Sbjct: 12  VLIFVHELGHFALAKINGVRVEEFSIGMGPKIFSKQGKE-TKYSIGLFPIGGYVSMMGEE 70

Query: 76  K---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           +   D RSF   +P ++I  ++AG   N ++AI  FT +  + G      +++   SPA 
Sbjct: 71  QAVDDERSFSAKSPLRRITIIVAGVCMNYILAICIFTGYINHFGYTNTFANSIKSDSPAY 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            AG+++GD  + ++G+ V  +++++  V  +  + I +V+ R         + P + +  
Sbjct: 131 EAGLQEGDTFVKVNGMKVFTYDDISAGVLLSYGNPIDIVVDRNGEK-KDFTITPNVSEET 189

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS-ITRGFLGVLSSAFGKDTR 251
            R+ I       G+ F    T+++ + + +SF++   + +S +++ F G+     G+   
Sbjct: 190 GRYAI-------GVEF----TRVNDQGIGKSFTQSFKQTASLVSQTFKGLGMIFTGQANL 238

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
              + GP+ I +++      G    + F A  S  +   NLLP P LDGG  +  L+E+I
Sbjct: 239 KTDVGGPITIVKMSAATAKAGIWPLLYFTAFLSVNLAVFNLLPFPALDGGWTVILLIELI 298

Query: 312 RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             + +   +   +  +G  I++ L  L    DI
Sbjct: 299 TRRKVPNKIVEGLNYVGFMILIGLMILVTLKDI 331


>gi|223040177|ref|ZP_03610456.1| RIP metalloprotease RseP [Campylobacter rectus RM3267]
 gi|222878538|gb|EEF13640.1| RIP metalloprotease RseP [Campylobacter rectus RM3267]
          Length = 370

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 168/349 (48%), Gaps = 19/349 (5%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL+  + +  ++  HE GH++ AR+  + VL FSVG+G  +   T   G  + +  IPLG
Sbjct: 22  FLITVLVISFLIFFHELGHFLAARMLKVGVLKFSVGYGQSIYSKTI-GGTEYAIGAIPLG 80

Query: 67  GYVSF--SEDEK------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF-FYNTGV 117
           GYVS    ED+K      D  S+   +P  +I  + AGP  N  +A  FF F    + GV
Sbjct: 81  GYVSLKGQEDDKPGLKNEDADSYTRLSPLGRIFILFAGPFFNFALA--FFIFIALGHIGV 138

Query: 118 --MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
             + P V  V   S AA AG++KGD I++++GI +S ++E++  V    L   ++ L R 
Sbjct: 139 ERLAPTVGKVLENSAAASAGLQKGDKILNINGIKISEWDEISKNVN---LTSTAITLERA 195

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
              +  + + P++  +V  FG K + P +GIS S +   + + T   S    L E  + +
Sbjct: 196 GE-IKTINLTPKIGQSVTIFGEKIEKPLIGISPSGEAVTIRN-TGFSSLKFALVETINAS 253

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
           +     L         L ++ G + I  I       G +  +   A+ S  +G +NLLPI
Sbjct: 254 KLIFTGLEKLIAGVVPLKEMGGIIQITDITSKAAGIGVSTLLIIAALISVNLGVLNLLPI 313

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           P LDGGH+   L EMI  + +   V   +T  G   +  L      ND+
Sbjct: 314 PALDGGHIFFNLYEMIFRREMNEKVYIGLTYCGWAFLFCLMAFATFNDV 362


>gi|84516076|ref|ZP_01003436.1| membrane-associated zinc metalloprotease, putative [Loktanella
           vestfoldensis SKA53]
 gi|84509772|gb|EAQ06229.1| membrane-associated zinc metalloprotease, putative [Loktanella
           vestfoldensis SKA53]
          Length = 444

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 119/423 (28%), Positives = 177/423 (41%), Gaps = 88/423 (20%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           + + V+L +IV IHE+GHY+VAR C I    FS+GFGP +   T   G  W+++ +PLGG
Sbjct: 18  MAFVVALSVIVAIHEYGHYIVARWCGIHADVFSLGFGPVIYSRTDARGTVWQIAALPLGG 77

Query: 68  YVSF-------------SEDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFT-FFF 112
           YV F             S D  D R     AP W + LTV AGP+ N ++AI  FT    
Sbjct: 78  YVKFLGDTNAASVGSDGSVDAADARRSMAGAPLWARTLTVAAGPVFNFILAIAIFTGSIM 137

Query: 113 YNTGVMKP-VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE---- 167
           Y   V  P  + ++ P      + ++ GD ++S+  +  S  E     +   P+ E    
Sbjct: 138 YQGRVADPFTIGDIRPLPAQFQSDLRAGDVLLSVANVAFSVPERQMSLLDLLPVQERLTY 197

Query: 168 --------------------ISLVLYREHVGVLHLKV--------------MPRLQDTVD 193
                               IS +  R       L++               P+LQD V 
Sbjct: 198 QITREGRALAVEGPYPMPPLISALAPRSAADNAGLRIGDVITAVDGDPIFGFPQLQDKVI 257

Query: 194 -------RFGIKRQVPSVGISFS---YDETKLHSRTVLQSFSRGL----------DEISS 233
                     I R    + ++ S    DE +    +  QS+  G+          + +  
Sbjct: 258 SAQGAPLNLTIWRGGQDLDVTLSPRITDEPQPDG-SFTQSYRIGIVGDLMFTPQTESVGL 316

Query: 234 ITRGFLGVLSSAFGKDTRLN--------QIS-----GPVGIARIAKNFFDHGFNAYIAFL 280
           I  G LGV        T L+        QIS     GPVGIA  + +    G  ++I F+
Sbjct: 317 IAAGRLGVEGLWNTATTSLSALRHIIIGQISTCNLSGPVGIAETSGSMARQGTQSFIWFI 376

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
              S A+G +NL PIP+LDGGHL+ +  E +  +       +V   +GL +IL +    I
Sbjct: 377 GALSAAVGLINLFPIPVLDGGHLMFYAYEAVTRRKPSDRAVQVFMFIGLALILTMMSFTI 436

Query: 341 RND 343
            ND
Sbjct: 437 LND 439


>gi|238926722|ref|ZP_04658482.1| membrane-associated zinc metalloprotease [Selenomonas flueggei ATCC
           43531]
 gi|238885254|gb|EEQ48892.1| membrane-associated zinc metalloprotease [Selenomonas flueggei ATCC
           43531]
          Length = 346

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 167/338 (49%), Gaps = 21/338 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           ++V +HE GH++ A+L  +RV  F++GFGP L+       V + + L+PLGG+      +
Sbjct: 14  LLVFVHELGHFITAKLTGMRVDEFAIGFGPRLVHFRYGETV-YSIRLVPLGGFNDIAGMA 72

Query: 73  EDEKDMRSF-FCAAP-WKKILTVLAGPLANCVM-AILFFTFFFY---NTGVMKPVVSNVS 126
            D+ D     +C  P   +++ +LAG   N ++  +LFF  FF+    T    PV+  V 
Sbjct: 73  ADDNDAGDRGYCRKPILSRMIVILAGSAMNFILPVVLFFGIFFFAGVQTPNPAPVLGKVL 132

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
             +PAA AG+   D I+++DG T+  ++E+   +R N  H    +  +   G   L V  
Sbjct: 133 ADNPAAQAGLMTDDRILAIDGRTIDTWQELVDAIRTN--HGTVPMTMQVERGEQELTV-- 188

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF 246
                   +   +Q   +GI  +Y  T      + QS S   +    I    L  L    
Sbjct: 189 ---SVTPHYDASQQRGYIGIVNAYTSTY---PGLFQSISMAFERTMMIIVMMLDALYRII 242

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
             +   ++++GP+G+A++A    + G    + F A+ S  +  +NLLP+P LDGGH +T 
Sbjct: 243 -LELSGSELAGPIGVAQMAGEVAEMGIVPLLNFAALLSLNLAIINLLPVPALDGGHFLTL 301

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +E +RGK L   V   I   G+ +I+ L  L ++ND+
Sbjct: 302 CVEAVRGKPLSPKVMHYIQNAGVGLIILLMLLAMKNDV 339


>gi|323341773|ref|ZP_08082006.1| M50A family metalloprotease [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464198|gb|EFY09391.1| M50A family metalloprotease [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 354

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 100/352 (28%), Positives = 173/352 (49%), Gaps = 33/352 (9%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL----IPLGGYVSF 71
           +IV IHE GH M A++  +    F++G GP++          W+ S     +PLGG+VS 
Sbjct: 16  LIVFIHELGHLMAAKVFGVYCNEFAIGMGPKIFEYKKEG---WETSFSIRALPLGGFVSM 72

Query: 72  SED--EKDM-----RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM---KPV 121
           + +  E D      R+     PWK+++ +LAG   N V+A + FT    + G +   KP+
Sbjct: 73  AGEPGEGDFGVDRERTIVGIKPWKRLIVMLAGIFMNLVLAFVIFTGLSMHLGTVDAPKPI 132

Query: 122 VSNVSPASPAAIAGVKKGDCIISL---DG--ITVSAFEEVAPYVRENPLHEISLVLYREH 176
           V+ ++  SPA  AG++  D II L   DG  +T   F ++   +     HE+++ + R+ 
Sbjct: 133 VAGIAEGSPAEKAGLRINDEIIKLTFDDGKVVTPHDFNQLVTSIMVYEDHEVTVTVMRDG 192

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             V   K+ P      +R+ I  Q      + S +   L+     +S   G   + +I +
Sbjct: 193 NEV-DTKLKPEFNKEEERYLIGVQ------AISGEHRDLN---FFESLGMGFTMLGTIIQ 242

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             LG + S       LN + GP+GI ++       GF  +++ +A  S ++  +NL+PIP
Sbjct: 243 Q-LGFVLSRLVHGVGLNSVGGPIGIYQVTSQISSQGFIFFLSLIAQLSVSLAVINLVPIP 301

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           ++DGG  +  L+EMI  + +   +   I  +G+ +I+ LF   + NDI  L+
Sbjct: 302 VMDGGRALLTLIEMIIRRPIPEKIENGIMSIGVAMIMALFVFIMFNDIRKLI 353


>gi|331001984|ref|ZP_08325504.1| RIP metalloprotease RseP [Lachnospiraceae oral taxon 107 str.
           F0167]
 gi|330411780|gb|EGG91185.1| RIP metalloprotease RseP [Lachnospiraceae oral taxon 107 str.
           F0167]
          Length = 344

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 100/343 (29%), Positives = 169/343 (49%), Gaps = 28/343 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVS-FSED 74
           IIV+IHEFGH++ A+L  ++V+ FSVG GP +  +  +   ++ + L+PLGG  + + ED
Sbjct: 12  IIVLIHEFGHFLFAKLSGVKVMEFSVGMGPRIFSVKGKE-TKYSLKLLPLGGSCAMYGED 70

Query: 75  E-KDMRSFFCAAPW-KKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E +D    F +AP   +I T+ AGP  N ++A L   F   N GV KPV+S      PA 
Sbjct: 71  EDEDAPGSFNSAPLLGRIATIAAGPAFNFILAFLVAIFIVANVGVDKPVISGFISGLPAE 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            +G+  GD I  ++G  V  +  V+ Y+  N   +I L + R       + + P   +  
Sbjct: 131 SSGLMVGDEIKEINGKNVDFYRNVSTYLFLNQGKDIVLTVKRNGNEEKTVNISPVYNEEH 190

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQ---SFSRGLDEISSITRGFLGVLSSAFGKD 249
            ++ I   + S G     +  ++   +VL+   + S  ++ ++ + +G + V        
Sbjct: 191 SQYMI--GIRSSGYQKLNNPLEIIKYSVLEVKFTISMTVESLAHLIKGKVDV-------- 240

Query: 250 TRLNQISGPVGIARIAKNFFDHG--FNAYIAFLA------MFSWAIGFMNLLPIPILDGG 301
               ++SGPVGI  +  +  +    +  ++  L+      + S  +G MNLLP+P LDGG
Sbjct: 241 ---GEVSGPVGIVSMIGDTVNESKPYGIFVVLLSLSQMVLLLSANLGVMNLLPLPALDGG 297

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            LI   LE I  + L   V   +   G  +++ L    + NDI
Sbjct: 298 RLIFLFLEAIFRRPLNRKVEGYVHLAGFALLMLLMVFVMFNDI 340


>gi|189485763|ref|YP_001956704.1| putative zinc metalloprotease [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287722|dbj|BAG14243.1| putative zinc metalloprotease [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 350

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 165/346 (47%), Gaps = 30/346 (8%)

Query: 11  TVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVS 70
           TV    ++ IHE GH++ A++C +R+L+F+ GFGP+LI  T  +G ++ + +IP GG+V 
Sbjct: 11  TVGFGFLIFIHELGHFLAAKMCKVRILTFAFGFGPDLIKYT-YNGTKYCIKIIPFGGFVR 69

Query: 71  FSEDEKDMRS-----FFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK-PV--- 121
            + D     +     +     ++KI    AGP +N ++A+  FT  F   G +K P    
Sbjct: 70  MAGDNPKEATGSDGEYLSLKWYEKIWISFAGPFSNYILAVFLFTLVFNIWGAVKIPTDLS 129

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV-L 180
           V  V    PA  AG+  GD I S+D + ++ + +++  +++    + S ++ R      L
Sbjct: 130 VGAVVKNYPAETAGIIPGDKIKSVDSVEINTWNDLSANLKDKANKQTSFLIERGDSSFEL 189

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGI--SFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
            + V       +   GI      VG   S       L   T++       D++ S+ +  
Sbjct: 190 SMIVAKNPVTGIGTIGITPVKIKVGFLKSIHLGVKTLIVNTIVPVVYLA-DKVMSLEK-- 246

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
                          +ISGP+GI +I  N    G   Y+  +A+ S A+G  NL PIP++
Sbjct: 247 --------------PEISGPIGIMQIMANAAKIGMQDYLRLIAVISVALGLFNLFPIPMV 292

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           DGG ++ FL+E I  K +   V +V    GL +++ +      +D+
Sbjct: 293 DGGMILLFLVERIIRKQISTKVVQVYNTTGLILMISILLFATYSDL 338


>gi|217967185|ref|YP_002352691.1| membrane-associated zinc metalloprotease [Dictyoglomus turgidum DSM
           6724]
 gi|217336284|gb|ACK42077.1| membrane-associated zinc metalloprotease [Dictyoglomus turgidum DSM
           6724]
          Length = 348

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 97/340 (28%), Positives = 167/340 (49%), Gaps = 52/340 (15%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           +F+L  F L T+        HEFGH++ A++  +RV  ++VGFGP+++ I  R   ++ +
Sbjct: 4   IFFLILFALLTIP-------HEFGHFIFAKVFGVRVYEYAVGFGPKILEIKGRE-TKFVL 55

Query: 61  SLIPLGGYVSFS----------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAI-LFFT 109
            LIP+GG+V  +          E   + R F+  APW++ L + AG   N + AI LF  
Sbjct: 56  RLIPIGGFVKMAGVDDINIPEVESVPEDRKFYKKAPWQRFLILFAGSFMNFIFAIILFMA 115

Query: 110 FFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR---ENPLH 166
            F        PVV  V    PA+++G+  GD I+ +DG  +    +    +    ++P  
Sbjct: 116 IFLIGIPQPIPVVDKVLENKPASVSGILPGDRILYIDGKKIEDISDAVKLITGSIKSPGE 175

Query: 167 EISLVLYREHVG-VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFS 225
           +  + +  E  G ++++KV+P   +       +R+   +GI F         +TV + +S
Sbjct: 176 KREIEIKVERDGKIVNIKVVPEWSE-------ERKGGIIGIVF---------KTVPKRYS 219

Query: 226 RGLDEISSITRGFLGVLSS---------AFGKDTRLNQISGPVGIARIAKNFFDHGFNAY 276
                 +++  GFL  +++         A     +   I+GP+GIA++       G   Y
Sbjct: 220 LP----TAVKNGFLMFINALILIFYVFKALFNGVQGVSIAGPIGIAKMTGEVASMGLIYY 275

Query: 277 IAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           + FL + S  +G  NLLPIP LDGG ++  ++E IRGK +
Sbjct: 276 LNFLGVLSVQLGVFNLLPIPALDGGRILFVIIEKIRGKPI 315


>gi|169342690|ref|ZP_02863731.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens C str. JGS1495]
 gi|169299196|gb|EDS81266.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens C str. JGS1495]
          Length = 335

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 96/335 (28%), Positives = 163/335 (48%), Gaps = 24/335 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED 74
           ++++HE GH++VA+L  I V  F++G GP+L G+       + + ++P GG+V     ED
Sbjct: 13  LILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGE-TEYNLRILPFGGFVKMLGEED 71

Query: 75  E-KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           E  D RS     P ++IL + AG   N V+A++ F     ++   +  V++V P SPA  
Sbjct: 72  ESDDSRSLNAKTPIQRILVMGAGAFMNYVLALIIFIGLAMSSSFAENKVASVVPNSPAQE 131

Query: 134 AGVKKGDCIISLDGI---TVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQD 190
            G+++GD  + +DG    T   F       + NP   + L + R +  VL   V P L +
Sbjct: 132 IGIEQGDEFLKIDGNKIHTTDDFRMGLALAKGNP---VELEIKRGN-DVLTKTVQPILNE 187

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS-ITRGFLGVLSSAFGKD 249
           +         +  VGIS++  E      T+LQ   +G +E  S +++ F+ + +   G+ 
Sbjct: 188 S--------GMYQVGISYALVEKP----TLLQGIKQGFNETRSLVSQSFIALKTIVTGEA 235

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
                + GPV I +++      G N  + F+A  S  +   NLLP P LDGG +   L++
Sbjct: 236 NLKTDVGGPVTIIKMSGQAAKAGANTLLWFMAFLSVQLAVFNLLPFPALDGGRIFIELIQ 295

Query: 310 MIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           MI  K +       +  +G  +++ L  L    DI
Sbjct: 296 MIIRKEIPAKYIEAVNTVGFMLLMGLMVLVTIKDI 330


>gi|268679690|ref|YP_003304121.1| membrane-associated zinc metalloprotease [Sulfurospirillum
           deleyianum DSM 6946]
 gi|268617721|gb|ACZ12086.1| membrane-associated zinc metalloprotease [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 352

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 100/354 (28%), Positives = 173/354 (48%), Gaps = 47/354 (13%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPEL----IGITSRSGVRWKVSLIPLGGYVSFS 72
           ++  HE GH++ AR   + V  FS+GFG ++    IG T      +  SLIPLGGYV   
Sbjct: 13  LIFFHELGHFLAARFFGVHVEVFSIGFGKKVFSKVIGKT-----EYCFSLIPLGGYVQMK 67

Query: 73  -EDEKDMR-------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY----NTGVMK- 119
            +D+ D +       S+   +PWK+I+ +LAGP AN ++A     FF Y      GV K 
Sbjct: 68  GQDDSDPKKTSTDTDSYSIQSPWKRIVILLAGPFANFLLA-----FFLYLAIGAMGVTKY 122

Query: 120 -PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178
            P +  +   S A  AG+ + D I+ ++G+ + A+E+V+  ++++   + ++ +  E  G
Sbjct: 123 APTIGKIVENSAAFEAGLMENDRIVMINGVLIRAWEDVSTLIQKS---QEAITIKVERQG 179

Query: 179 VLH-LKVMPRLQDTVDRFGIKRQVPSVGI-------SFSYDETKLHSRTVLQSFSRGLDE 230
            +H   ++P++ ++   FG   Q   +GI       + +Y  ++L      Q+       
Sbjct: 180 AVHTFSILPKISESTTMFGETIQKKMLGIAPNGQTITLTYGVSELPQFAYEQTLKATTLI 239

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
           I+ + +   GV+S          ++ G + I ++  +  D G  A     A+ S  +G  
Sbjct: 240 ITGLQKLIEGVVSP--------KEMGGIISIVKVTSDASDAGLIALFTLTALISVNLGVF 291

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           NLLPIP LDGGH++    E++  K    ++   +T  G  ++L L    I NDI
Sbjct: 292 NLLPIPALDGGHIVFNAYELVTRKKPSEALFTSLTMAGWALLLSLMTFTIYNDI 345


>gi|332799215|ref|YP_004460714.1| membrane-associated zinc metalloprotease [Tepidanaerobacter sp.
           Re1]
 gi|332696950|gb|AEE91407.1| membrane-associated zinc metalloprotease [Tepidanaerobacter sp.
           Re1]
          Length = 345

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 100/335 (29%), Positives = 174/335 (51%), Gaps = 19/335 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
           ++V  HEFGH++ A+L +I+V  FS+GFGP+++ I  +    + +  +P GGYV    ED
Sbjct: 13  MLVFFHEFGHFIFAKLSDIKVNEFSLGFGPQILKIKLKE-TEYFIRALPFGGYVKMEGED 71

Query: 75  EK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
            K  D R+F       ++  VLAGP+ N ++A+L      +++G+    V+ V P  PA 
Sbjct: 72  SKTTDPRAFNNKPALVRMGVVLAGPIMNFLLAVLLLAIISFSSGIATTSVT-VIPGEPAE 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            AG++ GD I +++   V++++E+   +   P  EI++ + R     +  KV    +   
Sbjct: 131 QAGIRNGDQIYAINNEKVNSWDEIVDIISNKPYEEINITVLRNG-DFISYKVNTAAEPQT 189

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
            R GI      +GI     +T +   ++ +S   G+++   I++  L  LS     + ++
Sbjct: 190 QR-GI------IGI-----KTVVVKHSLSKSLGFGVEKTFWISKMILVGLSQMITGNAKV 237

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
           + + GPVG+ +I       G    +   A+ S  +G  NL PIP LDGG  I  LLE++R
Sbjct: 238 D-VVGPVGMFQIVGEAAKVGIFQLLYIAALISINLGLFNLFPIPALDGGRAIFLLLELLR 296

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           GKS+      +I  +G  +++FL  + +  DI  L
Sbjct: 297 GKSIDQEKEGLIHFIGFALLMFLMIVVLFKDIKEL 331


>gi|290968872|ref|ZP_06560409.1| RIP metalloprotease RseP [Megasphaera genomosp. type_1 str. 28L]
 gi|290781168|gb|EFD93759.1| RIP metalloprotease RseP [Megasphaera genomosp. type_1 str. 28L]
          Length = 346

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 101/345 (29%), Positives = 175/345 (50%), Gaps = 32/345 (9%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +IVVIHE GH+M A++  ++V  F+VGFGP+LI     S V + + LIPLGG+      +
Sbjct: 14  VIVVIHELGHFMTAKMTGMQVDEFAVGFGPKLISHKVGSTV-YSLRLIPLGGFNRIAGMT 72

Query: 73  EDEKDM------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK----PVV 122
           + E+ M      + F   +   ++L + AG L N ++AI      F+  G ++    P++
Sbjct: 73  DTEQAMTAVRRNKCFISKSLPARLLVMAAGALMNFILAICLLWGVFFVAGTVQISPEPII 132

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE-HVGVLH 181
                 SPAA A ++ GD I+++ G  +  ++++   + ++    +++   R+      H
Sbjct: 133 GQTINGSPAARANLQTGDRILAIHGEPIYQWQDIGRVLSKHQKDVVTVTFKRQGKEETAH 192

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL-- 239
           L  +P    +      +RQ+  +GI +  ++ + H    LQ+      ++  ++ GF+  
Sbjct: 193 L--IPETDASS-----QRQI--IGI-YPVEQKQRHG--FLQAGKLAAFQVGHLS-GFMVQ 239

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
           G+     GK      ++GP+GIA+IA      GF   + F A  S  +G +NLLP+P+LD
Sbjct: 240 GIYQMVTGKAK--ADLAGPIGIAQIAGKAASVGFADLLVFTAFLSTNLGIVNLLPVPLLD 297

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GGH+I  L+E IR K L       +   G+ I+  LF   +  DI
Sbjct: 298 GGHIIILLVEAIRRKKLPARALVYVQTAGMVILGALFLFSMFKDI 342


>gi|304436531|ref|ZP_07396504.1| RIP metalloprotease RseP [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304370474|gb|EFM24126.1| RIP metalloprotease RseP [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 346

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 99/346 (28%), Positives = 168/346 (48%), Gaps = 37/346 (10%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           ++V +HE GH++ A+L  +RV  F++GFGP L+       V + + L+PLGG+      +
Sbjct: 14  LLVFVHELGHFITAKLTGMRVDEFAIGFGPRLVHFRYGETV-YSIRLVPLGGFNDIAGMA 72

Query: 73  EDEKDMRSF-FCAAP-WKKILTVLAGPLANCVMAI-LFFTFFFY---NTGVMKPVVSNVS 126
            D+ D     +C  P   +++ +LAG   N ++ I LFF  FF+    T    PV+  V 
Sbjct: 73  ADDNDAGDRGYCRKPILSRMIVILAGSAMNFILPIVLFFGIFFFAGVQTPNPAPVLGKVL 132

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
             +PAA AG+   D II++DG  +  ++E+   +R N       +    +   L + V P
Sbjct: 133 ADNPAAQAGLMANDRIIAIDGKPIETWQEMVDAIRTNHGTVPMTMQVERNEQELTVSVTP 192

Query: 187 RLQDTVDR--FGIKRQVPSV------GISFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
               +  R   GI     S        IS +++ T +    +L +  R + E+S      
Sbjct: 193 HYDASQQRGYIGIVNAYTSTYPGFFQSISMAFERTAMIVVMMLDALYRIILELSG----- 247

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
                         ++++GP+G+A++A    + G    + F A+ S  +  +NLLP+P L
Sbjct: 248 --------------SELAGPIGVAQMAGEVAEMGIVPLLNFAALLSLNLAIINLLPVPAL 293

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           DGGH +T  +E +RGK L   V   I   G+ +I+ L  L ++ND+
Sbjct: 294 DGGHFLTLCVEAVRGKPLSPKVMHYIQNAGVGLIILLMLLAMKNDV 339


>gi|225570393|ref|ZP_03779418.1| hypothetical protein CLOHYLEM_06493 [Clostridium hylemonae DSM
           15053]
 gi|225160764|gb|EEG73383.1| hypothetical protein CLOHYLEM_06493 [Clostridium hylemonae DSM
           15053]
          Length = 343

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 158/344 (45%), Gaps = 42/344 (12%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK--DM 78
           HE GH+ +A+   I V  FS+G GP L     R G R+ + L+PLGG     EDE+  D 
Sbjct: 17  HELGHFSLAKKNGIDVEEFSIGMGPTLFSKEYR-GTRYCIKLLPLGGSCMMGEDEEATDS 75

Query: 79  RSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
              F   P W +I  + AGP+ N ++A +F        G  KPVV +V    PA  AG++
Sbjct: 76  PGNFNNKPVWARISVIAAGPVFNFILAFVFAVILIVMVGYDKPVVQSVDSGFPAQEAGIE 135

Query: 138 KGDCIISLDGITVSAFEEVAPYVRENPLH--EISLVLYREHVGVLHLKVMPRLQDTVD-- 193
            GD I+ + G  ++ F E+  Y   N  H  E   V Y          + P+L    D  
Sbjct: 136 PGDTIVKMGGKKINIFREINFY---NQFHQGEKVEVTYLHDGKKETATLTPKLDKESDYY 192

Query: 194 RFGI---KRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGK 248
           R GI        ++G +  Y   E K    T ++S       +  +  G +GV       
Sbjct: 193 RIGIGGGSNTKANIGTALQYGAYEVKFWICTTMES-------LKMLVTGQIGV------- 238

Query: 249 DTRLNQISGPVGIARIAKNFFD----HGFNAYIAFLA----MFSWAIGFMNLLPIPILDG 300
               +Q+SGPVGI     + +     +GF   +A L     + S  +G MNLLP+P LDG
Sbjct: 239 ----DQLSGPVGIVDAVDSTYQQSKSYGFLIVLAQLMNISILLSANLGVMNLLPLPALDG 294

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           G L+   +EMIRGK +       +  +G+ +++ L    + NDI
Sbjct: 295 GRLVFLFIEMIRGKRVPPEKEGYVHLVGIMLLMALMVFVMYNDI 338


>gi|110801002|ref|YP_696380.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens ATCC 13124]
 gi|168211419|ref|ZP_02637044.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens B str. ATCC 3626]
 gi|110675649|gb|ABG84636.1| RIP metalloprotease RseP [Clostridium perfringens ATCC 13124]
 gi|170710590|gb|EDT22772.1| putative membrane-associated zinc metalloprotease [Clostridium
           perfringens B str. ATCC 3626]
          Length = 335

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 96/335 (28%), Positives = 163/335 (48%), Gaps = 24/335 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--SED 74
           ++++HE GH++VA+L  I V  F++G GP+L G+       + + ++P GG+V     ED
Sbjct: 13  LILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGE-TEYNLRILPFGGFVKMLGEED 71

Query: 75  EKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           E D   S     P ++IL + AG   N V+A++ F     ++G  +  V++V P SPA  
Sbjct: 72  ESDDSGSLNAKTPIQRILVMGAGAFMNYVLALIIFIGLAMSSGFAENKVASVVPNSPAQE 131

Query: 134 AGVKKGDCIISLDGI---TVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQD 190
            G+++GD  + +DG    T   F       + NP   + L + R +  VL   V P L +
Sbjct: 132 IGIEQGDEFLKIDGNKIHTTDDFRMGLALAKGNP---VELEIKRGN-DVLTKTVQPILNE 187

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS-ITRGFLGVLSSAFGKD 249
           +         +  VGIS++  E      T+LQ   +G +E  S +++ F+ + +   G+ 
Sbjct: 188 S--------GMYQVGISYALVEKP----TLLQGIKQGFNETRSLVSQSFIALKTIVTGEA 235

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
                + GPV I +++      G N  + F+A  S  +   NLLP P LDGG +   L++
Sbjct: 236 NLKTDVGGPVTIIKMSGQAAKAGANTLLWFMAFLSVQLAVFNLLPFPALDGGRIFIELIQ 295

Query: 310 MIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           MI  K +       +  +G  +++ L  L    DI
Sbjct: 296 MIIRKEIPAKYIEAVNTVGFMLLMGLMVLVTIKDI 330


>gi|227486437|ref|ZP_03916753.1| M50A family metalloprotease [Anaerococcus lactolyticus ATCC 51172]
 gi|227235618|gb|EEI85633.1| M50A family metalloprotease [Anaerococcus lactolyticus ATCC 51172]
          Length = 339

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 100/336 (29%), Positives = 164/336 (48%), Gaps = 20/336 (5%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-EDEK--D 77
           HEFGH++VA+   I+V  F+VG GP LI    +   ++   LIP+GGY +   ED++  D
Sbjct: 17  HEFGHFIVAKKSGIKVNEFAVGMGP-LIYSRKKGETKYSFRLIPIGGYCAMEGEDDESSD 75

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
            RSF  A  +K+ LT+LAGP+AN ++AI+ FT     +G++   + + +  SPA  AG++
Sbjct: 76  PRSFDNAPAFKRFLTILAGPMANLIIAIVVFTIVGLISGIITTKIGSFTENSPAQEAGME 135

Query: 138 KGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGI 197
            GD I  +    +  F +++  + +           +++   L ++      DTV    +
Sbjct: 136 VGDEIRKVGDRDIKDFADISAGISD-------FYKDKDYKKPLTVEYFRESSDTVTAVDL 188

Query: 198 KRQVPS----VGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLN 253
           K +V      +GI  +       S  +L++   G  E     +    +L   F       
Sbjct: 189 KVEVKDDHAYIGIMPAR-----RSPNILEAVGLGFGETWKNVKMIFVILGRLFTGKLAFG 243

Query: 254 QISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRG 313
            +SGPVG+ +   N   +G    + FLA  S  +   NLLPIP LDG  L+T  +E+I G
Sbjct: 244 ALSGPVGVLKEIGNQAQNGLANLLYFLAYISVNLAVFNLLPIPALDGSKLLTSAIEIITG 303

Query: 314 KSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           K +   +   +T +G  I+L L  +    DI  L +
Sbjct: 304 KKIDKKIEEKVTMVGFFILLGLILVVSIKDIVNLFR 339


>gi|332295558|ref|YP_004437481.1| membrane-associated zinc metalloprotease [Thermodesulfobium
           narugense DSM 14796]
 gi|332178661|gb|AEE14350.1| membrane-associated zinc metalloprotease [Thermodesulfobium
           narugense DSM 14796]
          Length = 340

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 93/337 (27%), Positives = 169/337 (50%), Gaps = 20/337 (5%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L++ + + +  ++HE GH++ AR+  + V  FS+GFGP +   +        V ++PL
Sbjct: 2   SILIFILVIFVATLVHEAGHFVFARIFGVGVYEFSIGFGPRIFK-SKYKETDLSVRVLPL 60

Query: 66  GGYVSFSE-DEKDM----RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
           GG+V  +  DE ++    + F     +++IL +LAGP+ N +MA + FT   Y  GV  P
Sbjct: 61  GGFVRIAGLDEGEVPPGTKRFDQIKSFQRILVILAGPVMNIIMAAVLFTLV-YTQGVYVP 119

Query: 121 --VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178
              + +V+   PAA AG++ GD I++++ I +    E+   V E+   ++ L + R+   
Sbjct: 120 DLKIQSVNDNFPAAKAGIQVGDKIVAVNDIPIKTPNELIKIVSESKGEKLKLTILRDGKD 179

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
           + ++ ++P      +R+        +GI F  D T L   ++L+S   G  +  S +   
Sbjct: 180 I-NISLIPEFDQKENRY-------LIGIMF--DRT-LKKYSILESIYMGFTQTISWSIAL 228

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
           +  +         +  ++GP+GIA +     + G  A I F+   S  +G +NLLPIP L
Sbjct: 229 VVSIWMLITGKVPVGSLAGPIGIANMLGQAANEGPTALIFFIGFLSLNLGILNLLPIPAL 288

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335
           DG  ++  L+E++RGK +       I   G   ++ L
Sbjct: 289 DGSRILFLLVEVLRGKPIDPKKENFIHVAGFVFLILL 325


>gi|255322256|ref|ZP_05363402.1| RIP metalloprotease RseP [Campylobacter showae RM3277]
 gi|255300629|gb|EET79900.1| RIP metalloprotease RseP [Campylobacter showae RM3277]
          Length = 370

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 168/349 (48%), Gaps = 19/349 (5%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL+  + +  ++  HE GH++ AR+  + VL FSVGFG  +   T   G  + +  IPLG
Sbjct: 22  FLITVLVISFLIFFHELGHFLAARMLKVGVLKFSVGFGQSVYSKT-IGGTEYAIGAIPLG 80

Query: 67  GYVSF--SEDEK------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF-FYNTGV 117
           GYVS    ED K      D  S+   +P  +I  + AGP  N  +A  FF F    + GV
Sbjct: 81  GYVSLKGQEDAKPGLKNEDADSYTILSPLGRIFILFAGPFFNFALA--FFIFIALGHIGV 138

Query: 118 --MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
             + P V  V   S AA AG++KGD I++++GI +S ++E++  V    L   ++ L R 
Sbjct: 139 ERLAPTVGKVLENSAAASAGLQKGDKILNINGIKISEWDEISKNVN---LTSTAITLERA 195

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
              +  + + P++  ++  FG K + P +GIS S +   + + T   S    L E  + +
Sbjct: 196 GE-IKTINLTPKIGQSMTIFGEKIEKPLIGISPSGEAVTIRN-TGFSSLKFALVETVNAS 253

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
           +     L         L ++ G + I  I       G +  +   A+ S  +G +NLLPI
Sbjct: 254 KLIFTGLEKLIVGVVPLKEMGGIIQITDITSKAAGIGVSTLLIIAALISVNLGVLNLLPI 313

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           P LDGGH+   L E+I  + +   V   +T  G   +L L      ND+
Sbjct: 314 PALDGGHIFFNLYELIFRREMNEKVYIGLTYCGWAFLLCLMAFAAFNDV 362


>gi|118580467|ref|YP_901717.1| putative membrane-associated zinc metalloprotease [Pelobacter
           propionicus DSM 2379]
 gi|118503177|gb|ABK99659.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Pelobacter
           propionicus DSM 2379]
          Length = 372

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 95/327 (29%), Positives = 156/327 (47%), Gaps = 30/327 (9%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++L +++ +HE GH++ A+L N++V  FS+GFGP+L G        + +S  PLGGYV  
Sbjct: 8   IALGVLIFVHELGHFIFAKLFNVKVEKFSLGFGPKLFG-RQIGETEYLLSAFPLGGYVKM 66

Query: 72  S--------------------------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAI 105
                                       DE+  RSF    P  +I  VLAGP+ N + A 
Sbjct: 67  FGEGGFIEGGETHHQQDPEESPAQREYTDEEKRRSFAHKPPLARIAIVLAGPIFNLLFAW 126

Query: 106 LFFTFF-FYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP 164
           L F          +   +  V    PAA AG+ K D I ++DG  V  +EE A  + E+ 
Sbjct: 127 LAFMLLCTLGVPTITTRIGEVLKDKPAARAGIMKDDLITAVDGQAVYRWEEFASSIAESK 186

Query: 165 LHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSF 224
              I+L + R+    L   + P  +   + FG      ++G++ S  E        LQ+ 
Sbjct: 187 GKPINLSVKRKD-KELSFTITPAPRVAKNVFGENVNGYAIGVA-SAGEIVTEYYDPLQAV 244

Query: 225 SRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFS 284
            +G  +   +    +  L     +   L+ + GP+ IA++A      G  +++AF+A+ S
Sbjct: 245 VKGTKQTFVVIDLTITSLIKLAQRIVPLDTVGGPIMIAKMAGEQASAGGASFLAFMALLS 304

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMI 311
             +G +NLLP+P+LDGGHLI ++ E++
Sbjct: 305 INLGILNLLPVPVLDGGHLIFYIWELV 331


>gi|225181377|ref|ZP_03734821.1| membrane-associated zinc metalloprotease [Dethiobacter alkaliphilus
           AHT 1]
 gi|225167958|gb|EEG76765.1| membrane-associated zinc metalloprotease [Dethiobacter alkaliphilus
           AHT 1]
          Length = 337

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 162/337 (48%), Gaps = 26/337 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---- 71
           +++  HE GHY VA+   I V  F++GFGP+L    S     + +   PLGG+V      
Sbjct: 13  VLIFFHELGHYAVAKKVGIGVYEFAIGFGPKLFSWRSEE-TDYSLRAFPLGGFVRLVGED 71

Query: 72  SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN-TGVMKPVVSNVSPASP 130
            E+  +  SF   +   +   + AGP+ N ++A+L F+  F+   GV   V+  V P +P
Sbjct: 72  PEESNEEGSFQQKSVLSRFAVIAAGPIMNLILAVLLFSLIFFAFWGVPTNVIRTVEPGAP 131

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQD 190
           A   G+++GD I+S+ G  V  + E+   +  +P  EI++   RE      ++V P+ +D
Sbjct: 132 AEQVGLQEGDRIVSVAGEPVDDWFEITSRIHAHPEQEITIEFIREGES-QSVRVTPK-ED 189

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLH---SRTVLQSFSRGLDEISSITRGFLGVLSSAFG 247
                G+      +GI   Y +  L    S+ V  +FS  +  ++SI +   G ++    
Sbjct: 190 PDAGVGL------IGIGPEYRKYALFASLSQGVTYTFSVLVFFVTSIAQMITGAIAP--- 240

Query: 248 KDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFL 307
                  + GPVGI  +       G    ++  A+ S  +G +NLLPIP LDG  L+  L
Sbjct: 241 ------DVMGPVGIIGMVGEVARTGMTEVLSLAALISLNLGVINLLPIPALDGSRLMFLL 294

Query: 308 LEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LE +RGK +       +  +G  +++ L  +   ND+
Sbjct: 295 LEGVRGKPIDPQKESFVHFIGFTMLILLMLVVTFNDL 331


>gi|157164061|ref|YP_001466917.1| RIP metalloprotease RseP [Campylobacter concisus 13826]
 gi|112800271|gb|EAT97615.1| RIP metalloprotease RseP [Campylobacter concisus 13826]
          Length = 369

 Score =  132 bits (332), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 96/347 (27%), Positives = 175/347 (50%), Gaps = 15/347 (4%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL+  +++  ++  HE GH++ AR+  ++V +FS+GFG E I   +  G  + +S IPLG
Sbjct: 22  FLVTVLAISFLIFFHELGHFLAARMLGVKVNTFSIGFG-EKIYTKNVGGTDYCLSAIPLG 80

Query: 67  GYVSFS-EDEKDMR-------SFFCAAPWKKILTVLAGPLANCVMAILFFTFF-FYNTGV 117
           GYV    +D+ D +       S+   +P K+I  + AGP  N ++A   +    F     
Sbjct: 81  GYVQLKGQDDTDPKAKNYDADSYNVLSPIKRIYILFAGPFFNFILAFFIYILLGFIGVER 140

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           + P V +++  S AA AG+ K D I++++G+ ++ ++E++  V+  P    S +L   + 
Sbjct: 141 LAPSVGHIAEGSAAASAGLVKNDKILAINGVKINEWDEISKNVKLEP----STILIYRNG 196

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
             L + + P++ +T + F  K + P +GIS + +  K++  T L+S      E    ++ 
Sbjct: 197 SSLTINLTPKIGETTNLFNEKIERPLIGISPNGEVVKIY-HTGLESLKFAFGETIEASKL 255

Query: 238 FLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPI 297
                         L ++ G V IA +         +  +  +A+ S  +G +NL PIP 
Sbjct: 256 IFKSFEKLVVGAVPLKEVGGIVQIADVTSKAAKISLSVLLTIVALISVNLGVLNLFPIPA 315

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LDGGH++  + E+I  + +   V  V+T  G  ++L +  L   NDI
Sbjct: 316 LDGGHILFHIYELIFRREVNERVLVVLTYCGWALLLGIMVLATFNDI 362


>gi|332982463|ref|YP_004463904.1| membrane-associated zinc metalloprotease [Mahella australiensis
           50-1 BON]
 gi|332700141|gb|AEE97082.1| membrane-associated zinc metalloprotease [Mahella australiensis
           50-1 BON]
          Length = 337

 Score =  132 bits (332), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 93/341 (27%), Positives = 168/341 (49%), Gaps = 21/341 (6%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             ++  ++  ++++ HEFGH++VA+   I+V  F++G GP L     R    + + ++P+
Sbjct: 5   TIIIAIIAFGVLIIFHEFGHFVVAKAVGIKVEEFAIGMGPALYKF-HRGETDYAIRILPI 63

Query: 66  GGYVS-FSEDEK--DMRSFFCAAPWKKILTVLAGPLAN--CVMAILFFTFFFYNTGVMKP 120
           GG+V    EDE+  D R+F   +  K+I  + AGP+ N    + +L    F     V  P
Sbjct: 64  GGFVRMLGEDEQSDDERAFNNQSVLKRIAVIAAGPIMNFVLTLLLLVIITFMVGIAVYLP 123

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           VV  V P +PA  AG++ GD  IS++G  V + ++    V  NP   +  V+ R+    L
Sbjct: 124 VVDTVLPDTPAQQAGLQPGDRFISIEGKAVESADDARAIVSANPGEALDAVIERDG-KRL 182

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL- 239
            L++ P        +  + Q   +GI+F   + ++   +  ++      ++ ++T+  + 
Sbjct: 183 ELEITPE-------YNAETQTAQIGITF---KGQMQKVSFFKAVGYSFVQVYNMTKMMIV 232

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
           G+     G+    +Q+ GP GI  I       G    +  +A+ S  +G +NL+P P LD
Sbjct: 233 GIGQLLIGQG--FDQVMGPYGIVEIVGQAASQGAVDLLWLVAIISLNVGLINLVPFPALD 290

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340
           G  ++   +E IRGK +      +I   GL +IL LF + +
Sbjct: 291 GSRIVFLAIEGIRGKPIDREKEGMIHFAGL-VILMLFMIAV 330


>gi|51892638|ref|YP_075329.1| putative membrane-associated Zn-dependent protease [Symbiobacterium
           thermophilum IAM 14863]
 gi|51856327|dbj|BAD40485.1| putative membrane-associated Zn-dependent protease [Symbiobacterium
           thermophilum IAM 14863]
          Length = 344

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/344 (28%), Positives = 163/344 (47%), Gaps = 36/344 (10%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           +++ +HE GH+ VA+  +IRV  F++GFGP L+G  +R   R+ +  IPLGG+V  +   
Sbjct: 15  LMIFMHELGHFAVAKFFDIRVHEFALGFGPALVGF-NRGETRYSLRAIPLGGFVRMAGMD 73

Query: 73  -EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNV---- 125
             +  D R F     +++ LT+ AGP  N ++A L  + + Y  G  V +P+  +V    
Sbjct: 74  PSEPDDPRGFNSKPIYQRALTIFAGPFMNFLLASLLLSGYIYAQGVPVSEPIFGDVLAEC 133

Query: 126 -SPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
                PAA+AG++KGD ++++ G  V  + ++  YV  +    + +   R+   +  + +
Sbjct: 134 NGQPCPAAMAGLQKGDRVLTIGGSPVENWSDILTYVGTSEGAPLEIRFERDGQEMTTV-L 192

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT----RGFLG 240
            P   D     GI++                   T   SF + L +  SIT    + ++ 
Sbjct: 193 TPVYMDGRWMIGIQQA------------------TRPGSFWKALAQGPSITWEYSKAWVA 234

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
            L  A    T L ++SGPVGI R        G    +   A  S  +G  NLLPIP LDG
Sbjct: 235 SLVQAVTGRTEL-ELSGPVGITREIATQASAGLTNLLWLTAFLSINLGLFNLLPIPALDG 293

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            HL+   +E +RG+ L      ++   G  +++ L  +    D+
Sbjct: 294 SHLLFMAVEAVRGRRLDPERVNMVHFFGFLLLMGLILVVTYGDL 337


>gi|58697127|ref|ZP_00372562.1| Zinc metalloprotease [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58536576|gb|EAL59919.1| Zinc metalloprotease [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 215

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 104/188 (55%), Gaps = 19/188 (10%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           FL +++ + +IV +HE+GHY+VA+ C ++V SFS+GFGPE+ G   +SG RWK+S +PLG
Sbjct: 18  FLSFSLIISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSAVPLG 77

Query: 67  GYV----------------SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTF 110
           GYV                  +E+EK + SF      KK   V AGP AN V A++ FT 
Sbjct: 78  GYVKMLGDTNAASVPADQQELTEEEK-LYSFHTKPRHKKAAVVFAGPFANMVFAVIAFTI 136

Query: 111 FFYNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEI 168
           FF   G  +  PV+ NV   S A  AG+  GD I  ++   +  FE+++  +  NP   +
Sbjct: 137 FFSIAGYYRTPPVIENVIEGSAAKQAGLLPGDTITQINEHKIKYFEDISRVIMSNPKTRM 196

Query: 169 SLVLYREH 176
            +   R +
Sbjct: 197 EIEYSRNN 204


>gi|302764690|ref|XP_002965766.1| hypothetical protein SELMODRAFT_439234 [Selaginella moellendorffii]
 gi|300166580|gb|EFJ33186.1| hypothetical protein SELMODRAFT_439234 [Selaginella moellendorffii]
          Length = 454

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 178/362 (49%), Gaps = 39/362 (10%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +I+++HE GH++ ARL NI V  FS+GFGP+L     R  V + +  IPLGGYV F +
Sbjct: 95  LTVIILVHEAGHFLAARLQNIHVSKFSIGFGPKL-ATFQRKEVEYSIRAIPLGGYVGFPD 153

Query: 74  DEKDMRSFFCAAP--------WKKILTVLAGPLANCVMAILFFTFFFYNT---GVMKP-- 120
           D  D   F    P          ++L + AG  AN V A   +T  F  T   G+++   
Sbjct: 154 DNPD-SEFSPEDPDLLKNRPILDRVLVMSAGVFANIVFA---YTLLFTQTLTVGLLQQKI 209

Query: 121 ----VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFE----EVAPYVRENPLHEISLVL 172
               VV  V  +S AA AGV+  D I++LDG  V + E    ++   +++ P  +I ++L
Sbjct: 210 LPGVVVPEVYASSAAARAGVRPADVILALDGQEVRSDERSVMQIVDVIKQRPGKKIQMLL 269

Query: 173 YREHVGVLHLKVMP-RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
            R    V  + + P R +D   R G++   P++  +F      L   TV    SR   ++
Sbjct: 270 QRRGEAV-TVDIFPDRSKDGYGRIGVQLS-PNIQ-TFRVKARDLADATV--QASREFWKL 324

Query: 232 -SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
            S +  G   V+ + F +    +++SGPV I  +              F A+ +  +  +
Sbjct: 325 GSKVVEGLAQVVVN-FAQTA--DKVSGPVAIVAVGAEVARSDVAGLFQFAALLNLNLAVV 381

Query: 291 NLLPIPILDGGHLITFLLEMIR-GKSLGVSVTRVITRMGLCIILFL-FFLGIRNDI-YGL 347
           N+LP+P LDGG+L    LE +R GK L   + + I   G+ +IL L   L +R+ +  GL
Sbjct: 382 NILPLPALDGGYLALIALEALRGGKKLPDKIEQGIMSSGILLILALGIVLMVRDTLNLGL 441

Query: 348 MQ 349
           +Q
Sbjct: 442 VQ 443


>gi|332705411|ref|ZP_08425489.1| metallo peptidase, MEROPS family M50B [Lyngbya majuscula 3L]
 gi|332355771|gb|EGJ35233.1| metallo peptidase, MEROPS family M50B [Lyngbya majuscula 3L]
          Length = 363

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 105/340 (30%), Positives = 165/340 (48%), Gaps = 42/340 (12%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +++++HE GH+M ARL  I    FS+GFGP L          + V  IPLGG+V F +
Sbjct: 10  LAVLILVHELGHFMAARLQGIYANRFSLGFGPILWKYQGPE-TEYAVRAIPLGGFVGFPD 68

Query: 74  DEKDMR------SFFCAAP-WKKILTVLAGPLANCVMAILFF---------TFFFYNTGV 117
           D+ D        +     P   + + + AG +AN V A             + F Y  GV
Sbjct: 69  DDPDSEIPPNDPNLLRNRPILDRAIVISAGVIANLVFAYFLLVAQVGMVGISQFNYQAGV 128

Query: 118 MKPVVSNVSPASP--AAIAGVKKGDCIISLDGITVSAFEE----VAPYVRENPLHEISLV 171
              VV  ++P S   A  AG+K  D I+++DG  + A  E    +   ++ +P   + + 
Sbjct: 129 ---VVPKLAPESSLVATEAGLKPRDIILAVDGQELEANPEGITFLMKAIQNHPNQPLEMR 185

Query: 172 LYREHVGVLHLKVMPRLQ-DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
           + R+   +L LKV+P    D   + G++       +S + +E +  + ++L+ FSRG +E
Sbjct: 186 IQRQKQTLL-LKVIPEPGIDGKGKIGVQ-------LSPNGEEVRKRAGSLLEVFSRGAEE 237

Query: 231 ISSIT----RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWA 286
              IT     GF G L S FG+     Q+SGPV I  I  +         + F A+ S  
Sbjct: 238 YQRITVLTLEGF-GQLLSNFGETAE--QVSGPVAIVAIGADIARSNAVNLLQFAALISIN 294

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITR 326
           +  +N+LP+P LDGG L   L+E +RGK L + V + I +
Sbjct: 295 LAIINILPLPALDGGQLAFLLIEGLRGKPLPMEVQQNIMQ 334


>gi|320161394|ref|YP_004174618.1| putative M50B family peptidase [Anaerolinea thermophila UNI-1]
 gi|319995247|dbj|BAJ64018.1| putative M50B family peptidase [Anaerolinea thermophila UNI-1]
          Length = 364

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 166/363 (45%), Gaps = 35/363 (9%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           L + ++L +++ +HE GH++ ARL  I VL F  G  P ++ + +  G  + ++ IP G 
Sbjct: 14  LEFVLALGVLIFLHELGHFLFARLFKIEVLEFGFGLPPRMLKLFTWKGTEFTLNWIPFGA 73

Query: 68  YV--SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG---VMKPVV 122
           +V      D         A+PWK+   +L GPL N +  I  F+  +  TG     K  +
Sbjct: 74  FVRPKGESDPSIPDGMAAASPWKRFFILLGGPLMNFLTGIAIFSLLYTLTGAPETQKVQI 133

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
             V+P SPA +AG+  GD ++S++G  + + + ++  +R +   E++LV+ RE    L L
Sbjct: 134 IQVNPNSPAEVAGLMPGDLVVSVEGTPIQSMQSLSEAIRSHLGEEVTLVVSREG-KTLTL 192

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG-- 240
           K  PR Q+  +  G       +GI        + S +V +S    L + ++  +  +   
Sbjct: 193 KATPR-QNPPEGEG------PLGIVMG---NPIRSISVPESIPYALRDTANQAKTLISLP 242

Query: 241 ---VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAY-----------IAFLAMFSWA 286
              +     G+ TRL    GPVG+ R+ +        A            +  LA  S  
Sbjct: 243 VLILRGEVSGEQTRL---IGPVGMERVYREVRQMDVQAQQENPSNVPVRTLLLLASISIG 299

Query: 287 IGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYG 346
           +G  NL PIP LDGG ++  L E+I  K +      ++  +G   ++ L       DI  
Sbjct: 300 LGVANLFPIPALDGGRILFLLPEIIFKKRIPPEQENLVNLIGFTALILLMIFITTQDIVN 359

Query: 347 LMQ 349
            +Q
Sbjct: 360 PIQ 362


>gi|167746787|ref|ZP_02418914.1| hypothetical protein ANACAC_01499 [Anaerostipes caccae DSM 14662]
 gi|167653747|gb|EDR97876.1| hypothetical protein ANACAC_01499 [Anaerostipes caccae DSM 14662]
          Length = 343

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 98/347 (28%), Positives = 161/347 (46%), Gaps = 38/347 (10%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK--D 77
           +HE GH+ VA+   IRV  F +G GP L G        + V L+P GG     EDE   +
Sbjct: 16  VHELGHFSVAKKNGIRVDEFCIGLGPTLFG-KQVGETYYSVKLLPFGGACMMGEDEDRPE 74

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
             +F   + W ++  + AGP  N V A++        +G   P ++ V   SPA  AG+K
Sbjct: 75  ADAFGNKSVWARMAVIFAGPFFNFVFALILAFIMIGISGADLPDIARVEKKSPAQEAGLK 134

Query: 138 KGDCIISLDGITVSAFEEVAPY-VRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
            GD ++ +DG  +    E++ Y + +    E+ +V+ R+      L V P+      R+ 
Sbjct: 135 AGDQVLKIDGKKIYNNRELSYYFLLDYKGGEVPIVIKRDGTEK-SLSVTPKFNQEAKRYM 193

Query: 197 I-------KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKD 249
           I       ++  P   I + + E     R  ++S                 V+  A G+ 
Sbjct: 194 IGIGWEPYQKLNPLKTIEYGFHEVGFQIRVTVKS-----------------VVKLATGQL 236

Query: 250 TRLNQISGPVGIARIAKNFFD----HGFNAYIAFL----AMFSWAIGFMNLLPIPILDGG 301
           T LN +SGPVGI +   + ++    +GF   ++ +     + S  +G MNLLP+P LDGG
Sbjct: 237 T-LNDLSGPVGIVKQVGDTYNQAATYGFTVLLSTMLSIAVLISANLGVMNLLPLPALDGG 295

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            L   ++E +R K +  +V   +  +GL ++L L    +  DIY +M
Sbjct: 296 RLCFLIVEAVRRKPVSKNVEAAVHTVGLFLLLGLMIFVMFQDIYKIM 342


>gi|34558497|ref|NP_908312.1| putative integral membrane protein [Wolinella succinogenes DSM
           1740]
 gi|34481791|emb|CAE11212.1| PUTATIVE INTEGRAL MEMBRANE PROTEIN [Wolinella succinogenes]
          Length = 354

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 99/342 (28%), Positives = 170/342 (49%), Gaps = 21/342 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK---- 76
           HE GH++ AR   ++V  FS+GFG ++          + +S IPLGGYV     +     
Sbjct: 17  HELGHFLAARWFGVKVEVFSIGFGHKIYK-KVYGDTEYALSAIPLGGYVKMKGQDDANPS 75

Query: 77  ----DMRSFFCAAPWKKILTVLAGPLANCVMAIL-FFTFFFYNTGVMKPVVSNVSPASPA 131
               D  S+    PW++++ + AGPLAN  +A L +       +  + P+++   P+  A
Sbjct: 76  LLSHDQDSYNAKKPWQRLIILAAGPLANLFLAFLLYVAIALLGSQALAPIINEPDPSLSA 135

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDT 191
           A AG++ GD II +DG  V  + E++  + ++   EI +   R       L ++P L+++
Sbjct: 136 AKAGMRSGDEIIRIDGQKVRTWGEMSELISKSQ-GEIEVEFLRGGQ-ERSLMLLPTLRES 193

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI----SSITRGFLGVLSSAFG 247
            + FG     P +G+S +  E ++ S ++ +S  + L+E       I  G   +LS    
Sbjct: 194 KNIFGETILRPMIGVS-ALGEVRIVSYSLFESLPKALNETIRSSQMIVLGIQKLLSGVVP 252

Query: 248 KDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFL 307
                +++ G + I +I     + G     A  A+ S  +G +NLLPIP LDGGH++  L
Sbjct: 253 S----SEVGGVISIVQITSKASESGIITLFALTALISVNLGILNLLPIPALDGGHILFNL 308

Query: 308 LEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
            EM+  K+  ++V   +T  G  I+  L  LG+ ND+  + Q
Sbjct: 309 YEMVTKKAPSLAVFTNLTIAGWVILAGLMGLGLYNDLSKIAQ 350


>gi|309791080|ref|ZP_07685615.1| peptidase M50 [Oscillochloris trichoides DG6]
 gi|308226864|gb|EFO80557.1| peptidase M50 [Oscillochloris trichoides DG6]
          Length = 374

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 173/353 (49%), Gaps = 31/353 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRS 80
           HE GH++ A    I+V  F +G+ P  + +  R+GV++ ++ +PLGG+V F+ +++   S
Sbjct: 22  HELGHFLTAIWMGIKVEEFGIGYPPRALVMFERNGVKYTLNWLPLGGFVRFASNDESQDS 81

Query: 81  FF-------CAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV----VSNVSPAS 129
            +        A PW+KIL ++AGPL N V+A++ F   F   GV +P     +  V   +
Sbjct: 82  LYGAGGSLAAATPWRKILVMVAGPLMNLVLAMVVFGVIFALQGVPRPAPGQEIGAVFEGT 141

Query: 130 PAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQ 189
           PAA+AG++ GD ++SL+G+T+++ + +    R++    I  V+ R     L L V P   
Sbjct: 142 PAAVAGIEVGDVLLSLNGVTITSSDLIGQAARQSGGKPIPAVVLRNGQ-ELALTVTPGPW 200

Query: 190 DTVDRFGIKRQVPSVGISFSYDE----TKLHSRTVL-QSFSRGLDEISSITRGFLGVLSS 244
              D  G +     +G  FSY       +++  T L    +  +D    + R  L  L +
Sbjct: 201 TGPD--GTRYD---LGFGFSYSPHVVIEQVNPLTALWMGTTYSIDLTGQMLRS-LASLPA 254

Query: 245 AFG-----KDTRLNQISGPVGIARIAKNFFDH--GFNAYIAFLAMFSWAIGFMNLLPIPI 297
           A G       +   +  GP+GIAR          GF A+    A+ S  +  +NLLPIP 
Sbjct: 255 AIGGIFSPTPSPAGEPIGPIGIARATGEVIQQPGGFLAFWNLTAILSLNLFLLNLLPIPA 314

Query: 298 LDGGHLITFLLEMIR-GKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           LDG H+I   +E +R GK +      ++   G   ++ L  +   ND+   +Q
Sbjct: 315 LDGSHIIFATIEWLRGGKKVPPEKEALVHAFGFVALMGLMLVITVNDVINALQ 367


>gi|86157548|ref|YP_464333.1| peptidase M50 membrane-associated zinc metallopeptidase
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774059|gb|ABC80896.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 351

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 92/336 (27%), Positives = 152/336 (45%), Gaps = 28/336 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE-- 73
           +++V+HE GHY+ AR   +RV  FSVGFGP ++    R    + +S +PLGGYV  +   
Sbjct: 16  LLIVVHEAGHYLAARRSGMRVERFSVGFGPVVLSF-RRGETEFAISALPLGGYVRIAGMA 74

Query: 74  -----DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSN---- 124
                D  D  ++     W++ + +LAGP  N + A+L       + G+  P  S     
Sbjct: 75  PGEDVDPADRGAYANQPAWRRFVVILAGPAMNYLAAVLIAAALLASVGLRSPDASARVGA 134

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV---LH 181
           + P  PA +AG++ GD I ++DG  V  + ++   ++ +P   I L + R        L 
Sbjct: 135 LVPGKPAEVAGLRPGDRIAAVDGQPVETWTDLVGQLQRHPGQRIVLDVERGEGAAAQRLA 194

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
           L + P   D V R G ++               L  R  + + + GL   ++   G L  
Sbjct: 195 LPITPEDDDGVGRVGFRQH------------DVLVRRGAVGALADGLSRTNAQLGGQLAA 242

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
              AF    +  ++SGPVGIA+        G   +   +   S A+  +NL PIP LDGG
Sbjct: 243 FGQAFSGRQK-AELSGPVGIAQELVRGAHEGVERFFTLVWTISVALALLNLFPIPALDGG 301

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFF 337
            L+    E++  + +   V   +  +G   ++ L  
Sbjct: 302 RLVFLAYEIVTRRRVNARVENALHLIGFVALVGLLL 337


>gi|317471589|ref|ZP_07930933.1| RIP metalloprotease RseP [Anaerostipes sp. 3_2_56FAA]
 gi|316900904|gb|EFV22874.1| RIP metalloprotease RseP [Anaerostipes sp. 3_2_56FAA]
          Length = 343

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 98/347 (28%), Positives = 161/347 (46%), Gaps = 38/347 (10%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK--D 77
           +HE GH+ VA+   IRV  F +G GP L G        + V L+P GG     EDE   +
Sbjct: 16  VHELGHFSVAKKNGIRVGEFCIGLGPTLFG-KQVGETYYSVKLLPFGGACMMGEDEDRPE 74

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
             +F   + W ++  + AGP  N V A++        +G   P ++ V   SPA  AG+K
Sbjct: 75  ADAFGNKSVWARMAVIFAGPFFNFVFALILAFIMIGISGADLPDIARVETKSPAQEAGLK 134

Query: 138 KGDCIISLDGITVSAFEEVAPY-VRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
            GD ++ +DG  +    E++ Y + +    E+ +V+ R+      L V P+      R+ 
Sbjct: 135 AGDQVLKIDGKKIYNNRELSYYFLLDYKGGEVPIVIKRDGT-EKSLSVTPKFNQEAKRYM 193

Query: 197 I-------KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKD 249
           I       ++  P   I + + E     R  ++S                 V+  A G+ 
Sbjct: 194 IGIGWEPYQKLNPLKTIEYGFHEVGFQIRVTVKS-----------------VVKLATGQL 236

Query: 250 TRLNQISGPVGIARIAKNFFD----HGFNAYIAFL----AMFSWAIGFMNLLPIPILDGG 301
           T LN +SGPVGI +   + ++    +GF   ++ +     + S  +G MNLLP+P LDGG
Sbjct: 237 T-LNDLSGPVGIVKQVGDTYNQAATYGFTVLLSTMLSIAVLISANLGVMNLLPLPALDGG 295

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            L   ++E +R K +  +V   +  +GL ++L L    +  DIY +M
Sbjct: 296 RLCFLIVEAVRRKPVSKNVEAAVHTVGLFLLLGLMIFVMFQDIYKIM 342


>gi|254519191|ref|ZP_05131247.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
 gi|226912940|gb|EEH98141.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
          Length = 339

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 171/336 (50%), Gaps = 21/336 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---S 72
           +++++HE GH+++A++  I+V  F++G GP+++    +   ++ + L P+GGYV      
Sbjct: 12  LLIIVHELGHFVMAKVNGIKVEEFAIGMGPKILSTQGKE-TKYSIGLFPIGGYVKMMGEE 70

Query: 73  EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E+ +D RSF   +P ++I  ++AG   N + AI+ FT F    G   P V+++    PA 
Sbjct: 71  EEVQDERSFSSKSPLRRISVIIAGATMNFLFAIIIFTVFLNKFGYSLPKVNSLIENMPAV 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVA---PYVRENPLHEISLVLYREHVGVLHLKVMPRLQ 189
            AG+++GD  + ++G  V + +++       ++NP++     L   +     + V P+L 
Sbjct: 131 EAGLQEGDKFLKVNGSRVFSADDLTIGISLAKDNPIN----FLVERNGEKKEVTVTPKLT 186

Query: 190 DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE-ISSITRGFLGVLSSAFGK 248
           +   R   +R +    I F ++  ++ +  ++QSF +   E +S I++ +  +     G+
Sbjct: 187 EENGR---ERYM----IGFGFE--RIDNPGIVQSFKQSFKETLSVISQTYKSLKMMIMGE 237

Query: 249 DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLL 308
                 + GPV I R++     +G    + F+A  S  +   N+LP P LDGG  +  L+
Sbjct: 238 VNFKTDVGGPVSIIRMSSEAAKNGIWNLMYFIAFISINLAVFNMLPFPALDGGWTVILLI 297

Query: 309 EMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           E+I  + +   V   +  +G+ ++  L  +    DI
Sbjct: 298 ELITRRKVPDKVVGAMNYVGIMLLFGLMIIVTIKDI 333


>gi|168335172|ref|ZP_02693278.1| putative membrane-associated zinc metalloprotease [Epulopiscium sp.
           'N.t. morphotype B']
          Length = 342

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 171/354 (48%), Gaps = 30/354 (8%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           +++ +    IVV+HE+GH++ A+ C + V  F++G GP+L   T +    + + L+P+GG
Sbjct: 5   IIFVIIFATIVVVHEWGHFIAAKKCGVAVNEFAIGMGPKLWS-TKKEETLYTIRLLPIGG 63

Query: 68  YVSF---SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVS 123
           Y +    +E   +  S    +P +++L  +AG   N ++  +L      YN G    V++
Sbjct: 64  YCAMEGENEQSNNPMSLMSKSPLQRMLIFVAGAFMNVILTWVLMLVVLGYN-GYNSNVIA 122

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLK 183
           NV P SP A+AGV+  D II++DG+ V+   E+   +  N     ++ +      + ++ 
Sbjct: 123 NVIPDSPIALAGVQADDTIIAIDGVPVTTQTEIME-ISSNGNASYNMTIQDPSGTIRNVI 181

Query: 184 VMPRLQDTVDR-FGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVL 242
           V P++    +R FG   +    G             T+ QSF      +  + +GF  ++
Sbjct: 182 VTPQIDANGNRIFGFYSKSARYG----------FFETIWQSFLETGWMLVEVLQGFWMLI 231

Query: 243 SSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAF--------LAMFSWAIGFMNLLP 294
           S +      + +++G VG+A++    +D      + +         A+ S  +  +NLLP
Sbjct: 232 SGSL----SVKEMAGIVGVAQLTTQVWDASIQESVMYAIMNMARIAAILSANLAVLNLLP 287

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            P LDGG +   L+E++RGK L      +    G  +++ L  + + NDI  L+
Sbjct: 288 FPALDGGRIFFTLIEIVRGKPLNQEKEAMFHFAGFILLMILMVVVLYNDIIRLI 341


>gi|119483276|ref|ZP_01618690.1| hypothetical protein L8106_04466 [Lyngbya sp. PCC 8106]
 gi|119458043|gb|EAW39165.1| hypothetical protein L8106_04466 [Lyngbya sp. PCC 8106]
          Length = 364

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 100/328 (30%), Positives = 161/328 (49%), Gaps = 38/328 (11%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +++ +HE GH+M AR+ NI V  FS+GFGP L+     S   + +  IPLGG+V F +
Sbjct: 10  LAVLIFVHELGHFMAARVQNIHVNRFSIGFGPILMKYQG-SETEYALRGIPLGGFVGFPD 68

Query: 74  DE------KDMRSFFCAAP-WKKILTVLAGPLANCVMA---------ILFFTFFFYNTGV 117
           ++      +D        P   + + + AG +AN + A         I+    F Y+ GV
Sbjct: 69  EDPESTIPRDDPDLLSNRPILDRAIVISAGVIANLIFAYFLLVAQVGIIGIPEFNYSAGV 128

Query: 118 MKP-VVSNVSPASPAAIAGVKKGDCIISLDGIT----VSAFEEVAPYVRENPLHEISLVL 172
             P V +NVS  S A  AG++  D IIS++G        A +++   ++ +P   + L +
Sbjct: 129 SVPEVATNVS--SAAQRAGIQANDVIISVEGERFQPGQQAIQDLISEIQSHPNQPLDLEV 186

Query: 173 YREHVGVLHLKVMPRL-QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE- 230
            R    ++ ++V P    D   R G++       ++ + D  +  +  ++++F  G +E 
Sbjct: 187 KRGD-QIIPIEVTPEASNDGTGRIGVQ-------LTHNRDVVRRRADGLVEAFREGANEF 238

Query: 231 --ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
             I S+T    G L S F +     Q+SGPVGI  I  +           F A+ S  + 
Sbjct: 239 QRIISLTVSGFGQLISNFSQTAE--QLSGPVGIVAIGADIARSDAGDLFQFAALISINLA 296

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSL 316
           F+N+LP+P LDGG L   L+E IRGK L
Sbjct: 297 FINILPLPALDGGQLAFLLIEAIRGKPL 324


>gi|255957540|dbj|BAH96604.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957720|dbj|BAH96724.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957724|dbj|BAH96727.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957728|dbj|BAH96730.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957732|dbj|BAH96733.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957736|dbj|BAH96736.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957740|dbj|BAH96739.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957744|dbj|BAH96742.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957748|dbj|BAH96745.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957752|dbj|BAH96748.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957756|dbj|BAH96751.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957760|dbj|BAH96754.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957764|dbj|BAH96757.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957768|dbj|BAH96760.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957772|dbj|BAH96763.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957776|dbj|BAH96766.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957780|dbj|BAH96769.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957784|dbj|BAH96772.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957788|dbj|BAH96775.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957792|dbj|BAH96778.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957796|dbj|BAH96781.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957800|dbj|BAH96784.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957804|dbj|BAH96787.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957808|dbj|BAH96790.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957812|dbj|BAH96793.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957816|dbj|BAH96796.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957820|dbj|BAH96799.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957824|dbj|BAH96802.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957828|dbj|BAH96805.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957832|dbj|BAH96808.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|255957836|dbj|BAH96811.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|310743936|dbj|BAJ23895.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|310743940|dbj|BAJ23898.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|310743944|dbj|BAJ23901.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|310743948|dbj|BAJ23904.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
 gi|310743952|dbj|BAJ23907.1| hypothetical zinc metalloprotease [Candidatus Liberibacter
           asiaticus]
          Length = 65

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/65 (100%), Positives = 65/65 (100%)

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI
Sbjct: 1   WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 60

Query: 345 YGLMQ 349
           YGLMQ
Sbjct: 61  YGLMQ 65


>gi|226322650|ref|ZP_03798168.1| hypothetical protein COPCOM_00422 [Coprococcus comes ATCC 27758]
 gi|225208987|gb|EEG91341.1| hypothetical protein COPCOM_00422 [Coprococcus comes ATCC 27758]
          Length = 342

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 100/352 (28%), Positives = 167/352 (47%), Gaps = 51/352 (14%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPEL----IGITSRSGVRWKVSLIPLGGYVSFS 72
           IV  HE GH+++AR+  I V  F +G GP L    IG T      + + ++P+GG     
Sbjct: 13  IVFFHELGHFLLARINGINVYEFWIGMGPTLAHKKIGNTD-----YCLKILPIGGACVMG 67

Query: 73  EDEKD---MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPAS 129
           EDEK+     SF   +PW++I  + AGP+ N ++A +         GV KPV+  V+  +
Sbjct: 68  EDEKEDLSEGSFNSKSPWRRISVIAAGPVFNFILAFIGAFIIICFVGVDKPVIGTVNAGT 127

Query: 130 PAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL--VLYREHVGVLHLKVMPR 187
           PAA AG++ GD I+ ++  ++  F++++ Y   N  H+     ++Y+ +     + V P 
Sbjct: 128 PAAEAGLQAGDEIVKINDKSIHIFKDISTY---NQFHQGQTMKIVYKRNGEKNTVSVTPE 184

Query: 188 LQDTVDRFGIKRQVPSVGISFS-YDETKLHSRTVLQSF------SRGLDEISSITRGFLG 240
             D+            +GI+ S Y +T +       ++      +  +D +  +  G +G
Sbjct: 185 KNDSGYYL--------IGITSSNYVKTNVFETAAYSAYNVKYWINLTIDSLKQLVTGRIG 236

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFN--AYIAFLAMFSWAI------GFMNL 292
           V           +Q+SGPVGI       +    +  A + FL +    I      G MNL
Sbjct: 237 V-----------DQLSGPVGIVSAVDTTYKESKSGGALLIFLNLLQMTILLSANLGVMNL 285

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LP+P LDGG L+  ++E+IRGK +       +   G+ + L L    + NDI
Sbjct: 286 LPLPALDGGRLVFLIVEVIRGKRVPPEKEGYVHLAGMALFLCLMVFVMYNDI 337


>gi|310659001|ref|YP_003936722.1| membrane-associated protease [Clostridium sticklandii DSM 519]
 gi|308825779|emb|CBH21817.1| putative membrane-associated protease [Clostridium sticklandii]
          Length = 334

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 92/332 (27%), Positives = 159/332 (47%), Gaps = 20/332 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +IV +HE GH+  A+   + V  FSVG GP+L   T +    + +  +PLGGYV    ++
Sbjct: 15  VIVTVHEMGHFFTAKYFGVTVHEFSVGMGPKLYSKTKKE-TEYSLRALPLGGYVRMEGED 73

Query: 76  ---KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
              +D  SF    P K++  + AGP  N ++ I+  +F F   GV    +  +    PA+
Sbjct: 74  SESEDPNSFNNKHPLKRMAIIFAGPFMNFILTIVLMSFLFMMIGVPVNKIGALVENMPAS 133

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            +G++ GD II +D   + +++ V   ++ +P +++   + R +      KV+    D V
Sbjct: 134 NSGLEVGDKIIMIDDKKIDSWQSVTDAIQSSPDNDLEFTIERNN----EQKVIDV--DAV 187

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
           ++ G  R+V  VGIS + +      ++  +S   G ++   +    L  L   F      
Sbjct: 188 EQAG--RKV--VGISPASE------KSPGKSLVFGTNQTILMLTDMLSFLGKLFTGQAGD 237

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
             + GPVGI          GF   I+  A+ S  +G +NLLPIP LDG  ++   +E++R
Sbjct: 238 EGVVGPVGIISAVGEAARTGFANVISLAAIISLNLGLINLLPIPALDGSRIVFQAIELVR 297

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GK +       +  +G+ ++L L       DI
Sbjct: 298 GKKIDPEKEGFVHMIGMILLLALMLFITSKDI 329


>gi|302392355|ref|YP_003828175.1| membrane-associated zinc metalloprotease [Acetohalobium arabaticum
           DSM 5501]
 gi|302204432|gb|ADL13110.1| membrane-associated zinc metalloprotease [Acetohalobium arabaticum
           DSM 5501]
          Length = 357

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 90/353 (25%), Positives = 170/353 (48%), Gaps = 39/353 (11%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV------- 69
           ++ +HEFGH++VA+   + V  F++G GP+L+G   +    + + L PLGGY        
Sbjct: 15  LIFVHEFGHFIVAKKTGVLVEEFAIGMGPKLVG-KQKGETLYSIRLFPLGGYCKMTGEFP 73

Query: 70  ------------SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV 117
                        + +  ++ R  F  + ++++  +  GPL N ++A++ F+  F   GV
Sbjct: 74  IDEEEDEIEDVKQYRQAYRNERCLFQKSVFERMAVIFTGPLMNFLLAVVVFSLIFSVFGV 133

Query: 118 -----MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
                   V+  V P  PA  AG++  D I++++   V+ +EE+A  + +NP  EI + +
Sbjct: 134 PVSGSSSTVIGTVLPDKPAKEAGLQAQDKIVAVNDQQVNNWEELAALINKNPNQEIKVTV 193

Query: 173 YREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
            R        +V P L         +R +  +GI     +       + +S   G+ +  
Sbjct: 194 KRNG-DFKSFQVTPELDS-------ERDIGLIGI---MPQLVREQAGIFKSIKLGVQQTL 242

Query: 233 SITRGFL-GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
           ++T G + GV     G+ +  + ++GPV IA++  +         +  +A+ S  +G +N
Sbjct: 243 AVTVGIISGVWQMITGQMS--SSVAGPVKIAQLVGDAAQVSILKVLNLMAILSVNLGILN 300

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LLP P LDGG L+   +E++RGK++       +  +GL ++L L  + +  DI
Sbjct: 301 LLPFPALDGGRLVFLGIEVVRGKAVDPEKEGFVHFIGLVLLLILMAIIVYRDI 353


>gi|116073517|ref|ZP_01470779.1| hypothetical protein RS9916_33742 [Synechococcus sp. RS9916]
 gi|116068822|gb|EAU74574.1| hypothetical protein RS9916_33742 [Synechococcus sp. RS9916]
          Length = 363

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 103/320 (32%), Positives = 161/320 (50%), Gaps = 35/320 (10%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK--- 76
           IHE GH++ A    IRV  FSVGFGP L+     +GV + + L+PLGG+VSF +D++   
Sbjct: 16  IHEAGHFLAAVGQGIRVNGFSVGFGPALL-KREHNGVTYALRLLPLGGFVSFPDDDENST 74

Query: 77  ---DMRSFFCAAP-WKKILTVLAGPLANCVMAILFF---TFFFYNTGVMKP--VVSNVSP 127
              D        P  ++IL + AG LAN ++A L     + F       +P  +V  V P
Sbjct: 75  IPDDDPDLLRNRPIPQRILVISAGVLANLLLAWLVLVGQSAFVGIPASPEPGVMVVAVQP 134

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEE----VAPYVRENPLHEISLVLYR--EHVGVLH 181
              AA AG+K GD I+S++G  + + +E    +   ++  P   ++LV     +      
Sbjct: 135 GEAAARAGLKAGDQILSINGDVLGSGQEAVRSLVNLIKTAPDQNLNLVSRSAGDASSDRP 194

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLH-SRTVLQSFSRGLDEISSITR---- 236
           L + P  +D   R G + Q      + S D   LH +   LQ+ + G D+   + R    
Sbjct: 195 LTLTPVDRDGQGRIGAQLQA-----NLSGD---LHPASNPLQAVAYGSDQFIGMIRNTVV 246

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
           G+ G++++ FG+  +  Q+SGPV I  +       G    + F A+ S  +G +N LP+P
Sbjct: 247 GYSGLVTN-FGQTAQ--QVSGPVKIVEMGAQLSSQGGGGLVLFTALISINLGVLNALPLP 303

Query: 297 ILDGGHLITFLLEMIRGKSL 316
           +LDGG L+  L E +RGK L
Sbjct: 304 LLDGGQLVMLLAEAVRGKPL 323


>gi|162147930|ref|YP_001602391.1| metalloprotease mmpA [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542548|ref|YP_002274777.1| membrane-associated zinc metalloprotease [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786507|emb|CAP56089.1| putative metalloprotease mmpA [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209530225|gb|ACI50162.1| membrane-associated zinc metalloprotease [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 367

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 94/356 (26%), Positives = 163/356 (45%), Gaps = 22/356 (6%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L + + L ++V IHE GHY+ AR   + V  FS+GFG  L+    + G  W++  +
Sbjct: 5   LRTVLAFALVLGVLVFIHELGHYLAARWRGVHVEVFSIGFGRPLLRWHDKVGTEWRICPL 64

Query: 64  PLGGYVS---FSEDEKDM----------RSFFCAAPWKKILTVLAGPLANCVMAILFFTF 110
           PLGGYV    F   E+            R+F       + + ++AGP+ N ++AI+ F  
Sbjct: 65  PLGGYVKPHGFEGPEEATPEQMAAWQPGRTFHDKPVLSRAIVIVAGPVFNFLLAIVLFAG 124

Query: 111 FFYNTG--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEI 168
            F   G   ++ VV  V P S AA AGVK  D I+ +    V+   ++   +   P  + 
Sbjct: 125 LFATVGRPEIRNVVGQVLPGSAAASAGVKPNDAIVRIGDHVVADVADIQARISAEPGEKT 184

Query: 169 SLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
            L + R    V     +  + D+            +G+ F+    K  +       + G 
Sbjct: 185 VLTVRRAGQDVTLPVTVGSVTDSSG-----SHAGQLGVMFTATVGKPMALPA-AIVAAGQ 238

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           +    + +   G+     G+ +    + GP+ IA+++     +G  + ++F+A+ S  +G
Sbjct: 239 ETWHLVVQTLAGLWQMLTGQHSA-KDLGGPLRIAQMSGQVAQYGVASLVSFMALLSINLG 297

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +NL PIP+LDGG L+ + LE + G+ +   V  +  + G  +I  LF     ND+
Sbjct: 298 LINLFPIPVLDGGRLVFYALEAVLGRPVSRRVRDISFQAGFAVIAGLFLFSTFNDL 353


>gi|160940986|ref|ZP_02088325.1| hypothetical protein CLOBOL_05880 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436076|gb|EDP13843.1| hypothetical protein CLOBOL_05880 [Clostridium bolteae ATCC
           BAA-613]
          Length = 349

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 98/343 (28%), Positives = 158/343 (46%), Gaps = 17/343 (4%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY-VSFSED 74
           II++IHEFGH++ A+L  I V+ FS+G GP L     + G R+   ++P GG  +   ED
Sbjct: 12  IIIMIHEFGHFLFAKLNGIGVIEFSLGMGPRLFSF-EKGGTRYSFKILPFGGSCMMLGED 70

Query: 75  E--KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E   D  +F   + W +I  V AGP+ N ++A          TG     ++ V    PA 
Sbjct: 71  EGITDESAFNNKSVWARISVVAAGPVFNFILAFGLSMVLIGITGYDTTRLAGVVDGYPAQ 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            AG++ GD I S++G  V ++ ++  Y+  +P   + +   R   G    +    L+   
Sbjct: 131 AAGMEAGDVIKSINGRKVHSYRDINWYLFTHPQKSLKVTWERTEEGGGTERFSTELEPV- 189

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
             F  +     +G+ F+   + + +  + Q       E+              F     +
Sbjct: 190 --FSAENNQYMMGVQFNPVPSTVEN--IGQLLVHSAYEVQYWIHYVFDTFYMMFHGMVSV 245

Query: 253 NQISGPVGIARIAKNFFD----HGFNA----YIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
           N ISGPVGI        D    +G +A     I F  + S  +G MNLLPIP LDGG L+
Sbjct: 246 NDISGPVGIVNAIDTTVDETAPYGLSAVVLMLINFTILLSANLGVMNLLPIPALDGGRLV 305

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
             ++E +RGK +      ++   G+ ++L L  L + ND+  L
Sbjct: 306 FLIIEAVRGKPIDKEKEGMVHMAGMMVLLALMVLILFNDVRKL 348


>gi|109897581|ref|YP_660836.1| putative membrane-associated zinc metalloprotease
           [Pseudoalteromonas atlantica T6c]
 gi|109699862|gb|ABG39782.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Pseudoalteromonas atlantica T6c]
          Length = 450

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 118/438 (26%), Positives = 191/438 (43%), Gaps = 104/438 (23%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + ++L I+V +HE+GH+ VAR C ++V  FSVGFG  L   T + G  + ++ IPLGGYV
Sbjct: 11  FVIALGILVAVHEWGHFWVARRCGVKVERFSVGFGKALWRRTDKLGTEYVIAAIPLGGYV 70

Query: 70  SFSED------EKDM-RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKP 120
              ++      E+D+  +F      K+I  + AGPL N + AI F  F  Y  GV  +KP
Sbjct: 71  KMLDERVDDVAEEDLPHAFNRQHVLKRIAIIAAGPLTNFIFAI-FALFVMYLIGVQTIKP 129

Query: 121 VVSNVSPASPAAIAGVKKGDCIISL---DGITVSAFE-EVAPYV---------------- 160
           ++  + P S A+ AG+ +G  I  +   D I   A   E+  Y+                
Sbjct: 130 MLGEIKPDSIASQAGLLEGSIIKRVGERDTIDWQAVNLELISYIGNDTLPLTITLPNSPV 189

Query: 161 ----------------RENPLHEISLVLYREHV-------------GVLHLKVMPRLQ-- 189
                           +++ +  + L +YR  V               L LKV  ++Q  
Sbjct: 190 EQTKVLNLSTWQFDPDKDSAIESLGLSVYRPEVLSIVGLVAEKSAAEQLGLKVGDKIQQV 249

Query: 190 --------DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI------- 234
                   + +  +  KR    V I    DE  +    +L S   G +EI  +       
Sbjct: 250 DGTTMANWEQIVSYVAKRPNADVVIEVLRDEQVVRLSGLLGSRQDGENEIGYLGVSPTLA 309

Query: 235 ----------TRGFLGVLSSAFGKDTRL------------------NQISGPVGIARIAK 266
                       G +  ++ A  K  RL                    +SGP+ IA+ A 
Sbjct: 310 PWPKGVLFTHQYGLIDAVAQASDKTWRLMTLSVEMLGKLITGDVSVKNLSGPISIAQGAG 369

Query: 267 NFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITR 326
                G   +++FLA+ S  +G +NLLPIP+LDGGHL+ + +E++RG+ +  S+  +  +
Sbjct: 370 MSASSGIVYFLSFLALISVNLGIINLLPIPVLDGGHLLYYFIELLRGRPVPDSIQEIGFK 429

Query: 327 MGLCIILFLFFLGIRNDI 344
           +G  ++L    + I NDI
Sbjct: 430 IGGLLLLLFMSIAIINDI 447


>gi|282856753|ref|ZP_06266014.1| RIP metalloprotease RseP [Pyramidobacter piscolens W5455]
 gi|282585376|gb|EFB90683.1| RIP metalloprotease RseP [Pyramidobacter piscolens W5455]
          Length = 344

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 168/349 (48%), Gaps = 32/349 (9%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS- 72
           ++I V++HEFGHY+ A  C ++V  FS G GP L     R   +W V   P+GG+V  + 
Sbjct: 12  ILICVIVHEFGHYLTALWCGVKVHEFSFGMGPVLWQRQGRKN-KWSVRAFPVGGFVRLAG 70

Query: 73  ---EDEKDM----RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNV 125
              E+E +      SF     WK+++ + AG   N ++ ++  T    + GVM   VS V
Sbjct: 71  MGEENEGESLLPGESFQEKPAWKRLIVLAAGAFNNILLVVVLATVLLMSRGVMDLSVSEV 130

Query: 126 S---PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
               P  PAA AG+++GD I  + G+ V  +EE+   +R       S    RE    L L
Sbjct: 131 GALMPGFPAAEAGLRRGDVIERVGGVGVRDWEEMTRAIR-------SQAAAREK---LEL 180

Query: 183 KVMPRLQDTVDRFGIKRQV----PSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
            V    +      G K +     P +GI  +  +  L+     ++    L     ++   
Sbjct: 181 TVRRGSRQLTLTMGTKAEKAGEPPLIGIQPAIRKLPLN-----RALRGSLAWTFRMSLAM 235

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
           L  L        R++ +SGPVGIA +A      GF + ++FLA+ S  +G +NLLP P L
Sbjct: 236 LQGLKEMLVHPARVD-VSGPVGIAAMAGQAASAGFFSLLSFLAVISLNLGIINLLPFPAL 294

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           DGGH++  L+EMI G+++ + +   I  +G  I+  L  +    D+  L
Sbjct: 295 DGGHILFVLVEMITGRNMSLELEGKIHFIGFMILFALIVIVTWQDVLKL 343


>gi|78356169|ref|YP_387618.1| peptidase RseP [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78218574|gb|ABB37923.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 360

 Score =  129 bits (324), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 181/360 (50%), Gaps = 30/360 (8%)

Query: 8   LLYTVSLIIIV----VIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           ++ T+S+I+++      HE GH+  AR   I V +FS+GFGP L G   R    ++++L+
Sbjct: 1   MVSTLSVILVIGGLIFFHELGHFAAARSLGIGVKTFSLGFGPRLFGF-RRGQTDYRLALV 59

Query: 64  PLGGYVSF--SEDEKDM-------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN 114
           PLGGYV     +DE D+        SF     W +++ + AGPL N ++A L +   F+ 
Sbjct: 60  PLGGYVQLVGEQDEADLPEGFSRHESFALRPAWHRMIVIAAGPLFNFLLAWLLYWGLFWV 119

Query: 115 TGVM--KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
            G M   P V  V   SPA  AG++KGD I+++ G T+  + +V+  +       + +V+
Sbjct: 120 QGQMFLVPEVGGVQDGSPAQHAGIRKGDRILTIQGRTIEYWSDVSETISAGSGAPVEIVI 179

Query: 173 YREHVG---VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSR-TVLQSFSRGL 228
            R        L L V P  Q   + FG       +G+  S     LH     + + ++G 
Sbjct: 180 SRPAAAGTQTLTLTVKPEEQVRKNLFGEDEHALIIGVHAS--GATLHKPLGPVDALTKGA 237

Query: 229 ----DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFS 284
               D I+   +GFL +    F +   L+ + GP+ IA++      +G +  +A  A+ S
Sbjct: 238 VHTWDMIALTGQGFLKL----FQRVVPLDTVGGPIMIAQMVTEQAQNGLSPLLALTALIS 293

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             +G +NLLP+P+LDGGHL+   LE I  + +   +  + T+ GL ++L L  L   NDI
Sbjct: 294 VNLGLLNLLPVPVLDGGHLLFLSLETIFRRPVPQRIQHLTTQAGLVLLLMLMALATFNDI 353


>gi|293400532|ref|ZP_06644677.1| RIP metalloprotease RseP [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305558|gb|EFE46802.1| RIP metalloprotease RseP [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 356

 Score =  129 bits (324), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 171/361 (47%), Gaps = 38/361 (10%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
            L + + L  IV++HEFGH + A+   +    FS+G GP L+    +    W +  +P+G
Sbjct: 7   LLWFVLILGAIVIVHEFGHLLAAKKFGVYCKEFSIGMGP-LLWQKQKGETAWSIRALPIG 65

Query: 67  GYVSFSEDEKDM-----------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT 115
           G+V+ + ++++            R+     PWK+++ + AG   N ++A L F       
Sbjct: 66  GFVAMAGEDEESDEKDELDIPFERTLNGIKPWKQVIVMAAGAFMNVLLAWLIFIGITAYQ 125

Query: 116 GVM----KPVVSNVSPASPAAIAGVKKGDCIISLDG------ITVSAFEEVAPYVRENPL 165
           G +    KP+V++V   SPA  AG   GD II L+       +T  +  E+  +++  P 
Sbjct: 126 GSVSVPPKPIVASVVENSPAQKAGFHVGDEIIRLENKSKKETLTPDSTREIMEFLQYYP- 184

Query: 166 HEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSF- 224
            EI+  + R+   V        LQ T   F     +  +GI +     K  S  V   + 
Sbjct: 185 GEITYTVLRDGKQV-------TLQGTA-AFHKDENLYILGIGYPQSAAKEISFWVAIPYG 236

Query: 225 -SRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMF 283
             R +  ++SI    LG L    G    LN +SGPVGI +I       G  + +A +A+ 
Sbjct: 237 TQRMVSSVTSIMDS-LGKLVRGVG----LNNLSGPVGIFQITAQTTQDGLLSTLALIALL 291

Query: 284 SWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
           S  +G +NL+PIPILDGG +   L+E + GK L   +  VI   GL +I+ +  L   ND
Sbjct: 292 SVNVGIVNLIPIPILDGGRIFIILIETLIGKKLSERMQSVIMMAGLLMIVGIMVLATWND 351

Query: 344 I 344
           I
Sbjct: 352 I 352


>gi|303325666|ref|ZP_07356109.1| RIP metalloprotease RseP [Desulfovibrio sp. 3_1_syn3]
 gi|302863582|gb|EFL86513.1| RIP metalloprotease RseP [Desulfovibrio sp. 3_1_syn3]
          Length = 384

 Score =  129 bits (324), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 108/381 (28%), Positives = 183/381 (48%), Gaps = 42/381 (11%)

Query: 8   LLYTVSLIIIVV-----IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
           +L T+  +IIV+      HE GH+ VAR   + V +FS+GFGP+++         + +SL
Sbjct: 1   MLMTIIAVIIVLGGLIFFHELGHFAVARCLGMGVSTFSLGFGPKILK-RKLGKTEYALSL 59

Query: 63  IPLGGYVSF--SEDEKDM-------RSFFCAAPWKKILTVLAGPLANCVMAIL--FFTFF 111
           +PLGGYV+     +E ++        SF     W+++L V+AGP AN ++A L  +   F
Sbjct: 60  VPLGGYVALVGESNESEIPEGFSPKESFALRPAWQRLLVVIAGPAANILLAWLLCWILAF 119

Query: 112 FYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV 171
            + T V+ P V  V   SPAA AG+K GD I+S+DG  V +++ ++  +  +    + L 
Sbjct: 120 GWGTPVLLPDVGAVVENSPAAKAGLKAGDRILSIDGQAVGSWDAMSAAIAHSDGKPMQLE 179

Query: 172 LYRE----------------------HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFS 209
           + R                           LHL++          FG       +G+  +
Sbjct: 180 VLRPAPEAAMETEPAADGTRGQGATVEGTTLHLEMTAERAARKTIFGENETAWLIGVR-A 238

Query: 210 YDETKLHSRTVLQSFSRGLDEISS-ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNF 268
            +   +  +   ++ S G  E    ++  +L  +  A  +   L+Q+ GP+ IA++    
Sbjct: 239 ANSVDMRPKGFWEAASAGATETGRMVSLTWLSFVKLAE-RVVPLDQVGGPIMIAQMVGKQ 297

Query: 269 FDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMG 328
              G    +A  A+ S  +G +NLLPIPILDGG ++  LLE+I  + +   V     R G
Sbjct: 298 VHEGLPGLLALTALISINLGILNLLPIPILDGGQVVFCLLEIIFRRPVNRKVQEYAMRAG 357

Query: 329 LCIILFLFFLGIRNDIYGLMQ 349
           L +++ L  L   ND++ L++
Sbjct: 358 LALLIALMLLATFNDVWRLIK 378


>gi|153004028|ref|YP_001378353.1| putative membrane-associated zinc metalloprotease [Anaeromyxobacter
           sp. Fw109-5]
 gi|152027601|gb|ABS25369.1| putative membrane-associated zinc metalloprotease [Anaeromyxobacter
           sp. Fw109-5]
          Length = 347

 Score =  129 bits (324), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 99/333 (29%), Positives = 150/333 (45%), Gaps = 26/333 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE-- 73
           +++V+HE GHY+ AR   +RV  FSVGFGP ++    R    + VS +PLGGYV  +   
Sbjct: 16  LLIVLHEAGHYLAARAFGMRVERFSVGFGP-VVAAFRRGETEFAVSALPLGGYVRIAGMS 74

Query: 74  -----DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP----VVSN 124
                D  D R++   A W++   +LAGP  N V A+L         G+  P     V  
Sbjct: 75  PGDDVDPADRRAYANQAAWRRFAVILAGPAMNYVTAVLVAAALLATIGLRAPDPAPRVGA 134

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           + P  PAA AG++ GD I+++ G  V +F  +   ++ +P   I L + R     L L +
Sbjct: 135 LVPDMPAAAAGLQPGDRILTVAGAPVDSFRALVAELQRHPGERIQLEVERGGE-RLSLPI 193

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSS 244
            PR    V R G  +              ++  R    +   GLD  ++     L     
Sbjct: 194 TPRDDGGVGRVGFAQA------------QQVVRRGPGAALVEGLDRTNAAAGAQLAAFGG 241

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
            F    R  ++SGPVGIA+        G   ++A +   S  +  +NLLPIP LDGG L+
Sbjct: 242 MFSGKQR-AELSGPVGIAQELVRGARQGAEPFLALVWTISIVLAILNLLPIPALDGGRLV 300

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFF 337
               EMI  + +   V   +   G   ++ L  
Sbjct: 301 FLAWEMITRRRVNEKVENYVHLAGFVALVALIL 333


>gi|331090952|ref|ZP_08339794.1| RIP metalloprotease RseP [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405174|gb|EGG84710.1| RIP metalloprotease RseP [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 342

 Score =  129 bits (324), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 92/343 (26%), Positives = 161/343 (46%), Gaps = 25/343 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE- 75
           IV  HE GH+++AR   + V  F +G GP +I    +   ++ + L+P+GG     ED+ 
Sbjct: 14  IVFFHELGHFLLARKNGVYVEEFCIGMGPTIISKQGKE-TKYSIKLLPIGGACMMGEDDV 72

Query: 76  --KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
              D +SF   + W +I  + AGP+ N ++A +         G  K  +  + P S A  
Sbjct: 73  ENTDEKSFNNKSVWARISVIAAGPIFNFILAFILSVIVVAWVGYDKSEIGGIVPNSAAQE 132

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVD 193
           AG++KGD I  ++G  +  F E++ Y + +   +++L   R+  G  +  V+   ++   
Sbjct: 133 AGLQKGDVITEINGKNIHLFREISVYNQFHQGEKVTLEYKRD--GKTYESVLTPQKNEQG 190

Query: 194 RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLN 253
           ++        +GI+    + K        +   GL E+       L  L         ++
Sbjct: 191 QY-------LIGIT----QAKYKKANAFTALQYGLYEVEYWIETTLESLKMLVTGKIGMD 239

Query: 254 QISGPVGIARIAKNFFD----HGFNAYIAFL----AMFSWAIGFMNLLPIPILDGGHLIT 305
           Q+SGPVGI  +  + ++    +G ++ I  L     + S  +G MNLLP+P LDGG L+ 
Sbjct: 240 QLSGPVGIVDVVGDAYETNKAYGVSSVIFSLINLSILLSANLGVMNLLPLPALDGGRLVF 299

Query: 306 FLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
             +E IRGK +      ++   GL ++  L    + NDI  L+
Sbjct: 300 LFVEAIRGKRVPPEKEGMVHFAGLILLFGLMIFVLFNDIQRLL 342


>gi|113954015|ref|YP_731292.1| membrane-associated zinc metalloprotease [Synechococcus sp. CC9311]
 gi|113881366|gb|ABI46324.1| membrane-associated zinc metalloprotease, putative [Synechococcus
           sp. CC9311]
          Length = 360

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 158/315 (50%), Gaps = 30/315 (9%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMR- 79
           HE GH++ AR  NIRV  FS+GFGP L  + S  GV + +  +PLGG+VSF +D++D   
Sbjct: 17  HEAGHFLAARFQNIRVNGFSIGFGPALWKLES-GGVTYALRALPLGGFVSFPDDDEDSPI 75

Query: 80  -----SFFCAAP-WKKILTVLAGPLANCVMA---ILFFTFFFYNTGVMKP--VVSNVSPA 128
                      P  ++ L + AG LAN ++A   ++  T      G   P  +V  V   
Sbjct: 76  PADDPDLLRNRPIPQRALVISAGVLANLLLAWVVLVGHTALAGVPGDPDPGVLVMAVQQG 135

Query: 129 SPAAIAGVKKGDCIISLDGITV----SAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
            PA  AG++ GD I+S++G+++     A ++    V++NP   +S+ + R  + V  +++
Sbjct: 136 EPAEKAGLQPGDQILSIEGLSLGRGEKAVKDAVMPVKDNPSRALSVEVQRNGM-VRVIQL 194

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI---TRGFLGV 241
            P       R G + Q      +F+     +H   + ++ + G ++   +   T    G 
Sbjct: 195 TPEDHQGQGRIGAQLQA-----NFTGTTRPVHG--LGEAIASGSEQFGGLLQRTVSGYGA 247

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           L + FG  T   Q+SGPV I  +       G +    F+A+ S  +  +N LP+P+LDGG
Sbjct: 248 LLTDFG--TTAQQVSGPVKIVEMGAQLSSQGGSGLALFMALISINLAVLNALPLPLLDGG 305

Query: 302 HLITFLLEMIRGKSL 316
            L+  LLE +RG+ +
Sbjct: 306 QLVFILLEGVRGRPI 320


>gi|115375007|ref|ZP_01462278.1| membrane-associated Zn-dependent protease [Stigmatella aurantiaca
           DW4/3-1]
 gi|310820554|ref|YP_003952912.1| peptidase, m50 [Stigmatella aurantiaca DW4/3-1]
 gi|115368034|gb|EAU66998.1| membrane-associated Zn-dependent protease [Stigmatella aurantiaca
           DW4/3-1]
 gi|309393626|gb|ADO71085.1| Peptidase, M50 [Stigmatella aurantiaca DW4/3-1]
          Length = 414

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 97/323 (30%), Positives = 158/323 (48%), Gaps = 24/323 (7%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE------ 73
           +HE GH + ARL  +RV  FS+GFGP L+      G  + ++ IPLG   +         
Sbjct: 16  VHELGHLVAARLLGLRVPRFSLGFGPPLLSF-RLFGTEYIIAAIPLGASATIHGMNPHAM 74

Query: 74  -DEKDMRSFFCAAPWKKILTVLAGPLANCVMAI-LFFTFFFYNTGVMKPV-VSNVSPASP 130
             E D +S+    PW+++L  LAG LAN ++A+ + F  +   T V+ P+ V  V P S 
Sbjct: 75  GREADAKSYSAQRPWRRVLVTLAGSLANYLLALGILFALYTSGTHVVVPLTVGTVVPGSE 134

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQD 190
           AA A +  GD I+S+DG     + +    +  +P  E +LV+ RE    + ++V PR   
Sbjct: 135 AARAQLLPGDRILSVDGQPTKNWSDFVAIIARSPGQERTLVVAREAQTRV-VQVRPR--- 190

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT-RGFLGVLSSAFGKD 249
             D  G  R    +G+S  Y        T L++ ++ L     +   G   +L +  G D
Sbjct: 191 -ADERGTGR----IGVSQQY---VFREHTGLEALAQALLHTRRVAIEGVNLLLRTVRGPD 242

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
             L + +  V + R + +    G+++++  L   S A+  ++LLPIP LDGG L+   +E
Sbjct: 243 P-LEEPASSVAVMRQSSDAASSGWDSFLRVLVTISVALALVHLLPIPGLDGGRLVFLAIE 301

Query: 310 MIRGKSLGVSVTRVITRMGLCII 332
             RGK +   +  +I  +G   I
Sbjct: 302 SARGKPVSPRLETLIHTIGFLAI 324


>gi|229019015|ref|ZP_04175856.1| Zinc metalloprotease rasP [Bacillus cereus AH1273]
 gi|229025260|ref|ZP_04181680.1| Zinc metalloprotease rasP [Bacillus cereus AH1272]
 gi|228736013|gb|EEL86588.1| Zinc metalloprotease rasP [Bacillus cereus AH1272]
 gi|228742255|gb|EEL92414.1| Zinc metalloprotease rasP [Bacillus cereus AH1273]
          Length = 420

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    TVD+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDNEQ-FNVKVTP----TVDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYEWTKLIFDSLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 46.2 bits (108), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKI 90
          D        P KK+
Sbjct: 75 DTVEL---KPGKKV 85


>gi|229098289|ref|ZP_04229236.1| Zinc metalloprotease rasP [Bacillus cereus Rock3-29]
 gi|229104382|ref|ZP_04235051.1| Zinc metalloprotease rasP [Bacillus cereus Rock3-28]
 gi|229117306|ref|ZP_04246684.1| Zinc metalloprotease rasP [Bacillus cereus Rock1-3]
 gi|228666206|gb|EEL21670.1| Zinc metalloprotease rasP [Bacillus cereus Rock1-3]
 gi|228679080|gb|EEL33288.1| Zinc metalloprotease rasP [Bacillus cereus Rock3-28]
 gi|228685187|gb|EEL39118.1| Zinc metalloprotease rasP [Bacillus cereus Rock3-29]
          Length = 420

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 139/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  +   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPIDKPMVGKIMENSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG + S +++V   VRENP  EI+L + R++   L++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKSTSTWKDVVAIVRENPNKEITLQVKRDNEQ-LNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYEWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|255659936|ref|ZP_05405345.1| RIP metalloprotease RseP [Mitsuokella multacida DSM 20544]
 gi|260847807|gb|EEX67814.1| RIP metalloprotease RseP [Mitsuokella multacida DSM 20544]
          Length = 345

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 95/341 (27%), Positives = 165/341 (48%), Gaps = 28/341 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           ++V++HE GH+  A++  +RV  F++GFGP+L+G   R    + +  IPLGG+       
Sbjct: 14  LLVLVHELGHFATAKMTGMRVDEFAIGFGPKLVGF-QRGETVYSIRAIPLGGFNDIAGMD 72

Query: 73  EDEKDMRS-FFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGVM----KPVVSNVS 126
            ++ D  S  +C  P   +++ +LAG + N ++ +  F   F+  GV     +PV+  V 
Sbjct: 73  PEQNDAGSRGYCEKPVSSRMIVILAGSIMNFILPLFLFFGIFFFAGVSTPSPEPVLGTVL 132

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
              PAA AG++ GD ++++DG  ++ + +    V+++    + L + R         V P
Sbjct: 133 AGKPAAEAGLRDGDRVLAIDGTPIATWSDFVGGVKDSAGEPVKLTVERGGE-TFDATVTP 191

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF 246
               +  R         VG+  S +       T    F   +      T   L ++  A 
Sbjct: 192 AYDSSTQR-------AMVGVMGSVN-------TRYPGFVESVQLAVQKTGAILYMMVDAL 237

Query: 247 GK---DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
            K   +    +++GP+G+A++A      GF   + F A  S  +G +NL PIP LDGGH 
Sbjct: 238 YKIILELSGAELAGPIGVAQMAGEVAQMGFVPLLNFAAFLSLNLGIVNLFPIPALDGGHF 297

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +T  +E +RGK L  +  R    +G+ ++L L  L  +NDI
Sbjct: 298 LTLCVEAVRGKPLSPTALRYTQNVGIILLLLLMLLATKNDI 338


>gi|115374981|ref|ZP_01462252.1| membrane-associated zinc metalloprotease, putative [Stigmatella
           aurantiaca DW4/3-1]
 gi|310820545|ref|YP_003952903.1| peptidase, m50a (s2p protease) subfamily [Stigmatella aurantiaca
           DW4/3-1]
 gi|115368008|gb|EAU66972.1| membrane-associated zinc metalloprotease, putative [Stigmatella
           aurantiaca DW4/3-1]
 gi|309393617|gb|ADO71076.1| Peptidase, M50A (S2P protease) subfamily [Stigmatella aurantiaca
           DW4/3-1]
          Length = 537

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 99/158 (62%), Gaps = 10/158 (6%)

Query: 9   LYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY 68
           L+ + L ++V +HE GH++VA+ C ++VL FS GFGP+L+G   +    ++++L+PLGGY
Sbjct: 7   LFALLLGVLVTVHELGHFLVAKACGVKVLKFSFGFGPKLLGFV-KGETEYQIALLPLGGY 65

Query: 69  VSFSED--------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT-GVMK 119
           V  + D        E+  R F    PWK++L VLAGP+ N V  IL + F F+    V  
Sbjct: 66  VKMAGDIPGEELAPEEAHRGFLAQPPWKRMLIVLAGPVFNLVFPILIYFFVFWGAHEVTS 125

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA 157
             V NV P SPAA+AG++ GD +++++G  V  ++E+A
Sbjct: 126 TRVGNVLPESPAAVAGLRPGDRVLAVEGDKVRTYQEMA 163



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 115/229 (50%), Gaps = 9/229 (3%)

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL-YREHVGVL 180
           VS+V P SPAA AG++ GD ++SL+G  + +F      V+ + L E    L +R   G+ 
Sbjct: 310 VSSVLPGSPAAKAGIQWGDRLVSLNGEPIRSFSMF--QVQISGLGEKPFGLTWRSAEGMR 367

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVL-----QSFSRGLDEISSIT 235
             ++        + FG     P +G+  S+D +    R  L     ++ ++    + +I 
Sbjct: 368 TEQIARAPVQVKEEFGQVSTGPVLGVQ-SWDFSAPAERIQLNLEWHEALTQSARIVPTII 426

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
           +  +  ++  F     L+ I GP+ + ++A    + G++ ++  +A  S  +G +NLLPI
Sbjct: 427 KQTVKAIAGLFDNSVPLSSIGGPIMMYQMAAKSSELGWDYFLQLMAAISINLGVVNLLPI 486

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           PILDG HL+    E +R + + V V  V   +GL +++ L  +   NDI
Sbjct: 487 PILDGFHLVAAGWESVRRRPIPVRVREVANVVGLAMLVALMLVAFFNDI 535


>gi|154174843|ref|YP_001408199.1| RIP metalloprotease RseP [Campylobacter curvus 525.92]
 gi|112802473|gb|EAT99817.1| RIP metalloprotease RseP [Campylobacter curvus 525.92]
          Length = 370

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 89/348 (25%), Positives = 170/348 (48%), Gaps = 17/348 (4%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPL 65
           FL+   ++  +V  HE GH++ AR   + V +FS+GFG ++   T + G   + +S IPL
Sbjct: 22  FLITVFAISFLVFFHELGHFLAARSLGVAVNTFSIGFGDKIY--TKKVGATEYAISAIPL 79

Query: 66  GGYVSFS-EDEKDMR-------SFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTG 116
           GGYV    +D+ D +       S+    P  +I  +LAGP  N ++A +L+    F    
Sbjct: 80  GGYVQLKGQDDTDPKAKNYDADSYNTLKPLGRIYILLAGPFFNFILAFLLYMVLGFIGVE 139

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
            + P++ +++  S A  AG+   D I+ ++ + +  +++++  V+   L + ++ + R  
Sbjct: 140 KLAPIIGHIAENSAAKEAGLVINDKILKINDVVIHEWDDISKQVK---LQKTNIKVERNG 196

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             ++ + + P++ +T + F      P +GIS + +  +++  T L S S  L+E    ++
Sbjct: 197 -KIIDINLTPKIGETRNLFKESVSKPLIGISPNGETVRVY-HTGLSSLSYALNETIDASK 254

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
                          L ++ G V IA +         +  +  +A+ S  +G +NL PIP
Sbjct: 255 LIFISFEKLINGSVPLKEVGGIVQIADVTSKAAQISLSVLLVIVALISVNLGVLNLFPIP 314

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            LDGGH++  L E+I  + +   +   +T  G  ++  L  L   NDI
Sbjct: 315 ALDGGHILFNLYELIFRREVNEKIYIALTYCGWALLFTLMLLATYNDI 362


>gi|126657038|ref|ZP_01728209.1| hypothetical protein CY0110_28069 [Cyanothece sp. CCY0110]
 gi|126621581|gb|EAZ92291.1| hypothetical protein CY0110_28069 [Cyanothece sp. CCY0110]
          Length = 361

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 175/352 (49%), Gaps = 35/352 (9%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           LII++V+HE GH+  ARL  I V  FS+GFGP L     +    + +  IPLGG+V F +
Sbjct: 10  LIILIVVHELGHFSAARLQGIHVTRFSIGFGPVLARYQGKE-TEYTLCAIPLGGFVGFPD 68

Query: 74  DEK------DMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVS- 123
           D+       D        P + + + + AG +AN + A           G+  ++P +S 
Sbjct: 69  DDPESDITPDDPDLLRNRPVFDRAIVISAGVIANLIFAYFLLVGQTATIGIQELQPGLSI 128

Query: 124 -NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA----PYVRENPLHEISLVLYREHVG 178
             V   S A +AG++ GD IIS+D  ++  F +        V+ +    + L + RE   
Sbjct: 129 PQVDENSAAMVAGIESGDVIISVDNQSLGDFPDATTVFIEKVKNSAQQPLDLKVKRED-N 187

Query: 179 VLHLKVMPRLQDTVD-RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT-- 235
           ++ L V+P   +  + + G+   +P+V ++         S+ +L++FS   +   ++T  
Sbjct: 188 IVDLTVIPEANEEGEGKIGVAL-LPNVQLN--------RSQNILEAFSYSAEAYQNVTML 238

Query: 236 --RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
             +GF  ++S+ F ++ +  Q++GPV I     +   +       F A+ S  +  +N L
Sbjct: 239 TLQGFWQLISN-FQENAK--QVAGPVKIVEYGASIAQNNLGNLFQFGALISINLAIINTL 295

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL-FFLGIRNDI 344
           P+P LDGG L+  L+E + GK L + +   I + GL ++L L  F+ IR+ +
Sbjct: 296 PLPALDGGQLVFLLIEGLFGKPLPLKLQEGIMQTGLVLLLSLGIFIIIRDTV 347


>gi|227824510|ref|ZP_03989342.1| zinc-dependent metalloprotease rasP [Acidaminococcus sp. D21]
 gi|226905009|gb|EEH90927.1| zinc-dependent metalloprotease rasP [Acidaminococcus sp. D21]
          Length = 338

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 97/344 (28%), Positives = 170/344 (49%), Gaps = 35/344 (10%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY---VSFS 72
           +++ +HE GH+  A+L  ++V  F++GFGP+L   T   G  + +  +PLGG+       
Sbjct: 13  VLITVHELGHFAAAKLVGMQVDEFAIGFGPKLYQ-TEEKGTVYTLRALPLGGFNRIAGME 71

Query: 73  EDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFY----NTGVMKPVVSNVSP 127
             E+++ + F   P W +++ +LAG   N ++ +L F   F+     T V +PV+  V  
Sbjct: 72  PGEENVENGFHTKPLWARMVVILAGVTMNFLLPLLLFFGIFFFHGTETPVNEPVLGRVMD 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
             PA+ AG+ KGD IIS++G  +SA+ +V+  ++E    + +LV+ R     L   ++P+
Sbjct: 132 HQPASDAGLMKGDRIISINGTKLSAWTDVSTLIQEAGSKKSTLVIQRGGK-TLEKTLIPQ 190

Query: 188 LQDTVDRFGI-------KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240
                 R+ I       KR    +G+S S     L    +++    GL +I +   G  G
Sbjct: 191 FDQEAGRYLIGVMPTLEKR---PLGLSESVRYAVLTEGRIMKGMVDGLRQILT---GKAG 244

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
           V             ++GP+G+A++A +    G   ++ F+A  S  +G +NL+PIP LDG
Sbjct: 245 V------------NVAGPIGVAQMAGSVAQEGMIPFLTFIAFLSLNLGILNLIPIPALDG 292

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           G  +   +E I    L       +  +G+ +IL L      +DI
Sbjct: 293 GQFLILAVEGILRHPLPPKAKERVQLVGVALILGLTIYATISDI 336


>gi|284048710|ref|YP_003399049.1| membrane-associated zinc metalloprotease [Acidaminococcus
           fermentans DSM 20731]
 gi|283952931|gb|ADB47734.1| membrane-associated zinc metalloprotease [Acidaminococcus
           fermentans DSM 20731]
          Length = 338

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 162/338 (47%), Gaps = 36/338 (10%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLGGYVSFSED 74
           +++ +HE GH++ A+   + V  FS+GFGP L     + G   + + L PLGGY   +  
Sbjct: 13  VLITVHELGHFLAAKGTGMLVTEFSIGFGPRLF--QKKVGETLYSLRLCPLGGYNRIAGM 70

Query: 75  EKDM----RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG----VMKPVVSNVS 126
           E       R F     W ++L +LAGP  N ++  L F   F  +G    V +PVV ++ 
Sbjct: 71  EPGEAVTPRGFNGRPLWARMLVILAGPFMNFLLPFLIFFGVFAFSGLTLPVNEPVVGSLM 130

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR---EHVGVLHLK 183
              P A AG+K GD ++S++G  +  + ++   V++N      +V+ R   E   VL   
Sbjct: 131 EGYPGAEAGLKAGDRLVSINGRKLEKWNDINALVQQNGPEPGQVVIDRNGTERTVVLK-- 188

Query: 184 VMPRLQDTVDRF--GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
             PR      RF  G++ +V    +S   +  K  +  V ++ +  +D +  +  G    
Sbjct: 189 --PRYDGESHRFLIGVRPRVEHRQLSLG-ESLKTAALAVGRTTAAMVDGLRKMITG---- 241

Query: 242 LSSAFGKDTRLN-QISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
                    ++N  I+GP+G+A +A +    G   Y+ F+A  S  +  +NL+PIP LDG
Sbjct: 242 ---------KVNADIAGPIGVAHMAGDVAAQGAVPYLEFMAFLSLNLAVLNLVPIPALDG 292

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGL-CIILFLFF 337
           G  +  ++E I G +L      VI  +G+ CI+    F
Sbjct: 293 GQFLVLVVEGILGHALAPKAKEVIQMIGVGCIVALTIF 330


>gi|325290368|ref|YP_004266549.1| membrane-associated zinc metalloprotease [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324965769|gb|ADY56548.1| membrane-associated zinc metalloprotease [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 352

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 92/346 (26%), Positives = 160/346 (46%), Gaps = 29/346 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED- 74
           ++V+IHE GH+ VA+   I+VL F+ G GP+L G+  R    + + ++PLGG+V F  + 
Sbjct: 13  LMVLIHEAGHFFVAKKSGIKVLEFAFGIGPKLFGV-QRGETVYSIRILPLGGFVRFLSEE 71

Query: 75  --------EKDM---RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV----MK 119
                   +K     R+F     W+K   + AGP+ N V+  + F   +   GV     +
Sbjct: 72  ELKEESEEQKQFLWPRTFESKKYWQKASVIAAGPIMNFVLGAVLFIIVYAWYGVPAVATE 131

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
            +V  V    PAA AG+  GD I+++DG+    +  +   +  NP  ++ + + +    V
Sbjct: 132 NIVGTVMEGQPAAAAGLGVGDKILAIDGVETPDWSSLVNIIHANPDKKLEIKIQKADSPV 191

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSR-TVLQSFSRGLDEISSITRGF 238
           +   V+  + D     G+   VP V          ++ + +VL++   GL + +  T+  
Sbjct: 192 IVTSVITPVLDQQSGQGLIGIVPQV----------INQKVSVLKATQYGLTQTADFTKMI 241

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
           +  L         ++ + GPV +A++       G    ++   + S   G +NLLPIP L
Sbjct: 242 VMYLVQMVTGKVPVD-LGGPVAVAQVIGEGARQGIADLLSLTGILSIQFGILNLLPIPAL 300

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           DGG L     E IR +S+ V    +I   G  +++ L       DI
Sbjct: 301 DGGQLAVLSYEKIRRRSISVEKKGLIQLTGFALLMALMIAVTYKDI 346


>gi|332140477|ref|YP_004426215.1| membrane-associated zinc metalloprotease, putative [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327550499|gb|AEA97217.1| membrane-associated zinc metalloprotease, putative [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 450

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 118/437 (27%), Positives = 189/437 (43%), Gaps = 103/437 (23%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + V+L I+V +HE+GH+ VAR C ++V  FS+GFG  +    S+SG  + +++IPLGGYV
Sbjct: 11  FIVALGILVAVHEWGHFYVARKCGVQVERFSIGFGKPIWRKVSKSGTEYVIAMIPLGGYV 70

Query: 70  SFSE-------DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKP 120
              +        E + ++F      +++  + AGP  N + A  F  +  Y  G+  +KP
Sbjct: 71  RMLDGRIDDVPPELEDKAFNNKPVLQRMAVIAAGPGVNFIFA-FFALWLMYLVGLDTVKP 129

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV- 179
           VV ++   S AAIAGV+ GD II +   +   +E V   +  N   E + V  +    V 
Sbjct: 130 VVKSIETDSIAAIAGVQPGDEIIKVGDRSTPDWEAVNLEIVSNIGSENASVTVKNSSNVE 189

Query: 180 ----LHLKVM---PRLQDTVDRFGIKRQVPSVGISFSY---------------DETKLHS 217
                 LK     P  +  +   G+    P   ++  +               DE K  +
Sbjct: 190 KELTFTLKSWNFDPDSESPLSSLGLTPYRPDATLTVGFVGEGSAAQQAGLKPGDELKALN 249

Query: 218 RTVLQSFSRGLDEI----------------------SSITR--------GFLGV------ 241
            T L S+ R +D I                      ++I R        G+LGV      
Sbjct: 250 GTKLTSWERLVDVIVESPGERISLDILRDGQPLTLDATIARRDTPQGQSGYLGVSPTFEP 309

Query: 242 ----------------LSSAFGKDTRLNQIS------------------GPVGIARIAKN 267
                           +  A  K  RL  +S                  GP+ IA+ A  
Sbjct: 310 WPEGYVFTHQYGIIEAIGKALDKTWRLMTLSVEMIGKLITGDVSVKNLSGPISIAQGAGT 369

Query: 268 FFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRM 327
              +G   +++FLA+ S  +G +NLLP+P+LDGGHL+ F++E I GK +  +V     R+
Sbjct: 370 SAGYGLAYFLSFLALISVNLGIINLLPLPMLDGGHLMFFIVEWITGKPVPEAVQEWGYRI 429

Query: 328 GLCIILFLFFLGIRNDI 344
           G  ++  +  + I NDI
Sbjct: 430 GGVLLFMIMGIAIFNDI 446


>gi|108804242|ref|YP_644179.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Rubrobacter xylanophilus DSM 9941]
 gi|108765485|gb|ABG04367.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Rubrobacter xylanophilus DSM 9941]
          Length = 345

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 161/350 (46%), Gaps = 34/350 (9%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPEL----IGITSRSGVRWKVSLI 63
           L+  + LI ++ IHE GH + A+   +RV  F +GFGP L    +G T+     +   +I
Sbjct: 4   LVALLGLIFLIAIHELGHMLTAKALGVRVPEFGIGFGPALFKKKLGDTT-----YSFRII 58

Query: 64  PLGGYVSFS---EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
            LGG+   +   +      +++    W++ L + AGP AN + A+L  T  F        
Sbjct: 59  LLGGFARIAGMGDGRTGPGTYYEKPAWRRALIIFAGPFANILAAVLILTAIFMGAHEPSM 118

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEE-VAPYVRENPLHEISLVLYRE---H 176
            V  V P S A  AGVKKGD I+++DG  V +++  V     + P   + LV+ R+    
Sbjct: 119 TVERVVPGSFADEAGVKKGDRIVAVDGRRVESWDAFVGAVGDKRPGDPVRLVVRRDGEPK 178

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
           V    LK  PR     +R  +  Q    G ++           VL++F   +  +  ITR
Sbjct: 179 VFAGELKADPR---DPERALVGVQPAPSGQTYG----------VLEAFGMAVGRVVEITR 225

Query: 237 GFLGVLSSAF--GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
             LGV       G+ +    ++GPVGI  ++    + GF  +   LA  S  +   NLLP
Sbjct: 226 -LLGVFLWQLLTGEQSLYQNVTGPVGIVSVSSQSVEQGF--FPVLLAFISLNLALFNLLP 282

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           I  LDGGHL+   +E +  K +       +  +GL ++L LF      D+
Sbjct: 283 ILPLDGGHLLFLAVEKVIRKPVSEETMNRVAIVGLMLVLTLFLFATYADL 332


>gi|32267180|ref|NP_861212.1| hypothetical protein HH1681 [Helicobacter hepaticus ATCC 51449]
 gi|32263233|gb|AAP78278.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 351

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 179/354 (50%), Gaps = 25/354 (7%)

Query: 12  VSLIII---VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY 68
           ++LII+   V  HE GH+ VARLC +RV  FS+GFG ++  +      ++ +SLIPLGGY
Sbjct: 5   IALIILSFLVFFHELGHFFVARLCGVRVEVFSIGFGKKIASVQIGQ-TQYALSLIPLGGY 63

Query: 69  VSFS-EDEKDMR-------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV-MK 119
           V    +D+ + +       S+   +P ++I  +LAGPL N ++A   +        + + 
Sbjct: 64  VKLKGQDDSNPKARNYEVDSYLSKSPMQRIAILLAGPLFNLLLAFFLYIAVGIGGKLSLL 123

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
           PVV  V    PA +AG+K GD I+S++   +  +EE+   +  +   E+ + + R+   +
Sbjct: 124 PVVGEVKENYPAYLAGIKAGDRILSINDEEIKTWEELDSIILSSS-GELLISIERDPSQI 182

Query: 180 LHLKVMPRLQDTVDRFG--IKRQVPSVGISFSYDETKLHSR---TVLQSFSRGLDEISSI 234
            +  + P  ++  + FG  I R+V  +GI+ +    K+  R   ++   F   L   + I
Sbjct: 183 FNFHLTPIEKEAKNIFGEDITRRV--IGIASANAVGKVSYRGWESIRYGFEETLKASTLI 240

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
            +G + +LS           +S    I   ++     G+       A+ S  +G +NLLP
Sbjct: 241 AQGIVKLLSGVVPSSEVGGVVSIVSVIGSASQ----EGWVILFWLTALISVNLGILNLLP 296

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           IP LDGGH+I    E+I  K    +V   +T  G  I+L L FLG+ NDI+ L+
Sbjct: 297 IPALDGGHIIFNCYEIIMRKPPSENVAYYLTLCGWAILLALMFLGLYNDIFRLL 350


>gi|228954096|ref|ZP_04116125.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|229071318|ref|ZP_04204541.1| Zinc metalloprotease rasP [Bacillus cereus F65185]
 gi|228711772|gb|EEL63724.1| Zinc metalloprotease rasP [Bacillus cereus F65185]
 gi|228805662|gb|EEM52252.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
          Length = 420

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMDNSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDNEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|317010538|gb|ADU84285.1| zinc metalloprotease [Helicobacter pylori SouthAfrica7]
          Length = 355

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 104/366 (28%), Positives = 186/366 (50%), Gaps = 46/366 (12%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++L  ++ +HE GH+ +ARLC ++V  FS+GFG +L       G ++ +SLIPLGGYV  
Sbjct: 7   LTLAFLIFVHELGHFTIARLCGVKVEVFSIGFGKKL-WFFRLFGTQFALSLIPLGGYVKL 65

Query: 72  S---------------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
                           +D KD  S+   +P +K+  +  G   N + AIL + FF   +G
Sbjct: 66  KGMDKEENDTDEANAKDDAKDNDSYAQKSPSQKLWILFGGAFFNFLFAILVY-FFLALSG 124

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+ P++ ++   + A  AG+ KGD I+S++   +++F E+   V  +   E+ + + R
Sbjct: 125 EKVLLPIIGDLE--NNALEAGLLKGDKILSINHKKIASFREIRGIVTRSQ-GELIVEIER 181

Query: 175 EHVGVLHLKVMPRL----QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
            +  +L  ++ P++     D+ D   +  Q   +GI     +T + S ++ Q+F + L +
Sbjct: 182 NN-QILEKRLTPKIVAVISDSNDPNEM-IQYKVIGIKPDMQKTGVVSYSLFQAFKKALIQ 239

Query: 231 --------ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
                   I S+ R  +G  S+         ++SG +GI     +   + F+A + F A 
Sbjct: 240 FKEGADLIIDSLKRLIVGSASA--------KELSGVIGIVGALSH--ANSFHALLLFGAF 289

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S  +G +NLLPIP LDGG ++  + + I   +L V +   +  +G+  ++F  FLG+ N
Sbjct: 290 LSINLGVLNLLPIPALDGGQMLGVIFKNIFNITLPVIIQNALWLVGVGFLVFAMFLGLFN 349

Query: 343 DIYGLM 348
           DI  L+
Sbjct: 350 DITRLL 355


>gi|229031450|ref|ZP_04187450.1| Zinc metalloprotease rasP [Bacillus cereus AH1271]
 gi|228729739|gb|EEL80719.1| Zinc metalloprotease rasP [Bacillus cereus AH1271]
          Length = 420

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMEKSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVSIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|47569098|ref|ZP_00239787.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus
           G9241]
 gi|47554260|gb|EAL12622.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus
           G9241]
          Length = 420

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      +++LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRVLTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVNIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|229174486|ref|ZP_04302018.1| Zinc metalloprotease rasP [Bacillus cereus MM3]
 gi|228609046|gb|EEK66336.1| Zinc metalloprotease rasP [Bacillus cereus MM3]
          Length = 420

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDNEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFDSLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|197121592|ref|YP_002133543.1| membrane-associated zinc metalloprotease [Anaeromyxobacter sp. K]
 gi|196171441|gb|ACG72414.1| membrane-associated zinc metalloprotease [Anaeromyxobacter sp. K]
          Length = 351

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 92/336 (27%), Positives = 150/336 (44%), Gaps = 28/336 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE-- 73
           +++V+HE GHY+ AR   +RV  FSVGFGP ++    R    + +S +PLGGYV  +   
Sbjct: 16  LLIVVHEAGHYLAARRSGMRVERFSVGFGPVVLSF-RRGETEFAISALPLGGYVRIAGMA 74

Query: 74  -----DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSN---- 124
                D  D  ++     W++   +LAGP  N + A+L       + G+  P  S     
Sbjct: 75  PGEDVDPADRGAYANQPAWRRFGVILAGPAMNYLAAVLIAAALLASVGLRTPDASARVGA 134

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV---LH 181
           + P  PA +AG++ GD I ++DG  V  + ++   ++ +P   I L + R        L 
Sbjct: 135 LVPGKPAEVAGLRPGDRIAAVDGQPVERWTDLVGQLQRHPGRRIVLDVERGEGAAAQRLA 194

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
           L + P   D V R G ++               L  R  L + + G    ++   G L  
Sbjct: 195 LPITPEDDDGVGRVGFRQH------------DVLVRRGALGALADGFARTNAQLGGQLAA 242

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
              AF    +  ++SGPVGIA+        G   +   +   S A+  +NL PIP LDGG
Sbjct: 243 FGQAFSGRQKA-ELSGPVGIAQELVRGAHEGVERFFTLVWTISVALALLNLFPIPALDGG 301

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFF 337
            L+    E++  + +   V   +  +G   ++ L  
Sbjct: 302 RLVFLGYEIVTRRRVNARVENALHLIGFVALVGLLL 337


>gi|254975725|ref|ZP_05272197.1| putative membrane-associated protease [Clostridium difficile
           QCD-66c26]
 gi|255093112|ref|ZP_05322590.1| putative membrane-associated protease [Clostridium difficile CIP
           107932]
 gi|255314854|ref|ZP_05356437.1| putative membrane-associated protease [Clostridium difficile
           QCD-76w55]
 gi|255517528|ref|ZP_05385204.1| putative membrane-associated protease [Clostridium difficile
           QCD-97b34]
 gi|255650639|ref|ZP_05397541.1| putative membrane-associated protease [Clostridium difficile
           QCD-37x79]
 gi|260683729|ref|YP_003215014.1| putative membrane-associated protease [Clostridium difficile CD196]
 gi|260687389|ref|YP_003218523.1| putative membrane-associated protease [Clostridium difficile
           R20291]
 gi|306520567|ref|ZP_07406914.1| putative membrane-associated protease [Clostridium difficile
           QCD-32g58]
 gi|260209892|emb|CBA63824.1| putative membrane-associated protease [Clostridium difficile CD196]
 gi|260213406|emb|CBE05046.1| putative membrane-associated protease [Clostridium difficile
           R20291]
          Length = 334

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 95/342 (27%), Positives = 165/342 (48%), Gaps = 27/342 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
           IIV+IHE GH++ A+   I+V  FS+G GP++  +  +    + +  +P+GGYVS   ED
Sbjct: 12  IIVLIHELGHFIFAKRSGIKVNEFSIGMGPKIYSV--KKDTEYSIRALPIGGYVSMEGED 69

Query: 75  EKDM--RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E+ +   SF   +  ++  T++AGP+ N ++A +     F   G     +  + P +PA 
Sbjct: 70  EEQISPNSFGNKSILQRFSTIVAGPIFNIILAAILLVPVFLYIGSPTTKLGKIMPDTPAQ 129

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
             G++ GD I  ++G +V  ++EVA  +  +   E+ L + R+    + + V P+  +  
Sbjct: 130 AVGLQVGDKINKINGNSVKTWDEVANIINTSSGGELKLSITRDGSNKV-VNVTPKNNNGK 188

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG---FLGVLSSAFGKD 249
              GI+ Q                 +  L S          +T+    FLG + +     
Sbjct: 189 YEIGIQPQ---------------REKDFLASIVNACKTTVDMTKQMLTFLGQMITGRVPG 233

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
              N ++GPVG+  +  +    G    +   A+ S  +G +NLLPIP LDG  ++  LLE
Sbjct: 234 GIGNAVAGPVGVIGMVSDAARTGIINVVYLAAVISLNLGIVNLLPIPALDGWRILMLLLE 293

Query: 310 MIR-GKSLGVSVTRVITRMGL-CIILFLFFLGIRNDIYGLMQ 349
            +R GK L  +   +I  +G   ++LF+ F+  + DI  L Q
Sbjct: 294 AVRGGKKLDPNKEGMINVVGFGALMLFMLFITYK-DILRLFQ 334


>gi|238924128|ref|YP_002937644.1| putative membrane-associated Zn-dependent protease [Eubacterium
           rectale ATCC 33656]
 gi|238875803|gb|ACR75510.1| predicted membrane-associated Zn-dependent protease [Eubacterium
           rectale ATCC 33656]
          Length = 351

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 144/318 (45%), Gaps = 42/318 (13%)

Query: 18  VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY-VSFSEDEK 76
           V+ HE GH+ +A+   I+V  F +G GP L G+  R   ++ + L+P GG  +   EDE 
Sbjct: 20  VIFHELGHFWLAKANGIKVNEFCLGLGPTLFGV-QRGETKYSIKLLPFGGACIMEGEDES 78

Query: 77  --DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIA 134
             D R+F   + W +I  V AGP  N +MA +F      + G   P ++ V     A  A
Sbjct: 79  SGDDRAFNNKSVWARISVVFAGPFFNFIMAFIFALIIICSVGYDSPKLAGVIEGYAAEEA 138

Query: 135 GVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVM-PRLQDTVD 193
           G+K GD I+ L+   +  + E++ Y   +    + +   R+  G  H   + P+  +T  
Sbjct: 139 GIKAGDEIVKLNNTNIHFYREISLYSMLHEGETVDVTYLRD--GKKHTTTLKPKYDETTK 196

Query: 194 RF------GIKRQVPSVGISFSYD--ETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           R+        KR  P  G +  Y   E K +  T ++         +S+           
Sbjct: 197 RYLYGFNVSGKRTKPGFGKALLYSCYEVKYNIYTTIEGLKMLCTGAASV----------- 245

Query: 246 FGKDTRLNQISGPVGIARIAKNFFDHGFN---AYIAFLAMFSWAI------GFMNLLPIP 296
                  N +SGPVGI +   + ++   +    ++  L M +W +      G MNLLP+P
Sbjct: 246 -------NNLSGPVGIVKNMGDTYEQAVSMSGVWLGILNMLNWGVLISANLGVMNLLPLP 298

Query: 297 ILDGGHLITFLLEMIRGK 314
            LDGG L+  ++E IR K
Sbjct: 299 ALDGGRLVFLIVEAIRRK 316


>gi|304316870|ref|YP_003852015.1| membrane-associated zinc metalloprotease [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778372|gb|ADL68931.1| membrane-associated zinc metalloprotease [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 338

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 93/329 (28%), Positives = 155/329 (47%), Gaps = 20/329 (6%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-EDE--K 76
           IHEFGH++VA+L   +V  F+VGFGP++          +   L+  GG+ + + EDE   
Sbjct: 19  IHEFGHFIVAKLSGTKVNEFAVGFGPKIFS-KKYGETEYSFRLMLFGGFCALAGEDETSN 77

Query: 77  DMRSFFCAAPWKKILTVLA-GPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAG 135
           D R+     PW   L + A GPL N ++  +     FY  G   P+V +V    PA  AG
Sbjct: 78  DKRAV-TNQPWYTRLGIFAAGPLMNILLTFILLVIVFYIVGSPVPIVGSVLSGYPAEKAG 136

Query: 136 VKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRF 195
           +  GD I+ ++   ++ ++ +   +  N   ++   + R++V +L   ++P    T D+ 
Sbjct: 137 IIPGDKIVMVNNTKINDWDTLQNIINSNSGIKLKFTIERDNV-ILTKSIVP----TYDKN 191

Query: 196 GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQI 255
             K   P +GI   Y       R++L +FS G  +    ++  +  L          N +
Sbjct: 192 ASK---PMIGIVPQY------KRSLLLAFSTGTKQAIFFSKMIILSLYMLITGKVSANDL 242

Query: 256 SGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKS 315
            GPVGI +        G    +AF A+ S  +G +NLLP P LDGG ++  L+E IRGK 
Sbjct: 243 MGPVGIVQAIGTEAKSGILNLMAFTALISVNLGLLNLLPFPALDGGRILFVLIEKIRGKP 302

Query: 316 LGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +       +  +G  +++ L       D+
Sbjct: 303 VDPEKEGFVHYIGFILLIALILFATYRDL 331


>gi|255987640|ref|YP_001885464.2| RIP metalloprotease RseP [Clostridium botulinum B str. Eklund 17B]
 gi|255961471|gb|ACD23692.2| RIP metalloprotease RseP [Clostridium botulinum B str. Eklund 17B]
          Length = 342

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 82/334 (24%), Positives = 162/334 (48%), Gaps = 17/334 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +++++HE GH+ +A+L  +RV  F++G GP++     +    + + L P+GG+V+   +E
Sbjct: 18  VLIIVHELGHFTLAKLNGVRVEEFAIGMGPKVFSKKGKE-TTYSLRLFPIGGFVNMMGEE 76

Query: 76  ---KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
              +D RSF   +P ++I  ++AG + N ++AI+ F       G   P V NV P  PA 
Sbjct: 77  EAVQDDRSFSEKSPLRRISIIIAGAVMNYILAIVIFACIAGKFGYKVPEVVNVLPDYPAI 136

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            +G+++GD  I +DG  V   ++V   +       + L + R +  + +  V P+L +  
Sbjct: 137 ESGLQEGDKFIKIDGSKVFTADDVTAGILMAKGAPVDLTVKRGN-EIKNFTVTPKLSEEN 195

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
                      VGI F  +       ++  S ++    +S   +G   + +   GK    
Sbjct: 196 QYM--------VGIGFGVETNPSIGSSIKHSVNQTASLVSQTFKGLKMIFT---GKSNLK 244

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
             + GP+ I +++    + G    + F+   S ++   N+LP P LDGG  +  L+E+I 
Sbjct: 245 TDVGGPLTIIKMSAKTAESGIWNLMYFVGFISVSLAVFNMLPFPALDGGWTVILLIELIT 304

Query: 313 GKSLGVSVTRVITRMG-LCIILFLFFLGIRNDIY 345
            + +   +   +  +G +C+I  +  + I++ I+
Sbjct: 305 RRKVPDKIVETLNYVGFMCLIGLMILVTIKDIIF 338


>gi|312898666|ref|ZP_07758056.1| RIP metalloprotease RseP [Megasphaera micronuciformis F0359]
 gi|310620585|gb|EFQ04155.1| RIP metalloprotease RseP [Megasphaera micronuciformis F0359]
          Length = 340

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 98/341 (28%), Positives = 167/341 (48%), Gaps = 29/341 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           +IV +HE GH++ A+L  ++V  F++GFGP+L        V + + +IPLGG+   +   
Sbjct: 14  LIVFVHEAGHFITAKLTGMQVDEFAIGFGPKLYSRKYGETV-YSLRIIPLGGFNKIAGMS 72

Query: 73  -EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK----PVVSNVSP 127
            E+E + RSF       ++L + AG L N ++A L      ++TG+      P+V  +  
Sbjct: 73  DEEELNERSFLNKPVRSRLLVISAGALMNFLLAFLLLWGIVFSTGISSVLPDPIVGGIIK 132

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
            S AA AG++ GD IIS+    V+ + ++ P   E    E+  V+Y      + +  +P+
Sbjct: 133 NSAAAEAGIEPGDRIISVGNTPVNRWIDI-PEAIEAHQREVVPVVYERDGSRITVDTIPK 191

Query: 188 LQDTVDR--FGIKRQVPSVGISFSYDETKLHSRTVLQSFS--RGLDEISSITRGFLGVLS 243
             +   R   G+   +PS+       +TK         F+  R +D    +  G   ++S
Sbjct: 192 TDEKTGRTLLGV---MPSI-------QTKYVGVGEAAGFAVNRLVDLGGMMLTGLYRMVS 241

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHL 303
                 T   +++GP+G+A++A      GF   + F A  S  +G +NLLPIP+LDGG++
Sbjct: 242 G-----TEKAELAGPIGVAQLAGQAASVGFVNLLTFTAFLSLNLGILNLLPIPMLDGGYI 296

Query: 304 ITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           I  LLE I  + +       I   G+ I+  +F   +  DI
Sbjct: 297 ILILLEGITRRKMPKKALYYIQMAGVIILGAMFIFALVQDI 337


>gi|218898972|ref|YP_002447383.1| RIP metalloprotease RasP [Bacillus cereus G9842]
 gi|218544448|gb|ACK96842.1| RIP metalloprotease RasP [Bacillus cereus G9842]
          Length = 418

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 158 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPIDKPMVGKVMDNSAAQQAGL 217

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 218 KENDTIQAIDGKNTSTWKDVVDIVRENPDKEITLQVKRDNEQ-FNVKVTP----TLDKEG 272

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 273 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 325

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 326 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 385

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 386 DRQKEGMVHFIGFALLMLLMLVVTWNDI 413



 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 14 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 72

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 73 DTVEL---KPGKKVGLVL 87


>gi|148359872|ref|YP_001251079.1| membrane associated zinc metalloprotease [Legionella pneumophila
           str. Corby]
 gi|296107922|ref|YP_003619623.1| Predicted membrane-associated Zn-dependent proteases 1 [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148281645|gb|ABQ55733.1| membrane associated zinc metalloprotease [Legionella pneumophila
           str. Corby]
 gi|295649824|gb|ADG25671.1| Predicted membrane-associated Zn-dependent proteases 1 [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 357

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 96/343 (27%), Positives = 167/343 (48%), Gaps = 25/343 (7%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++LI+++ IHE GH + ARL  +++   S+GFG  LI   ++SG  W  ++ PLGGYV  
Sbjct: 10  LTLILVIGIHELGHALAARLFQVKISKISIGFGKPLIQWQTQSGCNWIWAMWPLGGYVQL 69

Query: 72  SEDE----KDMRSFFC--AAP-WKKILTVLAGPLANCVMAILFFTFFFY-NTGVMKPVVS 123
                   K   + +C    P W ++L +L+G +AN + A +     FY      +P + 
Sbjct: 70  LNSRISPVKPQENAYCFDKKPIWIRVLILLSGAIANLITAWIALVLVFYIGISYKQPQIQ 129

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA-PYVRENPLHEISLVLYREHVGVLHL 182
           +V   S AA AG++ GD  +S++     +++ V    V       + +VL + +  +  L
Sbjct: 130 SVKLDSLAAKAGIQAGDQWVSVENYPTDSWQGVGMQLVIHWGQKNVQIVLRQANQQLKQL 189

Query: 183 KV-MPRLQDT------VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
            + + +++ T      ++  GIK  + +V     Y        ++L S  +   EI    
Sbjct: 190 SLDLSQIEFTSKDGSLLESLGIKPDLSAVSSLTRYP-------SLLASMQKAFAEIIHTM 242

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             F+ +L   F      + + GP+ I  ++      G   ++ F+A  S A+  +NL PI
Sbjct: 243 YFFIMILKQLFLGVIPFSILLGPLAIFSVSVASLTQGVIVFLLFIATLSLAVALVNLFPI 302

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
           P LDGG ++  ++E IRGK + V+V  ++ R  L IILF   L
Sbjct: 303 PGLDGGSILYSVIEKIRGKPVSVAVEVLLHR--LMIILFCVLL 343


>gi|148241645|ref|YP_001226802.1| membrane-associated Zn-dependent protease [Synechococcus sp.
           RCC307]
 gi|147849955|emb|CAK27449.1| Predicted membrane-associated Zn-dependent protease [Synechococcus
           sp. RCC307]
          Length = 362

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 98/320 (30%), Positives = 156/320 (48%), Gaps = 38/320 (11%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMR- 79
           HE GH++ A    IRV SF+VGFGP L+    R+GV + + LIPLGG+V+F EDE D   
Sbjct: 17  HEAGHFLAAVCQGIRVTSFNVGFGPALL-QKQRNGVLYALRLIPLGGFVAFPEDEPDNDI 75

Query: 80  -----SFFCAAPW-KKILTVLAGPLANCVMA----------ILFFTFFFYNTGVMKPVVS 123
                      P  ++ L + AG +AN ++A          +   + F    GV+   V+
Sbjct: 76  DPRDPDLLKNRPLSQRALVIAAGVIANVILAWVVLVGQGLVVGIPSGFSATGGVL---VT 132

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITV----SAFEEVAPYVRENPLHEISLVLYREHVGV 179
            V P   AA AG++ GD +I L+G  +    +A + +   V+ +P  E+ + + R+    
Sbjct: 133 GVQPQQAAARAGLEPGDTLIGLNGQPLGGGSTAVQTLVDAVKSSPSQELQVEIKRQGE-T 191

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI-TRGF 238
           L + ++P       R G + Q   V       E        L+  SR   + ++I TR  
Sbjct: 192 LSVPMIPADLGGSGRIGAQLQPAGV-------ENFRRPANPLEVISRANRDFAAIWTRTI 244

Query: 239 LG--VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
            G   L + FG+    +Q+SGPV I  +     + G ++   F A+ S  +  +N LP+P
Sbjct: 245 DGFWTLITNFGETA--SQVSGPVKIVEMGAQLAEQGGSSLFLFTALISINLAVLNALPLP 302

Query: 297 ILDGGHLITFLLEMIRGKSL 316
           +LDGG  +  L+E +RG+ L
Sbjct: 303 MLDGGQFVLLLIEGLRGRPL 322


>gi|269792542|ref|YP_003317446.1| membrane-associated zinc metalloprotease [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100177|gb|ACZ19164.1| membrane-associated zinc metalloprotease [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 342

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 91/315 (28%), Positives = 151/315 (47%), Gaps = 26/315 (8%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L + + + I V+IHE GH+  ARL  +RV  FS+G GP+++ +  R G +W + ++P+
Sbjct: 4   TLLSFLLVISISVLIHELGHFWAARLSGVRVNEFSLGMGPKVLSV-ERLGTQWSLRVVPI 62

Query: 66  GGYVSFSEDEKDMR----SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--- 118
           GG+V  +  E D      +F    P  +   +++G L N ++A        +  GVM   
Sbjct: 63  GGFVKLAGMEGDQTQGEDTFEGKGPLARAFILVSGALCNVLLAFALAAMVLHFHGVMDTS 122

Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN-PLHEISLVLYREHV 177
             V+       PA   G+  GD I+ ++G+ V  +  +A  +R + PL  + L + RE  
Sbjct: 123 STVIGETMEGYPAREVGISPGDRIVEVNGVRVGDWGSMAKTIRRHAPLGPLYLGIEREGT 182

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG 237
            V++  VM R  D+             G         L   T L++         ++  G
Sbjct: 183 -VIYKTVMIRKDDS-------------GAYLLGVRPSLRRYTPLEALRGAYRYSVNLAFG 228

Query: 238 FL-GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
            + G+L  A G++    ++SGPVGIA  A +    G   ++AFL+  +  +G +NLLP P
Sbjct: 229 IVKGILDWALGRNP--VEVSGPVGIAVAAGDVARRGLWEFLAFLSALNLHLGLVNLLPFP 286

Query: 297 ILDGGHLITFLLEMI 311
            LDGG LI    E++
Sbjct: 287 ALDGGRLIFVAFELV 301


>gi|54295173|ref|YP_127588.1| hypothetical protein lpl2253 [Legionella pneumophila str. Lens]
 gi|53755005|emb|CAH16493.1| hypothetical protein lpl2253 [Legionella pneumophila str. Lens]
          Length = 355

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 96/343 (27%), Positives = 168/343 (48%), Gaps = 25/343 (7%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++LI+++ IHE GH + ARL  +++   S+GFG  LI   ++SG  W  ++ PLGGYV  
Sbjct: 8   LTLILVIGIHELGHALAARLFQVKISKISIGFGKPLIQWQTQSGCNWIWAMWPLGGYVQL 67

Query: 72  SEDE----KDMRSFFC--AAP-WKKILTVLAGPLANCVMAILFFTFFFY-NTGVMKPVVS 123
                   K   + +C    P W ++L +L+G +AN + A +     FY      +P + 
Sbjct: 68  LNSRISPVKPQENAYCFDKKPIWIRVLILLSGAIANIITAWIALVLVFYIGISYKQPQIQ 127

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA-PYVRENPLHEISLVLYREHVGVLHL 182
           +V   S AA AG++ GD  +S++     +++ V    V      ++ +VL + +  +  L
Sbjct: 128 SVKLDSLAAKAGIQAGDQWVSVENYPTDSWQGVGMQLVIHWGQKDVRIVLRQGNQQLKQL 187

Query: 183 KV-MPRLQDT------VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
            + + +++ T      ++  GIK  + +V     Y        ++L S  +   EI    
Sbjct: 188 NLDLSQIEFTSKDGSLLESLGIKPDLSAVSSLTRYP-------SLLASMQKAFAEIIHTM 240

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             F+ +L   F      + + GP+ I  ++      G   ++ F+A  S A+  +NL PI
Sbjct: 241 YFFIMILKQLFLGVIPFSILLGPLAIFSVSVASLTQGVVVFLLFIATLSLAVALVNLFPI 300

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
           P LDGG ++  ++E IRGK + V+V  ++ R  L IILF   L
Sbjct: 301 PGLDGGSILYSVIEKIRGKPVSVAVEVLLHR--LMIILFCVLL 341


>gi|229047506|ref|ZP_04193096.1| Zinc metalloprotease rasP [Bacillus cereus AH676]
 gi|229111291|ref|ZP_04240844.1| Zinc metalloprotease rasP [Bacillus cereus Rock1-15]
 gi|229129096|ref|ZP_04258069.1| Zinc metalloprotease rasP [Bacillus cereus BDRD-Cer4]
 gi|296504315|ref|YP_003666015.1| zinc metalloprotease rasP [Bacillus thuringiensis BMB171]
 gi|228654333|gb|EEL10198.1| Zinc metalloprotease rasP [Bacillus cereus BDRD-Cer4]
 gi|228672067|gb|EEL27358.1| Zinc metalloprotease rasP [Bacillus cereus Rock1-15]
 gi|228723753|gb|EEL75108.1| Zinc metalloprotease rasP [Bacillus cereus AH676]
 gi|296325367|gb|ADH08295.1| Zinc metalloprotease rasP [Bacillus thuringiensis BMB171]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMDNSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDNEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|229146391|ref|ZP_04274762.1| Zinc metalloprotease rasP [Bacillus cereus BDRD-ST24]
 gi|228637024|gb|EEK93483.1| Zinc metalloprotease rasP [Bacillus cereus BDRD-ST24]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMDNSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDNEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|188588698|ref|YP_001920611.1| RIP metalloprotease RseP [Clostridium botulinum E3 str. Alaska E43]
 gi|188498979|gb|ACD52115.1| RIP metalloprotease RseP [Clostridium botulinum E3 str. Alaska E43]
          Length = 342

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 162/334 (48%), Gaps = 17/334 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +++++HE GH+ +A+L  +RV  F++G GP++     +    + + L P+GG+V+   +E
Sbjct: 18  VLIIVHELGHFTLAKLNGVRVEEFAIGMGPKVFSKKGKE-TTYSLRLFPIGGFVNMMGEE 76

Query: 76  ---KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
              +D RSF   +P ++I  ++AG + N ++AI+ F       G   P V NV P  PA 
Sbjct: 77  EAVQDDRSFSEKSPLRRISIIIAGAVMNYILAIVIFACIAGKFGYKVPEVVNVLPDYPAI 136

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            +G+++GD  I +DG  V   ++V   +       + L + R +  + +  + P+L +  
Sbjct: 137 ESGLQEGDKFIKIDGSKVFTADDVTAGILMAKGAPVDLTVKRGN-EIKNFNITPKLSEEN 195

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
                      VGI F  +       ++  S ++    +S   +G   + +   GK    
Sbjct: 196 QYM--------VGIGFGVEANPSIGDSIKHSVNQTASLVSQTFKGLKMIFT---GKSNLK 244

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
             + GP+ I +++    + G    + F+   S ++   N+LP P LDGG  +  L+E+I 
Sbjct: 245 TDVGGPLTIIKMSAKTAESGIWNLMYFVGFISVSLAVFNMLPFPALDGGWTVILLIELIT 304

Query: 313 GKSLGVSVTRVITRMG-LCIILFLFFLGIRNDIY 345
            + +   +   +  +G +C+I  +  + I++ I+
Sbjct: 305 RRKVPDKIVETLNYVGFMCLIGLMILVTIKDIIF 338


>gi|220931618|ref|YP_002508526.1| putative membrane-associated zinc metalloprotease [Halothermothrix
           orenii H 168]
 gi|219992928|gb|ACL69531.1| putative membrane-associated zinc metalloprotease [Halothermothrix
           orenii H 168]
          Length = 357

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 87/366 (23%), Positives = 171/366 (46%), Gaps = 40/366 (10%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   + + + L I++ IHEFGHY+ A+   IRV  F++G+GP L     +    + +  +
Sbjct: 2   LTTIISFIIVLGILIFIHEFGHYITAKKAGIRVEEFALGYGPRLFS-RQKGETVYSIRAL 60

Query: 64  PLGGYVSFS------------------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAI 105
           PLGG+   +                  + ++    FF  +P K+   +  GP  N ++A+
Sbjct: 61  PLGGFCKMTGEFPEDEEMTEEERKIYLDAKEKGECFFQKSPIKRFAVIFMGPFMNFMLAV 120

Query: 106 LFFTFFFYNTGV-----MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYV 160
           L F   F   G+        ++  + P  PAA AG++ GD II ++G  V  ++E+A  +
Sbjct: 121 LLFILMFSIYGIPVDSSSTTIIGTIVPEKPAAEAGLEPGDKIIEINGTRVENWDEMASII 180

Query: 161 RENPLHEISLVLYREHVGVLHLKVMPRLQDTVDR--FGIKRQVPSVGISFSYDETKLHSR 218
             +P  ++ +   R +  +  + ++P   +  +    GI  ++    +SF+        +
Sbjct: 181 HRSPGKKLEIKYIRNN-EIREVTLIPDFNENTETGVIGIYPELIMKKVSFT--------K 231

Query: 219 TVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA 278
           ++   F +     S+    F+ +++    ++T   +++GP+ IA +       G    + 
Sbjct: 232 SIKMGFYQTWYVFSNTIMAFVKIIT----RETS-AELAGPIMIANMVGQAAKVGLLNLLN 286

Query: 279 FLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
            +A+ S  +G +NLLP P LDGG ++  L+E++RGK +       +  +G  +++ L   
Sbjct: 287 LMAVISINLGILNLLPFPALDGGRIVFILVEVVRGKPVDPEKEGFVHLIGFVLLMVLMVF 346

Query: 339 GIRNDI 344
            I  DI
Sbjct: 347 VIYKDI 352


>gi|328950707|ref|YP_004368042.1| peptidase M50 [Marinithermus hydrothermalis DSM 14884]
 gi|328451031|gb|AEB11932.1| peptidase M50 [Marinithermus hydrothermalis DSM 14884]
          Length = 342

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 97/351 (27%), Positives = 165/351 (47%), Gaps = 28/351 (7%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             +L+ + L + + +HE GHY+ ARL  + V +FS+GFGP L+    R G  W++SLIPL
Sbjct: 2   SLVLFLLILGVSIFVHELGHYLAARLQGVGVPAFSIGFGPPLVRF-KRGGTEWRLSLIPL 60

Query: 66  GGYVSFS----EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV 121
           GGY        + +  +R +       K   +LAG + N ++A       F   G+ + +
Sbjct: 61  GGYAEIEGMVPDPDGRLRGYARLGFLGKAFILLAGVVMNLLLAWTLMAVLFSGQGIPRAI 120

Query: 122 -----VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
                +  V P S A  AG++ GD I+++DG  + A+ ++A  V+E P    +L + R+ 
Sbjct: 121 PTEAHIVEVLPESLAERAGLRPGDVIVAIDGQPLEAYTDLA-KVKERPGPH-ALTVLRDG 178

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQ-SFSRGL--DEISS 233
                L++        ++ G++ + P V    +Y +    S       FS G   + + S
Sbjct: 179 A---PLEIQLVWTPEAEQIGVRYR-PGV----AYVQLPFPSAFAQAVQFSVGFFPEMVQS 230

Query: 234 ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
             RG LG  +      T   ++ GPVGI  +       G+ A I  +A+ + ++   NLL
Sbjct: 231 FIRGILGAFTG-----TATGEVVGPVGIVAMTGEAAQEGWFALIRLMAVINLSLAVFNLL 285

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           PIP LDGG L   +L  +    +G      +  +G   ++FL  +    D+
Sbjct: 286 PIPSLDGGRLFMLVLNGLTRGRIGPEHEAAVNFIGFMFLIFLIVMITLQDV 336


>gi|228902323|ref|ZP_04066480.1| Zinc metalloprotease rasP [Bacillus thuringiensis IBL 4222]
 gi|228966765|ref|ZP_04127809.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228792864|gb|EEM40422.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228857292|gb|EEN01795.1| Zinc metalloprotease rasP [Bacillus thuringiensis IBL 4222]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPIDKPMVGKVMDNSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVDIVRENPDKEITLQVKRDNEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|222097265|ref|YP_002531322.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus
           Q1]
 gi|229140461|ref|ZP_04269016.1| Zinc metalloprotease rasP [Bacillus cereus BDRD-ST26]
 gi|221241323|gb|ACM14033.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus
           Q1]
 gi|228643022|gb|EEK99298.1| Zinc metalloprotease rasP [Bacillus cereus BDRD-ST26]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|206972657|ref|ZP_03233598.1| RIP metalloprotease RasP [Bacillus cereus AH1134]
 gi|218234918|ref|YP_002368621.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           B4264]
 gi|206732414|gb|EDZ49595.1| RIP metalloprotease RasP [Bacillus cereus AH1134]
 gi|218162875|gb|ACK62867.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           B4264]
          Length = 418

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 158 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPIDKPMVGKVMDNSAAQQAGL 217

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 218 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDNEQ-FNVKVTP----TLDKEG 272

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 273 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 325

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 326 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 385

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 386 DRQKEGMVHFIGFALLMLLMLVVTWNDI 413



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 14 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 72

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 73 DTVEL---KPGKKVGLVL 87


>gi|251777652|ref|ZP_04820572.1| RIP metalloprotease RseP [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243081967|gb|EES47857.1| RIP metalloprotease RseP [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 342

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 162/334 (48%), Gaps = 17/334 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +++++HE GH+ +A+L  +RV  F++G GP++     +    + + L P+GG+V+   +E
Sbjct: 18  VLIIVHELGHFTLAKLNGVRVEEFAIGMGPKVFSKKGKE-TTYSLRLFPIGGFVNMMGEE 76

Query: 76  ---KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
              +D RSF   +P ++I  ++AG + N ++AI+ F       G   P V NV P  PA 
Sbjct: 77  EAVQDDRSFSEKSPLRRISIIIAGAVMNYILAIVIFACIAGKFGYKIPEVVNVLPDYPAI 136

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            +G+++GD  I +DG  V   ++V   +       + L + R +  + +  + P+L +  
Sbjct: 137 ESGLQEGDKFIKIDGSKVFTADDVTAGILMAKGAPVDLTVKRGN-EIKNFNITPKLSEEN 195

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
                      VGI F  +       ++  S ++    +S   +G   + +   GK    
Sbjct: 196 QYM--------VGIGFGVEANPSIGDSIKHSVNQTASLVSQTFKGLKMIFT---GKSNLK 244

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
             + GP+ I +++    + G    + F+   S ++   N+LP P LDGG  +  L+E+I 
Sbjct: 245 TDVGGPLTIIKMSAKTAESGIWNLMYFVGFISVSLAVFNMLPFPALDGGWTVILLIELIT 304

Query: 313 GKSLGVSVTRVITRMG-LCIILFLFFLGIRNDIY 345
            + +   +   +  +G +C+I  +  + I++ I+
Sbjct: 305 RRKVPDKIVETLNYVGFMCLIGLMILVTIKDIIF 338


>gi|217961240|ref|YP_002339808.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           AH187]
 gi|217065425|gb|ACJ79675.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           AH187]
          Length = 418

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 158 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 217

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 218 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 272

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 273 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 325

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 326 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 385

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 386 DRQKEGMVHFIGFALLMLLMLVVTWNDI 413



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 14 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 72

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 73 DTVEL---KPGKKVGLVL 87


>gi|228909644|ref|ZP_04073467.1| Zinc metalloprotease rasP [Bacillus thuringiensis IBL 200]
 gi|228849933|gb|EEM94764.1| Zinc metalloprotease rasP [Bacillus thuringiensis IBL 200]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPIDKPMVGKVMDNSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVDIVRENPNKEITLQVKRDNEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|228922574|ref|ZP_04085874.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228960036|ref|ZP_04121700.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|229081075|ref|ZP_04213585.1| Zinc metalloprotease rasP [Bacillus cereus Rock4-2]
 gi|229152019|ref|ZP_04280214.1| Zinc metalloprotease rasP [Bacillus cereus m1550]
 gi|229180096|ref|ZP_04307440.1| Zinc metalloprotease rasP [Bacillus cereus 172560W]
 gi|229191989|ref|ZP_04318959.1| Zinc metalloprotease rasP [Bacillus cereus ATCC 10876]
 gi|228591540|gb|EEK49389.1| Zinc metalloprotease rasP [Bacillus cereus ATCC 10876]
 gi|228603305|gb|EEK60782.1| Zinc metalloprotease rasP [Bacillus cereus 172560W]
 gi|228631368|gb|EEK88002.1| Zinc metalloprotease rasP [Bacillus cereus m1550]
 gi|228702119|gb|EEL54595.1| Zinc metalloprotease rasP [Bacillus cereus Rock4-2]
 gi|228799552|gb|EEM46505.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228837003|gb|EEM82344.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPIDKPMVGKVMDNSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDNEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|228940908|ref|ZP_04103467.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228973837|ref|ZP_04134413.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980426|ref|ZP_04140736.1| Zinc metalloprotease rasP [Bacillus thuringiensis Bt407]
 gi|228779246|gb|EEM27503.1| Zinc metalloprotease rasP [Bacillus thuringiensis Bt407]
 gi|228785862|gb|EEM33865.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818744|gb|EEM64810.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|326941587|gb|AEA17483.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPIDKPMVGKVMDNSAAQQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R++    ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDNEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|196036921|ref|ZP_03104305.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           W]
 gi|196042169|ref|ZP_03109452.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           NVH0597-99]
 gi|218904948|ref|YP_002452782.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           AH820]
 gi|195990476|gb|EDX54460.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           W]
 gi|196027021|gb|EDX65645.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           NVH0597-99]
 gi|218534938|gb|ACK87336.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           AH820]
          Length = 418

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 158 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 217

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 218 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 272

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 273 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 325

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 326 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 385

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 386 DRQKEGMVHFIGFALLMLLMLVVTWNDI 413



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 14 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 72

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 73 DTVEL---KPGKKVGLVL 87


>gi|229157396|ref|ZP_04285474.1| Zinc metalloprotease rasP [Bacillus cereus ATCC 4342]
 gi|228626123|gb|EEK82872.1| Zinc metalloprotease rasP [Bacillus cereus ATCC 4342]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVNIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|42782911|ref|NP_980158.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus
           ATCC 10987]
 gi|42738838|gb|AAS42766.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus
           ATCC 10987]
          Length = 420

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|49478393|ref|YP_037881.1| membrane-associated zinc metalloprotease [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141668|ref|YP_085161.1| membrane-associated zinc metalloprotease [Bacillus cereus E33L]
 gi|118479042|ref|YP_896193.1| peptidase RseP [Bacillus thuringiensis str. Al Hakam]
 gi|228916457|ref|ZP_04080023.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228928868|ref|ZP_04091900.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935134|ref|ZP_04097961.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947539|ref|ZP_04109829.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229092860|ref|ZP_04223994.1| Zinc metalloprotease rasP [Bacillus cereus Rock3-42]
 gi|229123333|ref|ZP_04252537.1| Zinc metalloprotease rasP [Bacillus cereus 95/8201]
 gi|229186059|ref|ZP_04313229.1| Zinc metalloprotease rasP [Bacillus cereus BGSC 6E1]
 gi|49329949|gb|AAT60595.1| membrane-associated zinc metalloprotease [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|51975137|gb|AAU16687.1| membrane-associated zinc metalloprotease [Bacillus cereus E33L]
 gi|118418267|gb|ABK86686.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Bacillus
           thuringiensis str. Al Hakam]
 gi|228597478|gb|EEK55128.1| Zinc metalloprotease rasP [Bacillus cereus BGSC 6E1]
 gi|228660109|gb|EEL15745.1| Zinc metalloprotease rasP [Bacillus cereus 95/8201]
 gi|228690482|gb|EEL44265.1| Zinc metalloprotease rasP [Bacillus cereus Rock3-42]
 gi|228812059|gb|EEM58390.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228824499|gb|EEM70304.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830675|gb|EEM76280.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228843036|gb|EEM88118.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 420

 Score =  125 bits (315), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|165872600|ref|ZP_02217231.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0488]
 gi|167635827|ref|ZP_02394136.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0442]
 gi|167639836|ref|ZP_02398105.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0193]
 gi|170687892|ref|ZP_02879106.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0465]
 gi|170706845|ref|ZP_02897303.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0389]
 gi|177652099|ref|ZP_02934645.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0174]
 gi|190568390|ref|ZP_03021297.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis Tsiankovskii-I]
 gi|227813272|ref|YP_002813281.1| RIP metalloprotease RasP [Bacillus anthracis str. CDC 684]
 gi|229602094|ref|YP_002868058.1| RIP metalloprotease RasP [Bacillus anthracis str. A0248]
 gi|164711632|gb|EDR17178.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0488]
 gi|167512237|gb|EDR87614.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0193]
 gi|167528784|gb|EDR91542.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0442]
 gi|170128263|gb|EDS97132.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0389]
 gi|170668208|gb|EDT18957.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0465]
 gi|172082468|gb|EDT67533.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. A0174]
 gi|190560394|gb|EDV14372.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis Tsiankovskii-I]
 gi|227006961|gb|ACP16704.1| RIP metalloprotease RasP [Bacillus anthracis str. CDC 684]
 gi|229266502|gb|ACQ48139.1| RIP metalloprotease RasP [Bacillus anthracis str. A0248]
          Length = 418

 Score =  125 bits (315), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 141/272 (51%), Gaps = 22/272 (8%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 158 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 217

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 218 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 272

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR----GFLGVLSSAFGKDTRL 252
            K +V  +G+    +      +TV+ S   G ++    T+     F+ +++  F     +
Sbjct: 273 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESFVKLVTGQFS----I 321

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
           N++SGPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +R
Sbjct: 322 NELSGPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALR 381

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GK +      ++  +G  +++ L  +   NDI
Sbjct: 382 GKPIDRQKEGMVHFIGFALLMLLMLVVTWNDI 413



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 14 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 72

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 73 DTVEL---KPGKKVGLVL 87


>gi|30263824|ref|NP_846201.1| membrane-associated zinc metalloprotease, putative [Bacillus
           anthracis str. Ames]
 gi|47529248|ref|YP_020597.1| membrane-associated zinc metalloprotease [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49186670|ref|YP_029922.1| membrane-associated zinc metalloprotease [Bacillus anthracis str.
           Sterne]
 gi|65321147|ref|ZP_00394106.1| COG0750: Predicted membrane-associated Zn-dependent proteases 1
           [Bacillus anthracis str. A2012]
 gi|254683473|ref|ZP_05147333.1| membrane-associated zinc metalloprotease, putative [Bacillus
           anthracis str. CNEVA-9066]
 gi|254721994|ref|ZP_05183783.1| membrane-associated zinc metalloprotease, putative [Bacillus
           anthracis str. A1055]
 gi|254735858|ref|ZP_05193564.1| membrane-associated zinc metalloprotease, putative [Bacillus
           anthracis str. Western North America USA6153]
 gi|254739616|ref|ZP_05197310.1| membrane-associated zinc metalloprotease, putative [Bacillus
           anthracis str. Kruger B]
 gi|254756011|ref|ZP_05208042.1| membrane-associated zinc metalloprotease, putative [Bacillus
           anthracis str. Vollum]
 gi|254759328|ref|ZP_05211353.1| membrane-associated zinc metalloprotease, putative [Bacillus
           anthracis str. Australia 94]
 gi|30258468|gb|AAP27687.1| RIP metalloprotease RasP [Bacillus anthracis str. Ames]
 gi|47504396|gb|AAT33072.1| putative membrane-associated zinc metalloprotease [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49180597|gb|AAT55973.1| membrane-associated zinc metalloprotease, putative [Bacillus
           anthracis str. Sterne]
          Length = 420

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 141/272 (51%), Gaps = 22/272 (8%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR----GFLGVLSSAFGKDTRL 252
            K +V  +G+    +      +TV+ S   G ++    T+     F+ +++  F     +
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESFVKLVTGQFS----I 323

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
           N++SGPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +R
Sbjct: 324 NELSGPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALR 383

Query: 313 GKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           GK +      ++  +G  +++ L  +   NDI
Sbjct: 384 GKPIDRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|317498941|ref|ZP_07957224.1| peptidase family M50 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316893774|gb|EFV15973.1| peptidase family M50 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 343

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 158/344 (45%), Gaps = 40/344 (11%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK--D 77
           +HE GH+++A+   I+V  F +G GP +IG        + V L+P GG     EDE   +
Sbjct: 16  VHELGHFLIAKKNGIQVDEFCIGLGPTIIG-KQVGETFYSVKLLPFGGACMMGEDEDRPE 74

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
             +F   + W ++  +  GP  N ++A +F       +G   P +S V   SPA  AG++
Sbjct: 75  ENAFNNKSVWARMAVIFGGPFFNFILAFIFSIIVIGMSGADIPKISKVEKDSPAYEAGIR 134

Query: 138 KGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRF-- 195
           KGD +I + G  +  + E + Y+  +       +   ++    ++ V P       ++  
Sbjct: 135 KGDIMIKVAGKKMHNYREFSYYMYLDYDGGKIPITILQNGKEKNINVTPEYDKERGQYLI 194

Query: 196 -----GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDT 250
                G ++  P   I +S+ E  L  +  L+S       +  +    LGV      KD 
Sbjct: 195 GITWNGYQKVGPLKTIEYSFREVGLQVKITLKS-------VKMLVSQKLGV------KD- 240

Query: 251 RLNQISGPVGIARIAKNFFD----HGFNAYIAFLAMFSWAI------GFMNLLPIPILDG 300
               +SGPVGI +   + +     +GF     FL M +W I      G MNLLP+P LDG
Sbjct: 241 ----LSGPVGIVKTVGDQYTQAAAYGFKT--VFLTMVNWIILISANLGVMNLLPLPALDG 294

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           G L+  ++E I GK++  ++  ++   GL +++ L    +  DI
Sbjct: 295 GRLLFLIIEAITGKAVSQNMEALVHTAGLILLMLLMVFVMYQDI 338


>gi|220916355|ref|YP_002491659.1| membrane-associated zinc metalloprotease [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219954209|gb|ACL64593.1| membrane-associated zinc metalloprotease [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 351

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 91/336 (27%), Positives = 150/336 (44%), Gaps = 28/336 (8%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE-- 73
           +++V+HE GHY+ AR   +RV  FS+GFGP ++    R    + +S +PLGGYV  +   
Sbjct: 16  LLIVLHEAGHYLAARRSGMRVERFSIGFGPVVLSF-RRGETEFAISALPLGGYVRIAGMA 74

Query: 74  -----DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSN---- 124
                D  D  ++     W++   +LAGP  N + A+L       + G+  P  S     
Sbjct: 75  PGEDVDPADRGAYANQPAWRRFGVILAGPAMNYLAAVLIAAALLASVGLRTPDASARVGA 134

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV---LH 181
           + P  PA +AG++ GD I ++DG  V  + ++   ++ +P   I L + R        L 
Sbjct: 135 LVPGKPAEVAGLRPGDRIAAVDGQPVERWTDLVGQLQRHPGRRIVLDVERGEGAAAQRLA 194

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
           L + P   D V R G ++               L  R  L + + G    ++   G L  
Sbjct: 195 LPITPEDDDGVGRVGFRQH------------DVLVRRGALGALADGFARTNAQLGGQLAA 242

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
              AF    +  ++SGPVGIA+        G   +   +   S A+  +NL PIP LDGG
Sbjct: 243 FGQAFSGRQK-AELSGPVGIAQELVRGAHEGVERFFTLVWTISVALALLNLFPIPALDGG 301

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFF 337
            L+    E++  + +   V   +  +G   ++ L  
Sbjct: 302 RLVFLGYEIVTRRRVNARVENALHLIGFVALVGLLL 337


>gi|196044632|ref|ZP_03111867.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           03BB108]
 gi|225865801|ref|YP_002751179.1| RIP metalloprotease RasP [Bacillus cereus 03BB102]
 gi|196024667|gb|EDX63339.1| putative membrane-associated zinc metalloprotease [Bacillus cereus
           03BB108]
 gi|225788654|gb|ACO28871.1| RIP metalloprotease RasP [Bacillus cereus 03BB102]
          Length = 418

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 158 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 217

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 218 KENDTIQAIDGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 272

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 273 -KEEVGRIGVYSPVE------KTVIGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 325

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 326 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 385

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 386 DRQKEGMVHFIGFALLMLLMLVVTWNDI 413



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 14 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 72

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 73 DTVEL---KPGKKVGLVL 87


>gi|126699746|ref|YP_001088643.1| putative membrane-associated protease [Clostridium difficile 630]
 gi|255101265|ref|ZP_05330242.1| putative membrane-associated protease [Clostridium difficile
           QCD-63q42]
 gi|255307141|ref|ZP_05351312.1| putative membrane-associated protease [Clostridium difficile ATCC
           43255]
 gi|115251183|emb|CAJ69014.1| putative membrane-associated peptidase, M50 family [Clostridium
           difficile]
          Length = 334

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 95/342 (27%), Positives = 165/342 (48%), Gaps = 27/342 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
           IIV+IHE GH++ A+   I+V  FS+G GP++  +  +    + +  +P+GGYVS   ED
Sbjct: 12  IIVLIHELGHFIFAKRSGIKVNEFSIGMGPKIYSV--KKDTEYSIRALPIGGYVSMEGED 69

Query: 75  EKDM--RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E+ +   SF   +  ++  T++AGP+ N ++A +     F   G     +  + P +PA 
Sbjct: 70  EEQISPNSFGNKSILQRFSTIVAGPIFNIILAAILLVPVFLYIGSPTTKLGKIMPDTPAQ 129

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
             G++ GD I  ++G +V  ++EVA  +  +   E+ L + R+    + + V P+  +  
Sbjct: 130 AVGLQVGDKINKINGNSVKTWDEVANIINTSSGGELKLSITRDGSDKV-VNVTPKNNNGK 188

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRG---FLGVLSSAFGKD 249
              GI+ Q                 +  L S          +T+    FLG + +     
Sbjct: 189 YEIGIQPQ---------------REKDFLGSIVNACKTTVDMTKQMLTFLGQMITGRVPG 233

Query: 250 TRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLE 309
              N ++GPVG+  +  +    G    +   A+ S  +G +NLLPIP LDG  ++  LLE
Sbjct: 234 GIGNAVAGPVGVIGMVSDAARTGIINVVYLAAVISLNLGIVNLLPIPALDGWRILMLLLE 293

Query: 310 MIR-GKSLGVSVTRVITRMGL-CIILFLFFLGIRNDIYGLMQ 349
            +R GK L  +   +I  +G   ++LF+ F+  + DI  L Q
Sbjct: 294 AVRGGKKLDPNKEGMINVVGFGALMLFMLFITYK-DILRLFQ 334


>gi|225026992|ref|ZP_03716184.1| hypothetical protein EUBHAL_01248 [Eubacterium hallii DSM 3353]
 gi|224955677|gb|EEG36886.1| hypothetical protein EUBHAL_01248 [Eubacterium hallii DSM 3353]
          Length = 345

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 100/348 (28%), Positives = 163/348 (46%), Gaps = 24/348 (6%)

Query: 8   LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67
           +L  V   +IV+ HE GH++ A+   I V  F++G GP + G       ++ +  +P GG
Sbjct: 5   ILAIVLFSVIVIFHELGHFLFAKKNGICVEEFAIGIGPTIFG-KQIGETKYSIKCLPFGG 63

Query: 68  Y-VSFSEDE--KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSN 124
             V   ED+  KD R+F   +   +   + AGP  N ++A +   F    +G    V   
Sbjct: 64  CCVMLGEDDDCKDPRAFGSQSALARFSVIFAGPFFNFILAFVLALFVIGFSGADPAVAGE 123

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           +S  S A  AG+ +GD I+ LDG  +  F E++ +   N LH+      +  V V + + 
Sbjct: 124 ISADSGAYEAGLHEGDRIVKLDGSRIYNFREISLF---NYLHK-----DKADVEVTYERD 175

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSS 244
             +   TV R   +    + GIS + D  +    T+  S      +I S       +++ 
Sbjct: 176 GKQKTVTVTRKKTEAGTYAFGISMTEDTKEGIIGTLKYSILEVRYQIKSTFLSLKYLITG 235

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFN--------AYIAFLAMFSWAIGFMNLLPIP 296
            F    +LN +SGPVGI  +  N ++            + + F  M S  +G MNLLP+P
Sbjct: 236 RF----KLNDLSGPVGIVNMIGNTYEQSIVYGIKTVVLSLLNFAIMLSANLGVMNLLPLP 291

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            LDGG L+  +LEMIR K +      ++   GL +++ L  + + NDI
Sbjct: 292 ALDGGRLVFIILEMIRRKKVSPEKEGMVHFAGLVLLMALMVIVMANDI 339


>gi|167630333|ref|YP_001680832.1| peptidase m50 [Heliobacterium modesticaldum Ice1]
 gi|167593073|gb|ABZ84821.1| peptidase m50 [Heliobacterium modesticaldum Ice1]
          Length = 351

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 96/348 (27%), Positives = 161/348 (46%), Gaps = 27/348 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           +++  HEFGH+ VA+   +RVL FS+G GP L G+  R    + + L+P+GG+V  +  E
Sbjct: 13  LMIFFHEFGHFAVAKAVGVRVLEFSIGMGPRLFGL-RRGPTLYALRLLPVGGFVRMAGME 71

Query: 76  KDMRSFFCAAP-----------WKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVV 122
                 F AA             ++   + AG   N ++A L F + +   GV     V+
Sbjct: 72  PGEDGQFPAATSDPGNFNNKTVLQRAAVIFAGSFMNFILAFLLFIYIYTIIGVPTYSNVI 131

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
            +V    PA  AG++ GD I+++DG   + + E+   +      E++L + R+   V H+
Sbjct: 132 GDVLEGKPAHRAGIRPGDRIVAVDGKATANWAELIQEIHPRGGQELTLTVERQGA-VRHV 190

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVL 242
           KV+P    +VD    +R V  +GI+          + +  S   G+    +IT     +L
Sbjct: 191 KVVP----SVDP---ERNVGQIGITVDDQSVYHEKKGLFTSLKLGIVNTVAITTM---IL 240

Query: 243 SSAFGKDTRLN--QISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
            S F   T     ++ GPV I          G    +   A+ S  +G +NL PIP LDG
Sbjct: 241 QSIFQMLTGAAPAEVGGPVMIVSEIGKAAQVGLMPLLMLAAVLSINLGLLNLFPIPALDG 300

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
             L+   LE +RG+ +  +   +I  +G  +++ L  L    D+  L+
Sbjct: 301 SRLVFLGLEALRGRPIDPAKESMIHMIGFALLIGLMLLIAYKDVLKLL 348


>gi|315641199|ref|ZP_07896276.1| peptidase [Enterococcus italicus DSM 15952]
 gi|315482966|gb|EFU73485.1| peptidase [Enterococcus italicus DSM 15952]
          Length = 421

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 147/283 (51%), Gaps = 23/283 (8%)

Query: 72  SEDEKDMR------SFFCAAPWKKILTVLAGPLANCVMAI-LFFTFFFYNTGVMKPV--- 121
            ED  ++R       F  A  W+++LT  AGP+ N ++A+ LFF       GV  P    
Sbjct: 147 EEDGTEVRIAPRDVQFQSAKLWQRMLTNFAGPMNNFILAVFLFFILILLQGGVQDPQSTK 206

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           + +V+  SPAA AG+K GD I  ++G TVS + E+   V++N   E+++V Y+       
Sbjct: 207 IGSVATDSPAATAGLKTGDTIQEINGTTVSNWSELTQAVQKNGSDELTVV-YKSGSQSKT 265

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
           + + P+ ++TV+     + V  VG+  S  +T +  + ++ +F+  ++    I    LG 
Sbjct: 266 VTMTPK-KNTVN----DQTVYQVGVGISM-KTGIMDK-IIGAFTMSINSFVQIFVA-LGS 317

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           L  +F     L+++ GPV I +I+      G+   I  +AM S  +G  NLLPIP LDGG
Sbjct: 318 LLKSF----SLDKLGGPVAIYQISSQAATQGWTTIIGVMAMISMNLGIFNLLPIPALDGG 373

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            L+  ++E +RGK L      +IT +G   ++ L  L   NDI
Sbjct: 374 KLVLNIIEGVRGKPLSQEKEGIITLIGFGFMMLLMILVTWNDI 416



 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 2/78 (2%)

Query: 4  LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
          +   L++     I+VV+HEFGH+  A+   I V  F++G GP++     + G  + + ++
Sbjct: 1  MKALLVFLFIFSIVVVVHEFGHFYFAKRAGILVREFAIGMGPKIFSHQGKDGTTYTIRIL 60

Query: 64 PLGGYVSFS--EDEKDMR 79
          PLGGYV  +  E+E  ++
Sbjct: 61 PLGGYVRMAGFEEEDGLK 78


>gi|167766539|ref|ZP_02438592.1| hypothetical protein CLOSS21_01045 [Clostridium sp. SS2/1]
 gi|167711662|gb|EDS22241.1| hypothetical protein CLOSS21_01045 [Clostridium sp. SS2/1]
          Length = 343

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 158/344 (45%), Gaps = 40/344 (11%)

Query: 20  IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK--D 77
           +HE GH+++A+   I+V  F +G GP +IG        + V L+P GG     EDE   +
Sbjct: 16  VHELGHFLIAKKNGIQVDEFCIGLGPTIIG-KQVGETFYSVKLLPFGGACMMGEDEDRPE 74

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
             +F   + W ++  +  GP  N ++A +F       +G   P +S V   SPA  AG++
Sbjct: 75  ENAFNNKSVWARMAVIFGGPFFNFILAFIFSIIVIGMSGADIPKISKVEKDSPAYEAGIR 134

Query: 138 KGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRF-- 195
           KGD +I + G  +  + E + Y+  +       +   ++    ++ V P       ++  
Sbjct: 135 KGDTMIKVAGKKMHNYREFSYYMYLDYDGGKIPITILQNGKEKNINVTPEYDKERGQYLI 194

Query: 196 -----GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDT 250
                G ++  P   I +S+ E  L  +  L+S       +  +    LGV      KD 
Sbjct: 195 GITWNGYQKVGPLKTIEYSFREVGLQVKITLKS-------VKMLVSQKLGV------KD- 240

Query: 251 RLNQISGPVGIARIAKNFFD----HGFNAYIAFLAMFSWAI------GFMNLLPIPILDG 300
               +SGPVGI +   + +     +GF     FL M +W I      G MNLLP+P LDG
Sbjct: 241 ----LSGPVGIVKTVGDQYTQAAAYGFKT--VFLTMVNWIILISANLGVMNLLPLPALDG 294

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           G L+  ++E I GK++  ++  ++   GL +++ L    +  DI
Sbjct: 295 GRLLFLIIEAITGKAVPQNMEALVHTAGLILLMLLMVFVMYQDI 338


>gi|224437554|ref|ZP_03658512.1| hypothetical protein HcinC1_06295 [Helicobacter cinaedi CCUG 18818]
 gi|313144008|ref|ZP_07806201.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313129039|gb|EFR46656.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 354

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 108/350 (30%), Positives = 179/350 (51%), Gaps = 27/350 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-EDE 75
           +V  HE GH++VAR+C ++V  FS+GFG +L+    R    + +S+IPLGGYV    +D+
Sbjct: 13  LVFFHELGHFIVARICGVKVEVFSIGFGKKLVSWQFRQ-TEYVLSMIPLGGYVKLKGQDD 71

Query: 76  KDMR-------SFFCAAPWKKILTVLAGPLANCVMAIL-FFTFFFYNTGVMKPVVSNVSP 127
            + +       S+   +PW++I  +LAGP  N  +A L +          + PVV  V  
Sbjct: 72  SNPKLKNYEADSYLSKSPWQRIAILLAGPFFNLFLAFLLYMAVGLLGKVSLLPVVGEVKE 131

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR---EHVGVLHLKV 184
             PA  AG+K GD I++++G  +  +EE+   + E+   E+ L + R   E    L ++V
Sbjct: 132 NYPAVKAGIKAGDVIVAINGKEIKTWEELDSMIIESQ-GELELKIQRGQGELKESLRVRV 190

Query: 185 MPRLQDTVD--RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI----SSITRGF 238
           +P  Q+  +  R  I R++  +GIS +     +H +  L S   G+DE     + I +  
Sbjct: 191 LPMEQEAQNIFRENITRKI--IGISSAGAVGMVHYKG-LDSIVFGIDESIKASTLIAQSI 247

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPIL 298
           + ++S           +S    I+  + +   H     +   A+ S  +G +NLLPIP L
Sbjct: 248 IKLISGVVPSSEVGGVVSIVSVISAASSSGLTH----LLWLTALISVNLGILNLLPIPAL 303

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           DGGH+I  L E+I  K+   +V   +T  G  ++L L  LG+ NDI+ L+
Sbjct: 304 DGGHIIFNLYEVIMRKAPSENVAYYLTLCGWAVLLGLMLLGLYNDIFRLL 353


>gi|324327717|gb|ADY22977.1| membrane-associated zinc metalloprotease, putative [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 420

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  E++L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKELTLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|206900570|ref|YP_002250511.1| membrane-associated zinc metalloprotease, putative [Dictyoglomus
           thermophilum H-6-12]
 gi|206739673|gb|ACI18731.1| membrane-associated zinc metalloprotease, putative [Dictyoglomus
           thermophilum H-6-12]
          Length = 348

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 98/332 (29%), Positives = 167/332 (50%), Gaps = 45/332 (13%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-------- 72
           HEFGH++ A++  ++V  +++GFGP+++ I  +   R+ + LIP+GG+V  +        
Sbjct: 17  HEFGHFIFAKIFGVKVYEYAIGFGPKILEIKGKE-TRFVLRLIPIGGFVKMAGVDDINLP 75

Query: 73  --EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP--VVSNVSPA 128
             E+  + R F+  APW++ L + AG   N V AI+ F    +  G+ +P  VV  V   
Sbjct: 76  EFEEVPENRRFYRKAPWQRFLILFAGSFMNFVFAIILFISI-FLIGIPQPIPVVDKVLEN 134

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR------ENPLHE--ISLVLYREHVGVL 180
            PA++AG+  GD ++ ++G      E+++  VR      + P  E  I + L R+   +L
Sbjct: 135 KPASMAGIMPGDRLLYING---QKIEDISDAVRLITGSIKAPGEEKFIEVTLERDG-NIL 190

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL----DEISSITR 236
             +V P   +       +R+   +GI F   +T     ++  S   G+    + +  I  
Sbjct: 191 TFRVKPEWSE-------ERKGGVIGIVF---KTVPKKYSLPASVKNGILMFVNALLLIFY 240

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
            F  + S A G       I+GP+GIA++       G   Y+ F+A+ S  IG  NLLPIP
Sbjct: 241 VFKALFSGAQGVS-----ITGPIGIAKMTGEVASMGLIYYLNFIALLSVQIGIFNLLPIP 295

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMG 328
            LDGG ++  ++E +RGK +  S   +I  +G
Sbjct: 296 ALDGGRILFIIIEKVRGKPIETSKEEIIHWVG 327


>gi|255656107|ref|ZP_05401516.1| putative membrane-associated protease [Clostridium difficile
           QCD-23m63]
 gi|296450462|ref|ZP_06892218.1| RIP metalloprotease RseP [Clostridium difficile NAP08]
 gi|296879414|ref|ZP_06903408.1| RIP metalloprotease RseP [Clostridium difficile NAP07]
 gi|296260723|gb|EFH07562.1| RIP metalloprotease RseP [Clostridium difficile NAP08]
 gi|296429560|gb|EFH15413.1| RIP metalloprotease RseP [Clostridium difficile NAP07]
          Length = 334

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/339 (27%), Positives = 167/339 (49%), Gaps = 21/339 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
           IIV+IHE GH++ A+   I+V  FS+G GP++  +  +    + +  +P+GGYVS   ED
Sbjct: 12  IIVLIHELGHFIFAKRSGIKVNEFSIGMGPKIYSV--KKDTEYSIRALPIGGYVSMEGED 69

Query: 75  EKDM--RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E+ +   SF   +  ++  T++AGP+ N ++A +     F   G     +  + P +PA 
Sbjct: 70  EEQISPNSFGNKSILQRFSTIVAGPIFNIILAAILLVPVFLYIGSPTTKLGKIMPDTPAQ 129

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
             G++ GD I  ++G +V  ++EVA  +  +   E+ L + R+    + + V P+  +  
Sbjct: 130 AVGLQVGDKINKINGNSVKTWDEVANIINTSSGGELKLSITRDGSDKV-VNVTPKNNNGK 188

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
              GI+ Q             K    +++ +    +D    +   FLG + +        
Sbjct: 189 YEIGIQPQ-----------REKDFWGSIVNACKTTVDMTKQMLT-FLGQMITGRVPGGIG 236

Query: 253 NQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIR 312
           N ++GPVG+  +  +    G    +   A+ S  +G +NLLPIP LDG  ++  LLE +R
Sbjct: 237 NAVAGPVGVIGMVSDAARTGIINVVYLAAVISLNLGIVNLLPIPALDGWRILMLLLEAVR 296

Query: 313 -GKSLGVSVTRVITRMGL-CIILFLFFLGIRNDIYGLMQ 349
            GK L  +   +I  +G   ++LF+ F+  + DI  L Q
Sbjct: 297 GGKKLDPNKEGMINVVGFGALMLFMLFITYK-DILRLFQ 334


>gi|301055310|ref|YP_003793521.1| putative membrane-associated zincmetalloprotease [Bacillus
           anthracis CI]
 gi|300377479|gb|ADK06383.1| putative membrane-associated zincmetalloprotease [Bacillus cereus
           biovar anthracis str. CI]
          Length = 418

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 158 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 217

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  E++L + R+     ++KV P    T+D+ G
Sbjct: 218 KENDTIQAIDGKNTSTWKDVVTIVRENPNKELTLQVKRDSEQ-FNVKVTP----TLDKEG 272

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 273 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 325

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 326 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 385

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 386 DRQKEGMVHFIGFALLMLLMLVVTWNDI 413



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 14 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 72

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 73 DTVEL---KPGKKVGLVL 87


>gi|52842543|ref|YP_096342.1| membrane associated zinc metalloprotease [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52629654|gb|AAU28395.1| membrane associated zinc metalloprotease [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 363

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 95/343 (27%), Positives = 167/343 (48%), Gaps = 25/343 (7%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++LI+++ IHE GH + ARL  +++   S+GFG  LI   ++SG  W  ++ PLGGYV  
Sbjct: 16  LTLILVIGIHELGHALAARLFQVKISKISIGFGKPLIQWQTQSGCNWIWAMWPLGGYVQL 75

Query: 72  SEDE----KDMRSFFC--AAP-WKKILTVLAGPLANCVMAILFFTFFFY-NTGVMKPVVS 123
                   K   + +C    P W ++L +L+G +AN + A +     FY      +P + 
Sbjct: 76  LNSRISPVKPQENAYCFDKKPIWIRVLILLSGAIANLITAWIALVLVFYIGISYKQPQIQ 135

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA-PYVRENPLHEISLVLYREHVGVLHL 182
           +V   S AA AG++ GD  ++++     +++ V    V      ++ +VL + +  +  L
Sbjct: 136 SVKLDSLAAKAGIQAGDQWVAIENYPTDSWQGVGMQLVIHWGQKDVHIVLRQGNQQLKQL 195

Query: 183 KV-MPRLQDT------VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
            + + +++ T      ++  GIK  + +V     Y        ++L S  +   EI    
Sbjct: 196 NLDLSQIEFTSKDGSLLESLGIKPDLSAVSSLTRYP-------SLLASMQKAFAEIIHTM 248

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             F+ +L   F      + + GP+ I  ++      G   ++ F+A  S A+  +NL PI
Sbjct: 249 YFFIMILKQLFLGVIPFSILLGPLAIFSVSVASLTQGVIVFLLFIATLSLAVALVNLFPI 308

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
           P LDGG ++   +E IRGK + V+V  ++ R  L IILF   L
Sbjct: 309 PGLDGGSILYSFIEKIRGKPVSVAVEVLLHR--LMIILFCVLL 349


>gi|224419126|ref|ZP_03657132.1| putative integral membrane protein [Helicobacter canadensis MIT
           98-5491]
 gi|253828062|ref|ZP_04870947.1| putative protease [Helicobacter canadensis MIT 98-5491]
 gi|313142633|ref|ZP_07804826.1| membrane-associated zinc metalloprotease [Helicobacter canadensis
           MIT 98-5491]
 gi|253511468|gb|EES90127.1| putative protease [Helicobacter canadensis MIT 98-5491]
 gi|313131664|gb|EFR49281.1| membrane-associated zinc metalloprotease [Helicobacter canadensis
           MIT 98-5491]
          Length = 356

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 100/355 (28%), Positives = 175/355 (49%), Gaps = 32/355 (9%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L  +V  HE GH++ A+L  ++V +FS+GFG + +         + +  IPLGG+V    
Sbjct: 10  LAFLVFFHELGHFLAAKLFGVKVEAFSIGFGSQKLWKKQIGETEYSLRPIPLGGFVQLKG 69

Query: 74  D----------EKDMRSFFCAAPWKKILTVLAGPLANCVMAIL-FFTFFFYNTGVMKPVV 122
                      EKD  S +  A +K+++ + AG   N  +A L +          + PV+
Sbjct: 70  QSDIDPKNRNYEKD--SLYGIATYKRLVILAAGSFFNLFLAFLLYIAIALMGQNELAPVI 127

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
             V    PA+ AG++ GD I++++G ++  ++++   V E+ + E+ +   R+   V   
Sbjct: 128 GKVQEDMPASKAGLQAGDEIVAINGESIKTWDKLNRVV-ESSVGELEVTFLRDS-QVQTA 185

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQS----FSRGLDEISSITRGF 238
            ++P+L  + + FG +   P +GI  + +E +  S + L+S    FS+ L   + I +G 
Sbjct: 186 ILIPKLGQSKNIFGEEISRPLIGI-IAANEIRKISYSPLESIPYAFSQTLQASTLILQGL 244

Query: 239 ----LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
               LGV+          +++ G V I  I K   + G    + F A+ S  +G +NLLP
Sbjct: 245 EKIILGVVP--------FSEVGGVVSIVSITKKATELGIVTLLTFTALISVNLGILNLLP 296

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           IP LDGGH++  L EMI  K   ++    +T  G  ++  L  LG+ ND+  +M 
Sbjct: 297 IPALDGGHIVFTLYEMITKKIPSLNAIYRLTLAGWVVLFGLMGLGLYNDVMRIMN 351


>gi|168043020|ref|XP_001773984.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162674669|gb|EDQ61174.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 387

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 168/357 (47%), Gaps = 29/357 (8%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L  IV +HE GH++ ARL  I V  F++GFGP +    S++ V + +  +PLGGYV F +
Sbjct: 36  LAAIVTVHEAGHFLAARLQGIHVTQFAIGFGPPIAKFKSKN-VEYSLRAVPLGGYVGFPD 94

Query: 74  DE-------KDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP------ 120
           D+        D       +  ++ L + AG +AN + A           G+++       
Sbjct: 95  DDPESVYEPDDPDLLKNRSIPERALVISAGVIANIIFAYTVLFGQVVTVGLLEQEFLPGV 154

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFE----EVAPYVRENPLHEISLVLYREH 176
           V+  ++P S AA+AG++ GD +  ++G  +   E    ++   +++NP  +++ ++ R  
Sbjct: 155 VIHVINPNSAAALAGIEPGDVVAGVNGHLLGTREASVRDLLQTIKDNPQKKLNFLVIRNG 214

Query: 177 VGVLHLKVMP-RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS-I 234
             +++L V P R +D   R G++    S             S    + F+R L  ++  +
Sbjct: 215 SELVNLDVTPNRAKDGGGRIGVQLSANSKTKRVKAANLADASLKATKEFTRLLTVVTDGL 274

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
            + FL    +A       +++SGPV I         +       F A+ +  +  +NLLP
Sbjct: 275 KQVFLNFAQTA-------DKLSGPVAILAAGAEVARNDIAGLFQFAAIVNINLAVVNLLP 327

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI--YGLMQ 349
           +P LDGG+L    LE +RGK L   V + I   G  ++L +  + I  D    G+MQ
Sbjct: 328 LPALDGGYLFLIALEALRGKKLPEGVEQGIMSSGFLLLLAVGIVLIVRDTLNLGIMQ 384


>gi|323705408|ref|ZP_08116983.1| membrane-associated zinc metalloprotease [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535310|gb|EGB25086.1| membrane-associated zinc metalloprotease [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 338

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 155/333 (46%), Gaps = 20/333 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
           I+V IHEFGH++VA+L   +V  F++GFGP++          +   L+  GG+ + + ED
Sbjct: 15  ILVTIHEFGHFIVAKLSGTKVNEFAIGFGPKIFS-KKHGETEYSFRLMLFGGFCALAGED 73

Query: 75  E--KDMRSFFCAAPWKKILTVLA-GPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPA 131
           E   D R+     PW   L + A GPL N ++  +     FY  G   P+VS+     PA
Sbjct: 74  EMSNDKRAV-TNKPWYTRLGIFAAGPLMNILLTFIILIMVFYFVGSPVPIVSSTISGYPA 132

Query: 132 AIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDT 191
             AG+K GD I+ ++   ++ +  +   +  N   +++  + R +V  L   V+P     
Sbjct: 133 EKAGIKPGDEIVMVNNTKINDWTTLQNIINSNNGVKLNFTIKRGNV-TLKKSVIP----I 187

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
           VD+   K   P +GI   Y       R+++ +   G+ +    ++  +  L         
Sbjct: 188 VDKNTAK---PMIGIVPQY------RRSLVLAVDSGVKQTIYFSKMIILSLYMLITGKVS 238

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
            N + GPVGI +        G    +AF A+ S  +G  NLLP P LDGG ++  L+E I
Sbjct: 239 TNDLMGPVGIVQAIGTEAKSGILNLMAFTALISVNLGLFNLLPFPALDGGRILFVLIEKI 298

Query: 312 RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           RGK +       +  +G  +++ L       D+
Sbjct: 299 RGKPVDPEKEGFVHYIGFMLLIALILFATYKDL 331


>gi|148656722|ref|YP_001276927.1| peptidase M50 [Roseiflexus sp. RS-1]
 gi|148568832|gb|ABQ90977.1| peptidase M50 [Roseiflexus sp. RS-1]
          Length = 392

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/308 (30%), Positives = 152/308 (49%), Gaps = 22/308 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GH++ A    I+V  F +G+ P  + +  R+GV++ ++ +P+GG+V FS +   +  
Sbjct: 47  HELGHFLTAVWFGIKVEEFGLGYPPRAMVLFERNGVKYTLNWLPIGGFVRFSGEGDQIYG 106

Query: 79  -RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV----VSNVSPASPAAI 133
             S   A+PWKKI+ + AGPL N ++A   F+  F   G+        +  V P +PA  
Sbjct: 107 VGSLATASPWKKIVVLFAGPLMNLLLAFAIFSAIFMARGIPAAFDGARIDVVYPGTPAER 166

Query: 134 AGVKKGDCIISLDGITV-SAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
           AG++ GD ++SL G  + +   E+     EN    I  V+ R+   V+ L V P      
Sbjct: 167 AGLRSGDLLLSLAGRPLRTDLSEIRQIAAENRGRPIEAVVERDGARVI-LVVTP---GRW 222

Query: 193 DRFGIKRQVPSVGISFSY-DETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
           +R G+   V   G  F+Y    ++   T+ Q+ + G      I   F+G +    G    
Sbjct: 223 ERDGV---VYENGFGFAYAPNMQIVPATLPQALTTGFSYTFEILGRFIGGIGQMLGSLLG 279

Query: 252 LNQ-----ISGPVGIARIAKNFFDH-GFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLIT 305
           L Q     ++G VGIAR         G+  +  + A+ S  +  +NLLPIP LDG H++ 
Sbjct: 280 LTQAPPGGVAGVVGIARGTGEVLQRDGWIGFWQWTALISLNLFLINLLPIPALDGSHILF 339

Query: 306 FLLEMIRG 313
            L+E+ RG
Sbjct: 340 ALIEIARG 347


>gi|317180063|dbj|BAJ57849.1| hypothetical protein HPF32_0267 [Helicobacter pylori F32]
          Length = 351

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 179/358 (50%), Gaps = 25/358 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSF----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV            +E  ++  S+   +P++K+  +  G   N + AIL + FF   +G
Sbjct: 62  GYVKLKGMDKEENGTNETHQENDSYAQKSPFQKLWILFGGAFFNFLFAILVY-FFLALSG 120

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + R
Sbjct: 121 EKVLLPVIGDLD--KNALEAGLLKGDKILSINHEKIASFREIRSVVARSQ-GELVLEIER 177

Query: 175 EHVGVLHLKVMPRL----QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
            H  +L  ++ P++     D+ D   + R   ++GI     +T + S ++ Q+F + L  
Sbjct: 178 NH-QILEKRLTPKIVAVISDSNDPNEMIRY-KAIGIKPDMQKTGVISYSLFQAFEKALSR 235

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
                      L         + ++SG VGI     +      +  + F A  S  +G +
Sbjct: 236 FKEGVVLIADSLRRLIMGSASVKELSGVVGIVGALSH--ASSVSMLLLFGAFLSINLGIL 293

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NLLPIP LDG  ++  + + I   +L V +   +   G+ +++F+ FLG+ NDI  L+
Sbjct: 294 NLLPIPALDGAQMLGVVFKNIFKITLPVFMQNALWLAGVGLLVFIMFLGLFNDITRLL 351


>gi|325282606|ref|YP_004255147.1| peptidase M50 [Deinococcus proteolyticus MRP]
 gi|324314415|gb|ADY25530.1| peptidase M50 [Deinococcus proteolyticus MRP]
          Length = 376

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 162/364 (44%), Gaps = 50/364 (13%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS- 72
           L +I  +HE GHY  AR  +++V SFSVG GP L+    R G  W++SL+P+GGYV    
Sbjct: 23  LSVITALHELGHYWAARKQSVKVDSFSVGMGPVLLRRQWR-GTEWRLSLLPIGGYVQIDG 81

Query: 73  ---EDEKD------MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM---KP 120
              E+  D         F    P  +I  +LAGPL N ++AI   T  F   GV    + 
Sbjct: 82  MAPEEAPDGTLRHPSTGFAALPPLGRIGVLLAGPLVNLLLAIGLMTATFSALGVTANDRV 141

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
            V  V   SPA   G++ GD I++LDG  +    E+A   +  P + +   L +E  G  
Sbjct: 142 RVGEVIAGSPAERLGLRAGDDIVALDGQDIPEQAEIA--GKAGPGYLLLGELLKE-AGPH 198

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVL--------------QSFSR 226
            L        TV R G   Q     ++F +  T    R +L              Q+  R
Sbjct: 199 TL--------TVQRTGEAEQRQ---LAFDWTPTVNGERQLLGIRYGPGSQPVSVPQALGR 247

Query: 227 GLDEISS----ITRGFLGVLSSAFGKDTR---LNQISGPVGIARIAKNFFDHGFNAYIAF 279
            L   +     +   F G+L   F  D +    + + GP+ I             A +  
Sbjct: 248 SLQTTAEAVPLVVNSFAGLLGEMFSLDLKGEETDDVGGPIRITETVSRAAALNGWALVQI 307

Query: 280 LAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMG-LCIILFLFFL 338
             + + ++   NLLPIP LDGG +   L+EM+RG+ L     + +T  G L ++L + F+
Sbjct: 308 ATLLNLSLAVFNLLPIPGLDGGRIALVLIEMLRGRPLTFQQEQSVTAAGFLFVMLLMAFV 367

Query: 339 GIRN 342
            +R+
Sbjct: 368 LVRD 371


>gi|109947859|ref|YP_665087.1| zinc metalloprotease [Helicobacter acinonychis str. Sheeba]
 gi|109715080|emb|CAK00088.1| zinc metalloprotease [Helicobacter acinonychis str. Sheeba]
          Length = 347

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 108/357 (30%), Positives = 183/357 (51%), Gaps = 40/357 (11%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF-- 71
           L  ++ +HE GH+ +ARLC ++V  FS+GFG +L         ++ +SLIPLGGYV    
Sbjct: 9   LAFLIFVHELGHFTIARLCGVKVEVFSIGFGKKL-WFFRLFDTQFALSLIPLGGYVKLKG 67

Query: 72  -SEDEKDMR----SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSN 124
             ++E D+     S+   +P +K+  +L G   N + AIL + FF   +G  V+ PV+ +
Sbjct: 68  MDKEESDINEGSDSYVQKSPSQKLWILLGGAFFNFLFAILVY-FFLALSGEKVLLPVIGD 126

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           +   + A  AG+ KGD I+S++   + +F E+   V  +   E+ L + R +  +L  ++
Sbjct: 127 LE--NNALEAGLLKGDKILSINHKKIVSFREIRGIVVRSQ-GELVLEIERNN-QILEKRL 182

Query: 185 MPR----LQDTVD--------RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI- 231
            P+    L D+ D          GIK  +  +G+  SY   +   + ++Q F  G D I 
Sbjct: 183 TPKIVAMLSDSNDPNEMIQYKAIGIKPDMQKIGV-VSYSLFQAFKKALIQ-FKEGADLII 240

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
            S+ R  +G         T   ++SG VGI     +   + F+A + F A  S  +G +N
Sbjct: 241 DSLKRLIIG--------STSAKELSGVVGIVGALSH--ANSFHALLLFGAFLSINLGVLN 290

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDG  ++  + + I   +L V +   +  +G+  ++F+ FLG+ NDI  L+
Sbjct: 291 LLPIPALDGAQILGVIFKSIFNITLPVIMQNALWLVGVGFLVFVMFLGLFNDITRLL 347


>gi|57242164|ref|ZP_00370104.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           upsaliensis RM3195]
 gi|57017356|gb|EAL54137.1| membrane-associated zinc metalloprotease, putative [Campylobacter
           upsaliensis RM3195]
          Length = 368

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 97/344 (28%), Positives = 162/344 (47%), Gaps = 19/344 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           ++  HE GH++ A+   +RV  FS+GFG  L     ++  ++++S +PLGGYV     + 
Sbjct: 32  LIFFHELGHFLAAKSLGVRVEIFSIGFGKALFEKEFKN-TKYRLSALPLGGYVKLKGQDD 90

Query: 77  --------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV--VSNVS 126
                   D  S+     W+KI  + AGP  N  +A L +     N G+ K    +  ++
Sbjct: 91  LNPALRNYDKDSYGSLHAWQKIYILFAGPFFNLFLAFLLY-IAIANLGLEKASAKIGFIA 149

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
           P S A   G+ +GD I S++GI + +F+E+   +  N L    + + RE    L+L + P
Sbjct: 150 PNSAAQEIGLLEGDIIKSINGIKIQSFDEIPALLTPNAL---IIEIQREEKN-LNLLITP 205

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLH-SRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           +     + FG  + VP + +  +    ++  S T LQS S  LDE    +   +  L   
Sbjct: 206 KTGQGYNEFG--QIVPKLQLGIASSNERISVSYTGLQSLSYALDESIKASTLIIKGLFKL 263

Query: 246 FGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLIT 305
              D     + G + +  I     +   +  +   A+ S  +G +NLLPIPILDGGH++ 
Sbjct: 264 ITGDIEAKNLGGIITMVDITSKAAEISLSWLLFITALISINLGILNLLPIPILDGGHILF 323

Query: 306 FLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
            L  +I  K +       ++  G+ ++L L      NDI  LMQ
Sbjct: 324 NLYSLIFKKEVPQKAFEYLSYSGMALLLSLMLFATLNDIIRLMQ 367


>gi|54298223|ref|YP_124592.1| hypothetical protein lpp2281 [Legionella pneumophila str. Paris]
 gi|53752008|emb|CAH13434.1| hypothetical protein lpp2281 [Legionella pneumophila str. Paris]
          Length = 355

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/343 (27%), Positives = 165/343 (48%), Gaps = 25/343 (7%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71
           ++LI+++ IHE GH + ARL  +++   S+GFG  LI   ++SG  W  ++ PLGGYV  
Sbjct: 8   LTLILVIGIHELGHALAARLFQVKISKISIGFGKPLIQWQTQSGCNWIWAMWPLGGYVQL 67

Query: 72  SEDE----KDMRSFFC--AAP-WKKILTVLAGPLANCVMAILFFTFFFY-NTGVMKPVVS 123
                   K   + +C    P W ++L +L+G +AN + A +     FY      +P + 
Sbjct: 68  LNSRISPVKPQENAYCFDKKPIWIRVLILLSGAIANLITAWIALVLVFYIGISYKQPQIQ 127

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA-----PYVRENP---LHEISLVLYRE 175
           +V   S AA AG++ GD  +S++     +++ V       + ++N    L + +  L + 
Sbjct: 128 SVKLDSLAAKAGIQAGDQWVSVENYPTDSWQGVGMQLVIHWGQKNVHIVLRQANQQLKQL 187

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
            + +  ++   +    ++  GIK  +  V     Y        ++L S  +   EI    
Sbjct: 188 SLDLSQIEFTSKDGSLLESLGIKPDLSVVSSLTRYP-------SLLASMQKAFAEIIHTM 240

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             F+ +L   F      + + GP+ I  ++      G   ++ F+A  S A+  +NL PI
Sbjct: 241 YFFIMILKQLFLGVIPFSILLGPLAIFSVSVASLTQGVIVFLLFIATLSLAVALVNLFPI 300

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338
           P LDGG ++  ++E IRGK + V+V  ++ R  L IILF   L
Sbjct: 301 PGLDGGSILYSVIEKIRGKPVSVAVEVLLHR--LMIILFCVLL 341


>gi|317179347|dbj|BAJ57135.1| hypothetical protein HPF30_1038 [Helicobacter pylori F30]
          Length = 351

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 96/358 (26%), Positives = 175/358 (48%), Gaps = 25/358 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSF----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV            +E  ++  S+   +P+KK+  +  G   N + AIL   +FF   G
Sbjct: 62  GYVKLKGMDKEENETNETNQENDSYVQKSPFKKLWILFGGAFFNFLFAIL--VYFFLALG 119

Query: 117 ---VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + 
Sbjct: 120 GEKVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVVV-HARGELVLEIE 176

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDE 230
           R H  +L  ++ P++   +       ++     +GI     +T + S ++ Q+F + L  
Sbjct: 177 RNH-QILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVVSYSLFQAFEQALSR 235

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
                      L     +   + ++SG VGI     +      +  + F A  S  +G +
Sbjct: 236 FKEGVVLIADSLRRLITRSASVKELSGVVGIVGALSH--ASSLSMLLLFGAFLSINLGIL 293

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NLLPIP LDG  ++  + + I   +L   +   +   G+ +++F+ FLG+ NDI  L+
Sbjct: 294 NLLPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGLLVFIMFLGLFNDITRLL 351


>gi|229162756|ref|ZP_04290713.1| Zinc metalloprotease rasP [Bacillus cereus R309803]
 gi|228620638|gb|EEK77507.1| Zinc metalloprotease rasP [Bacillus cereus R309803]
          Length = 420

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I +++G   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAINGKNTSTWKDVVTIVRENPNKEITLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEVGRIGVYSPVE------KTVMGSIKSGFEQTYQWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|302788122|ref|XP_002975830.1| hypothetical protein SELMODRAFT_175165 [Selaginella moellendorffii]
 gi|300156106|gb|EFJ22735.1| hypothetical protein SELMODRAFT_175165 [Selaginella moellendorffii]
          Length = 413

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 101/345 (29%), Positives = 157/345 (45%), Gaps = 65/345 (18%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +I+++HE GH++ ARL NI V  FS+GFGP+L     R  V + V  IPLGGYV F +
Sbjct: 93  LTVIILVHEAGHFLAARLQNIHVSQFSIGFGPKL-ATFQRKEVEYSVRAIPLGGYVGFPD 151

Query: 74  DEKDMRSFFCAAP--------WKKILTVLAGPLANCVMAILFFTFFFYNT---GVMKP-- 120
           D  D   F    P          ++L + AG  AN V A   +T  F  T   G+++   
Sbjct: 152 DNPD-SEFSPEDPDLLKNRPILDRVLVMSAGVFANIVFA---YTLLFTQTLTVGLLQQKI 207

Query: 121 ----VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFE----EVAPYVRENPLHEISLVL 172
               VV  V  +S AA AGV+  D I++LDG  V + E    ++   +++ P  +I ++L
Sbjct: 208 LPGVVVPEVYASSAAARAGVRPADVILALDGQEVRSDERSVMQIVDVIKQRPGKKIQMLL 267

Query: 173 YREHVGVLHLKVMP-RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
            R    V  + + P R +D   R G++                + +  V+ +F++  D  
Sbjct: 268 QRRGEAV-TVDIFPDRSKDGYGRIGVQL------------SPNIQTFRVVVNFAQTAD-- 312

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
                                 ++SGPV I  +              F A+ +  +  +N
Sbjct: 313 ----------------------KVSGPVAIVAVGAEVARSDVAGLFQFAALLNLNLAVVN 350

Query: 292 LLPIPILDGGHLITFLLEMIR-GKSLGVSVTRVITRMGLCIILFL 335
           +LP+P LDGG+L    LE +R GK L   + + I   G+ +IL L
Sbjct: 351 ILPLPALDGGYLALIALEALRGGKKLPDKIEQGIMSSGILLILAL 395


>gi|237752207|ref|ZP_04582687.1| membrane-associated zinc metalloprotease [Helicobacter winghamensis
           ATCC BAA-430]
 gi|229376449|gb|EEO26540.1| membrane-associated zinc metalloprotease [Helicobacter winghamensis
           ATCC BAA-430]
          Length = 356

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 148/304 (48%), Gaps = 12/304 (3%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED-- 74
           ++  HE GH++ A+   ++V +FS+GFG + +         + +  IPLGG+V       
Sbjct: 13  LIFFHELGHFLAAKFFGVKVEAFSIGFGKQRLWKKRIGDTEYSLRPIPLGGFVQLKGQSD 72

Query: 75  ------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF-FYNTGVMKPVVSNVSP 127
                   D  S +  A WK+++ + AG   N ++A L F          + P+V  V  
Sbjct: 73  IDPKLRNSDSDSLYGIAHWKRLVILAAGSFFNLLLAFLLFVAIGLIGKNELAPIVGKVES 132

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPR 187
             PA++AG+K GD I++++G  +  +  ++  + E+   E+ +V  RE+       + P+
Sbjct: 133 NMPASLAGLKSGDEIVAINGEKIRTWGNLSSAIAESK-GELEIVFLREN-KEYETTITPQ 190

Query: 188 LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFG 247
             ++ + FG   Q P +GI  S  E ++ S  +L S   GL E    ++  L  L     
Sbjct: 191 FGNSKNLFGESIQRPLLGIVAS-GEVRVVSYGILDSIFYGLKETKESSKLILQSLEKMLV 249

Query: 248 KDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFL 307
               L+++ G V I  I K   + G     AF A+ S  +G +NLLPIP LDGGH++  L
Sbjct: 250 GVVPLSEVGGVVSIVSITKKATELGIVTLFAFSALISVNLGILNLLPIPALDGGHILFTL 309

Query: 308 LEMI 311
            EMI
Sbjct: 310 YEMI 313


>gi|169830800|ref|YP_001716782.1| putative membrane-associated zinc metalloprotease [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169637644|gb|ACA59150.1| putative membrane-associated zinc metalloprotease [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 339

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 93/312 (29%), Positives = 149/312 (47%), Gaps = 33/312 (10%)

Query: 8   LLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +L  V++I++    + IHE GH++VA+   I V  F++GFGP L GI  R    + +  +
Sbjct: 1   MLTVVAVIVVFGLLIFIHELGHFLVAKRAGILVHEFALGFGPRLAGI-RRGETEYTLRAV 59

Query: 64  PLGGYVSFS-----EDEKD-MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV 117
           PLGG+V F+     E+E D  RS+   +  +++  + AGPLAN  +AI+     F   G+
Sbjct: 60  PLGGFVRFAGMDPKEEEYDPARSYRYKSVRQRMGVIAAGPLANFFLAIVLLAVIFMVQGL 119

Query: 118 MKP--VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
             P  VV  V P  PAA AG+++GD I+++DG  V  +E++   +   P   + L + RE
Sbjct: 120 PTPTTVVKTVLPDRPAAAAGLQQGDRIVAVDGRQVGNWEQLVTEISTRPGETLILTVERE 179

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD---EIS 232
               L L V+P  +  V + G    +  V +               ++ + G+    +I+
Sbjct: 180 GE-RLDLPVVPENESGVGKIGFAPDIQPVRVGL------------FKALAGGVQYTVQIT 226

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
            +   FLG + +          + GPV I          G    +   A  S  +G  NL
Sbjct: 227 LLIVSFLGQMITGHAP----ADVGGPVRIVAEIGTAAQLGLMPLLQLAAFLSINVGLFNL 282

Query: 293 LPIPILDGGHLI 304
           LPIP LDG  L+
Sbjct: 283 LPIPALDGSRLM 294


>gi|113476792|ref|YP_722853.1| hypothetical protein Tery_3268 [Trichodesmium erythraeum IMS101]
 gi|110167840|gb|ABG52380.1| YUP8H12.25 {{Arabidopsis thaliana}}-type protein. Metallo
           peptidase. MEROPS family M50B [Trichodesmium erythraeum
           IMS101]
          Length = 364

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 103/346 (29%), Positives = 162/346 (46%), Gaps = 38/346 (10%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             LL    L I++V+HE GH+M ARL NI V  FS+GFGP +I         + +   PL
Sbjct: 2   SVLLAIAVLGILIVVHELGHFMAARLQNIHVNRFSIGFGP-VIWKYQGPQTEYALRGFPL 60

Query: 66  GGYVSFSEDE------KDMRSFFCAAP-WKKILTVLAGPLANCVMA---------ILFFT 109
           GG+V F +D+      KD        P   + + + AG +AN + A         I+   
Sbjct: 61  GGFVGFPDDDPDSKIPKDDPDLLRNRPILDRAIVLSAGVIANLIFAYFLLVTQVGIIGVA 120

Query: 110 FFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLD----GITVSAFEEVAPYVRENPL 165
            F Y  GV  P V+  S +S AA AG+K  D I+S+D    G    A   +   ++ NP 
Sbjct: 121 DFNYAPGVKVPEVA-TSVSSAAARAGIKANDIILSVDNQQLGANKKAISTLVATIQNNPN 179

Query: 166 HEISLVLYREHVGVLHLKVMPRL-QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSF 224
             + + + R+   +  L+V P L  D+  R G+  Q+ S G    Y      ++ V ++ 
Sbjct: 180 RTLKMEIQRQEEKIF-LEVTPELGDDSKGRIGV--QLISNGEIVRY-----PTKNVFKAL 231

Query: 225 SRGLDEISSIT----RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL 280
           S G +E   I     RGF  ++S+ F +     +++GPV I  +              F 
Sbjct: 232 SIGAEEFQKIVILTVRGFWQLISN-FSQTA--GKLAGPVAIVDMGAKIAQDNVGELFKFG 288

Query: 281 AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITR 326
           A+ S  +  +N+LP+P LDGG L   ++E +RGK L + +   + +
Sbjct: 289 ALISINLAVINILPLPALDGGQLAFLVIEGVRGKPLPLRIQENVMQ 334


>gi|317967930|ref|ZP_07969320.1| membrane-associated Zn-dependent protease [Synechococcus sp.
           CB0205]
          Length = 362

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 97/325 (29%), Positives = 159/325 (48%), Gaps = 40/325 (12%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           ++V+HE GH+  A    IRV  FSVGFGP L+    R GV++ +  IPLGG+VSF +D++
Sbjct: 13  LIVVHEAGHFFAATWQGIRVSGFSVGFGPVLL-QKQRRGVQFALRAIPLGGFVSFPDDDE 71

Query: 77  DMR------SFFCAAPW-KKILTVLAGPLANCVMA----------ILFFTFFFYNTGVMK 119
           D              P  ++ L + AG +AN ++A          +     F    GV+ 
Sbjct: 72  DSSIPSDDPDLLTNRPLPQRALVIAAGVIANLLLAWAVLMAQGAFVGIPAGFSATPGVL- 130

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITV----SAFEEVAPYVRENPLHEISLVLYRE 175
             VS V     AA +G+K GD I+++DG  +    SA  ++   V+ +P   + L   R+
Sbjct: 131 --VSGVQQGQAAAASGLKAGDRILAVDGRDLGGGQSAVSQLVELVKGSPDQTLRLQAERQ 188

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
               L L++ P     + R G + Q PS   +F         R+ ++   +   +++ +T
Sbjct: 189 GQ-ALELQLTPADLSGIGRIGAQLQ-PSGTEAFR------RPRSPIEVIQQANHDVALLT 240

Query: 236 R----GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
           +    GF+  L + FG+     Q+SGPV I  +  +    G ++   + A+ S  +  +N
Sbjct: 241 KRTVDGFV-TLVTHFGETA--GQVSGPVKIVEMGASLAKQGGSSLFLYTALISINLAVLN 297

Query: 292 LLPIPILDGGHLITFLLEMIRGKSL 316
            LP+P+LDGG  +  LLE +R K L
Sbjct: 298 ALPLPMLDGGQFVLLLLEGLRRKPL 322


>gi|315638124|ref|ZP_07893307.1| membrane protein [Campylobacter upsaliensis JV21]
 gi|315481804|gb|EFU72425.1| membrane protein [Campylobacter upsaliensis JV21]
          Length = 368

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 96/344 (27%), Positives = 162/344 (47%), Gaps = 19/344 (5%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           ++  HE GH++ A+   +RV  FS+GFG  L     ++  ++++S +PLGGYV     + 
Sbjct: 32  LIFFHELGHFLAAKSLGVRVEIFSIGFGKALFEKEFKN-TKYRLSALPLGGYVKLKGQDD 90

Query: 77  --------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV--VSNVS 126
                   D  S+     W+KI  + AGP  N  +A L +     N G+ K    +  ++
Sbjct: 91  LNPALRNYDKDSYGSLHAWQKIYILFAGPFFNLFLAFLLY-IAIANLGLEKASAKIGFIA 149

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMP 186
           P S A   G+ +GD I S++G+ + +F+E+   +  N L    + + RE    L+L + P
Sbjct: 150 PNSAAQEIGLLEGDIIKSINGVKIQSFDEIPALLTPNAL---IIEIQREEKN-LNLLITP 205

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLH-SRTVLQSFSRGLDEISSITRGFLGVLSSA 245
           +     + FG  + VP + +  +    K+  S T LQS S  LDE    +   +  L   
Sbjct: 206 KTGQGYNEFG--QIVPKLQLGIAPSNEKISVSYTGLQSLSYALDESIKASTLIIKGLFKL 263

Query: 246 FGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLIT 305
              D     + G + +  I     +   +  +   A+ S  +G +NLLPIP+LDGGH++ 
Sbjct: 264 IAGDIEAKNLGGIITMVDITSKAAEISLSWLLFITALISINLGILNLLPIPMLDGGHILF 323

Query: 306 FLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
            L  +I  K +       ++  G+ ++L L      NDI  LMQ
Sbjct: 324 NLYSLIFKKEVPQKAFEYLSYSGMALLLSLMLFATFNDIIRLMQ 367


>gi|289523067|ref|ZP_06439921.1| RIP metalloprotease RseP [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503610|gb|EFD24774.1| RIP metalloprotease RseP [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 345

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 98/349 (28%), Positives = 166/349 (47%), Gaps = 30/349 (8%)

Query: 12  VSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKVSLIPLG 66
           VS II+    VV HEFGH++ ARL  ++V  F+ G GP +     R G   W +   P+G
Sbjct: 5   VSFIIVIGVCVVSHEFGHFISARLLGVQVHEFAFGMGPAI--YRKRKGETLWSIRAFPIG 62

Query: 67  GYVSFS--------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM 118
           G+V  +        E E   RSF   +P ++ L + AG + N ++AI+  T F +  GV+
Sbjct: 63  GFVRLAGMGEAVEGEVEDPERSFSAKSPARRWLILAAGSIINILLAIVIATLFLWGHGVL 122

Query: 119 K---PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
                 +  + P  PA   G+  GD I+S++   V+ + E+A  ++ N  + +++ + R 
Sbjct: 123 DMEHARIGELMPGYPAESIGLLPGDTIVSINDKKVTTWLEMATTLKSNADNPVTIEVERP 182

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
            VG L  + +    D V    I        +     + K    + +Q   + L E++   
Sbjct: 183 EVGRLVFRNVLLKPDPVTGAYI--------LGIKPGQIKYEGLSAIQYSLKYLWEMTKNI 234

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             F  +++ A G       ++GPVGIA +A      G   ++ FL + +  +G  NL+P 
Sbjct: 235 --FSALVNWALGGQKI--DVTGPVGIAEMAGEAAKSGVWTFLFFLGIINLNLGLFNLIPF 290

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           P LDGG L+   +EMI  K +   + + +  +G+ ++L L  L    DI
Sbjct: 291 PALDGGRLLFVTIEMIFRKKVPEYIEQKVHFIGMMVLLALIALITWQDI 339


>gi|261837704|gb|ACX97470.1| integral membrane protein [Helicobacter pylori 51]
          Length = 349

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 171/349 (48%), Gaps = 23/349 (6%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLGGYV    
Sbjct: 10  LAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLGGYVKLKG 68

Query: 74  DEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG---VMKPVV 122
            +K+          S+   +P+KK+  +  G   N + AIL   +FF   G   V+ PV+
Sbjct: 69  MDKEENETNESANDSYAQKSPFKKLWILFGGAFFNFLFAIL--VYFFLALGGEKVLLPVI 126

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
            ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + R H  +L  
Sbjct: 127 GDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVV-AHARGELVLEIERNH-QILEK 182

Query: 183 KVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL 239
           ++ P++   +       ++     +GI     +T + S ++ Q+F + L          +
Sbjct: 183 RLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTAVVSYSLFQAFEKALSRFKEGVVLIV 242

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
             L     +   + ++SG VGI     +      +  + F A  S  +G +NLLPIP LD
Sbjct: 243 DSLRRLITRSASVKELSGVVGIVGALSH--ASSLSMLLLFGAFLSINLGILNLLPIPALD 300

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           G  ++  + + I   +L   +   +   G+ +++F+ FLG+ NDI  L+
Sbjct: 301 GAQMLGVVFKNIFKITLPAFMQNALWLAGVGLLVFIMFLGLFNDITRLL 349


>gi|229013003|ref|ZP_04170168.1| Zinc metalloprotease rasP [Bacillus mycoides DSM 2048]
 gi|228748257|gb|EEL98117.1| Zinc metalloprotease rasP [Bacillus mycoides DSM 2048]
          Length = 420

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I +++G   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAINGKNTSTWKDVVTIVRENPNKEITLHVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYEWTKLIFDSLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|315586254|gb|ADU40635.1| RIP metalloprotease RseP [Helicobacter pylori 35A]
          Length = 349

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 174/356 (48%), Gaps = 23/356 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV     +K+          S+   +P+KK+  +  G   N + AIL   +FF   G  
Sbjct: 62  GYVKLKGMDKEENETNESANDSYAQKSPFKKLWILFGGAFFNFLFAIL--VYFFLALGGE 119

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
            V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + R 
Sbjct: 120 KVLLPVIGDLE--KNALEAGLLKGDKILSINHEKIASFREIRSVV-AHARGELVLEIERN 176

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
           H  +L  ++ P++   +       ++     +GI     +T + S ++ Q+F + L    
Sbjct: 177 H-QILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVVSYSLFQAFEKALSRFK 235

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
                    L       T + ++SG VGI     +      +  + F A  S  +G +NL
Sbjct: 236 EGVVLIADSLRRLIVGSTSVKELSGVVGIVGALSH--ADSLSMLLLFGAFLSINLGILNL 293

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIP LDG  ++  + + I   +L   +   +   G+ +++F+ FLG+ NDI  L+
Sbjct: 294 LPIPALDGAQMLGVVFKDIFKITLPAFMQNALWLAGVGLLVFIMFLGLFNDITRLL 349


>gi|163941558|ref|YP_001646442.1| putative membrane-associated zinc metalloprotease [Bacillus
           weihenstephanensis KBAB4]
 gi|163863755|gb|ABY44814.1| putative membrane-associated zinc metalloprotease [Bacillus
           weihenstephanensis KBAB4]
          Length = 418

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 158 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 217

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I +++G   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 218 KENDTIQAINGKNTSTWKDVVTIVRENPNKEITLHVKRDSEQ-FNVKVTP----TLDKEG 272

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 273 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYEWTKLIFDSLVKLVTGQFSINELS 325

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 326 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 385

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 386 DRQKEGMVHFIGFALLMLLMLVVTWNDI 413



 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 14 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 72

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 73 DTVEL---KPGKKVGLVL 87


>gi|239626439|ref|ZP_04669470.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239516585|gb|EEQ56451.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 349

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 90/312 (28%), Positives = 140/312 (44%), Gaps = 17/312 (5%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG---YVSFS 72
           II++IHEFGH++ A+L  I V+ FS+G GP  I    + G R+    +P GG    +   
Sbjct: 12  IIIMIHEFGHFLFAKLNGIGVIEFSLGMGPR-IWSCEKGGTRYSFKALPFGGSCMMLGED 70

Query: 73  EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E++ D  +F   + W +I  V AGP+ N ++A L         G     + +V+   PA 
Sbjct: 71  ENDSDEHAFNNKSVWARISVVAAGPVFNFILAFLLSLVLVGALGYNTTKLLSVTEGYPAQ 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
           +AG++ GD I S++G  V +F+E   Y+  +P  ++ L   R            R+    
Sbjct: 131 LAGLQAGDVITSVNGRKVHSFDEFKAYLFTHPQKDLDLTWRRTDPSGKEESYSARVTPIY 190

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRL 252
                 +   S  I   +D      +   +   +GL ++    +     LS        L
Sbjct: 191 -----VKDSGSYVIGVGFDAMPRAVQNPGELLVQGLYQVRFQIQYVFDTLSMMVRGMVSL 245

Query: 253 NQISGPVGIARIAKNFFDHGFNA--------YIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
           N ISGPVGI        D    A         +    + S  +G MNLLPIP LDGG L+
Sbjct: 246 NDISGPVGIVVEIDKTVDAVAPAGAMAIILMVVQLTVLLSANLGVMNLLPIPALDGGRLV 305

Query: 305 TFLLEMIRGKSL 316
             ++E +RGK +
Sbjct: 306 FLIIEALRGKPI 317


>gi|229061423|ref|ZP_04198768.1| Zinc metalloprotease rasP [Bacillus cereus AH603]
 gi|228717846|gb|EEL69494.1| Zinc metalloprotease rasP [Bacillus cereus AH603]
          Length = 420

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I +++G   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAINGKNTSTWKDVVTIVRENPNKEITLHVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYEWTKLIFDSLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|229134627|ref|ZP_04263437.1| Zinc metalloprotease rasP [Bacillus cereus BDRD-ST196]
 gi|228648888|gb|EEL04913.1| Zinc metalloprotease rasP [Bacillus cereus BDRD-ST196]
          Length = 420

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I +++G   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAINGKNTSTWKDVVTIVRENPNKEITLHVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYEWTKLIFDSLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|315453318|ref|YP_004073588.1| putative membrane-associated zinc metalloprotease [Helicobacter
           felis ATCC 49179]
 gi|315132370|emb|CBY82998.1| putative membrane-associated zinc metalloprotease [Helicobacter
           felis ATCC 49179]
          Length = 339

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 99/347 (28%), Positives = 174/347 (50%), Gaps = 16/347 (4%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           M WL       ++L  ++  HE GH++ AR+C + V  FS+GFG +L         ++ +
Sbjct: 1   MGWLASI----IALGFLIFFHELGHFVAARVCGVGVEVFSIGFGRKLWA-KHLGNTQYAL 55

Query: 61  SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLA-GPLANCVMAI-LFFTFFFYNTGVM 118
           S+IPLGGYV   E+  +    +   P+ K L +L+ GPL N ++A  ++          +
Sbjct: 56  SVIPLGGYVKLQENPIENPKSYPNQPFYKKLVILSMGPLFNLLLAFGIYLGVGLVGHASL 115

Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178
            PVV  ++P  PA  +G+K GD I+S++G  +  +E +   ++      I+L + R+ + 
Sbjct: 116 APVVGALAPEMPAIKSGIKVGDRIVSVNGTAIKDWESLYQAIQRTQ-GAITLQIQRDQL- 173

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGF 238
            LH+ + P L+ T + F    Q   +GI+ S ++  +     LQS  R   ++  +    
Sbjct: 174 -LHITLTPTLKTTQNAFKESVQTKLIGIAPSKEQIWIR-YGFLQSTQRAFGQLVDMCALI 231

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFN-AYIAFLAMFSWAIGFMNLLPIPI 297
              +   F     +++IS  VGI     +F  H  N A +  +A  S  +G +NLLPIP+
Sbjct: 232 FKGIEKLFIGVVSVSEISSVVGIV----DFMAHQQNLALLLSVAFISINLGVLNLLPIPV 287

Query: 298 LDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LDGG ++  L E +  + L       +  +G+ +++ L  LG+ ND+
Sbjct: 288 LDGGQMVIVLYESLTKRKLKSEHLEKLNLLGIALLIALMALGLFNDV 334


>gi|229168559|ref|ZP_04296282.1| Zinc metalloprotease rasP [Bacillus cereus AH621]
 gi|228614965|gb|EEK72067.1| Zinc metalloprotease rasP [Bacillus cereus AH621]
          Length = 420

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM--KPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I +++G   S +++V   VRENP  EI+L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAINGKNTSTWKDVVTIVRENPNKEITLHVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KDEVGRIGVYSPVE------KTVMGSIKSGFEQTYEWTKLIFDSLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|228986963|ref|ZP_04147089.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229197930|ref|ZP_04324646.1| Zinc metalloprotease rasP [Bacillus cereus m1293]
 gi|228585648|gb|EEK43750.1| Zinc metalloprotease rasP [Bacillus cereus m1293]
 gi|228772741|gb|EEM21181.1| Zinc metalloprotease rasP [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 420

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/268 (30%), Positives = 135/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F    +  GV   KP+V  V   S A  AG+
Sbjct: 160 RQFGSKKLGQRALTIFAGPAMNFILAFVIFVILGFVQGVPVDKPMVGKVMENSAAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   S +++V   VRENP  E++L + R+     ++KV P    T+D+ G
Sbjct: 220 KENDTIQAIDGKNTSTWKDVVTIVRENPNKELTLQVKRDSEQ-FNVKVTP----TLDKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K ++  +G+    +      +TV+ S   G ++    T+     L         +N++S
Sbjct: 275 -KEEIGRIGVYTPVE------KTVMGSIKSGFEQTYYWTKLIFESLVKLVTGQFSINELS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   +   A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFTRVLNLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH   A+   I    F++GFGP++        V + + L+PLGGYV  + ++ 
Sbjct: 16 LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTIRLLPLGGYVRMAGEDA 74

Query: 77 DMRSFFCAAPWKKILTVL 94
          D        P KK+  VL
Sbjct: 75 DTVEL---KPGKKVGLVL 89


>gi|160915166|ref|ZP_02077379.1| hypothetical protein EUBDOL_01174 [Eubacterium dolichum DSM 3991]
 gi|158432965|gb|EDP11254.1| hypothetical protein EUBDOL_01174 [Eubacterium dolichum DSM 3991]
          Length = 356

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 96/353 (27%), Positives = 170/353 (48%), Gaps = 37/353 (10%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +IV++HEFGH + A+   +    FS+G GP +I    +   +W +  +P+GG+V+ + 
Sbjct: 14  LSVIVIVHEFGHLIAAKKFGVYCKEFSIGMGP-VIWKRQKGETQWSIRALPIGGFVAMAG 72

Query: 74  DEKDMRSFFCAAP----------WKKILTVLAGPLANCVMA-ILFFTFFFYNTGVM---K 119
           ++++        P          WK+I+ + AG + N ++A +LF     Y   V+    
Sbjct: 73  EDEEGEEEKLEIPFERTIPGIKKWKQIVVMAAGAIMNVLLAWVLFIGVSAYQGQVVIDKG 132

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDG----ITVSAFEEVAPYVRENPLHEISLVLYRE 175
            VV + +   PA  AG++KGD I+ +       T++++ +V+ ++  N   E++L + R+
Sbjct: 133 AVVGDTAVGQPAEKAGIQKGDVIVEISQRDTHETINSWTDVSSFLLYNQ-GEVTLTIERD 191

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQVPSV-GISFSYDETKLHSRTVLQSFSRG-LDEISS 233
                      R+Q  +  +  K     + G++      ++   + L++   G L+    
Sbjct: 192 G---------NRMQVALTPYQDKETGGYLLGVTQGAGSYEVKDISFLEAVKYGTLEMFDG 242

Query: 234 ITRGF--LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
           +T  F  LG L    G    LN +SGPVGI +        G+ + IAF A+ S  +G  N
Sbjct: 243 MTTIFESLGKLLQGIG----LNNLSGPVGIYKATAEITQQGWISTIAFTALLSVNVGIFN 298

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LLPIPILDGG ++  +LE I  +         I  +GL +++ L      ND+
Sbjct: 299 LLPIPILDGGRILILVLETITRRKFSEKTQTAIMMVGLFMLIGLMVFATWNDL 351


>gi|166363027|ref|YP_001655300.1| putative zinc metalloprotease [Microcystis aeruginosa NIES-843]
 gi|166085400|dbj|BAG00108.1| putative zinc metalloprotease [Microcystis aeruginosa NIES-843]
          Length = 363

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 102/332 (30%), Positives = 166/332 (50%), Gaps = 46/332 (13%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +++V+HEFGH+  AR  +I V  FS+GFGP L     +    + +  IPLGGYV F +
Sbjct: 10  LALLIVVHEFGHFAAARWQSIHVNRFSIGFGPALAKYQGKE-TEYALRAIPLGGYVGFPD 68

Query: 74  DEKDMR------SFFCAAP-WKKILTVLAGPLANCV---------MAILFFTFFFYNTGV 117
           D+ D +            P + + + + AG +AN +         +A + F    Y  GV
Sbjct: 69  DDPDSQIPNNDPDLLRNRPVFDRAIVISAGVIANLIFAYFLLVTQVATVGFPQINYQEGV 128

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLD----GITVSAFEEVAPYVRENPLHEISLVLY 173
           + P V      S A  AG+K GD +++++    G + +A  +    ++ +P   + L + 
Sbjct: 129 IIPEVFTAE-NSVAKQAGMKAGDIVLAINDQPLGASQNAIIDFRDIIQSSPDQPLKLTIK 187

Query: 174 REHVGVLHLKVMPRL-QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
           R     ++L V P L  D   + G++       ++ + +ET+L +    Q+FS G  E  
Sbjct: 188 RP-TETINLIVTPELGSDGQGKIGVR-------LAPNGEETRLKADNFGQAFSLGAGEFQ 239

Query: 233 SIT----RGFLGVLSSAFGKDTRLNQISGPVGI----ARIAKNFFDHGFNAYIAFLAMFS 284
            +T    +GF G L S F KD+ + Q++GPV I    A IA+N   + F     F A+ S
Sbjct: 240 RLTLLTVQGF-GQLVSNF-KDS-VQQVAGPVKIVEYGAAIARNDAGNLFQ----FAALIS 292

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
             +  +N+LP+P LDGG L+  L+E + GK L
Sbjct: 293 INLAVINILPLPALDGGQLVFLLIEALVGKPL 324


>gi|317181566|dbj|BAJ59350.1| hypothetical protein HPF57_0276 [Helicobacter pylori F57]
          Length = 351

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 96/358 (26%), Positives = 172/358 (48%), Gaps = 25/358 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSF----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV            +E  ++  S+   +P+KK+  +  G   N + AIL   +FF   G
Sbjct: 62  GYVKLKGMDKEENETNETNQENDSYVQKSPFKKLWILFGGAFFNFLFAIL--VYFFLALG 119

Query: 117 ---VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V      E+ L + 
Sbjct: 120 GEKVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVV-ARARGELVLEIE 176

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDE 230
           R H  +L  ++ P++   +       ++     +GI     +T + S ++ Q+F + L  
Sbjct: 177 RNH-QILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVVSYSLFQAFEKALSR 235

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
                      L         + ++SG VGI     +      +  + F A  S  +G +
Sbjct: 236 FKEGVVLIADSLRRLITGSASVKELSGVVGIVGALSH--ASSLSMLLLFGAFLSINLGIL 293

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NLLPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ NDI  L+
Sbjct: 294 NLLPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGFLVFIMFLGLFNDITRLL 351


>gi|291614107|ref|YP_003524264.1| membrane-associated zinc metalloprotease [Sideroxydans
           lithotrophicus ES-1]
 gi|291584219|gb|ADE11877.1| membrane-associated zinc metalloprotease [Sideroxydans
           lithotrophicus ES-1]
          Length = 451

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 101/162 (62%), Gaps = 9/162 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGIT-SRSGVRWKVSL 62
           +   + + V++ I+VV HE GHY+VARLC+++VL FS+GFG  L     S S   W +S 
Sbjct: 1   MTTLIAFIVAIAILVVFHELGHYVVARLCDVKVLKFSIGFGNALYTKRFSNSETEWVISA 60

Query: 63  IPLGGYVS-FSEDEKDM------RSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYN 114
           IPLGGYV    E+E ++      R+F     W+++  V+AGP+AN ++A +L+F  F + 
Sbjct: 61  IPLGGYVKMLDENEGEVAAHELPRAFNRKPVWQRMAIVVAGPIANLLLAVVLYFMLFIHG 120

Query: 115 TGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV 156
              +KPV+  + P SPAA+AG++    I+S++G    +++E+
Sbjct: 121 VPGLKPVLGEIVPNSPAAVAGLQSKQTIVSINGQPTPSWQEI 162



 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 110/233 (47%), Gaps = 8/233 (3%)

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
           PV+  +     A  AG++  D ++  DG  V  +++    VR +P   + + + R    V
Sbjct: 221 PVIGKLVEGGVAQRAGLQVNDRVLLADGQKVPLWDDWVNAVRSHPGKPLDIEIERAG-AV 279

Query: 180 LHLKVMPRL----QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
           L L + P +      T+ R G    +          +        LQ   R   E + ++
Sbjct: 280 LKLSLTPEVIVEGGKTIGRIGAAAFIDKTAFEAMLTQVSYPPLAALQEALRKTWETAIVS 339

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
              +G +      +  L  +SGP+ IA  A      G  AYI+FLA+ S ++G +NLLPI
Sbjct: 340 LKMMGKMVEG---EVSLKNLSGPITIADYAGQSAQLGAGAYISFLALISISLGVLNLLPI 396

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           P+LDGGHL+ + +E+++G  +  S+     ++G+ +++ +    + NDI  L+
Sbjct: 397 PLLDGGHLLYYSVELVKGSPVSESLWEAGQKVGIALLVTMMAFALYNDISRLI 449


>gi|318040475|ref|ZP_07972431.1| membrane-associated Zn-dependent protease [Synechococcus sp.
           CB0101]
          Length = 362

 Score =  122 bits (306), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 99/326 (30%), Positives = 161/326 (49%), Gaps = 42/326 (12%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           ++V+HE GH+  A    IRV  FSVGFGP L+    R GV++ +  IPLGG+VSF +D++
Sbjct: 13  LIVVHEAGHFFAATWQGIRVSGFSVGFGPVLL-ERQRRGVQFALRAIPLGGFVSFPDDDE 71

Query: 77  ------DMRSFFCAAPW-KKILTVLAGPLANCVMA----------ILFFTFFFYNTGVMK 119
                 D        P  ++ L + AG LAN ++A          +     F    GV+ 
Sbjct: 72  ESTIPADDPDLLRNRPIPQRALVIAAGVLANLLLAWSVLVAQGLVVGIPAGFSATPGVL- 130

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITV----SAFEEVAPYVRENPLHEISLVLYRE 175
             V+ V     AA +G++ GD I+S DG+ +    SA  ++   V+  P  + +L L  E
Sbjct: 131 --VAGVQSGQAAAASGLRPGDRILSADGVNLGGGQSAVAQLVERVKGAP--DQTLQLQAE 186

Query: 176 HVG-VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI 234
             G  + + + P     + R G + Q PS   +F        ++   +  S+   + +S+
Sbjct: 187 RAGQTVTIALTPADVSGIGRIGAQLQ-PSGSEAFR------RAKGPGEILSQANRDFASL 239

Query: 235 TR----GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
           TR    GF+  L++ FG+     Q+SGPV I  +  +    G ++   + A+ S  +  +
Sbjct: 240 TRRTVEGFV-TLATHFGETA--GQVSGPVKIVEMGASLAKQGGSSLFLYTALISINLAVL 296

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSL 316
           N LP+P+LDGG  +  +LE +RGK L
Sbjct: 297 NALPLPLLDGGQFVFLMLEGLRGKPL 322


>gi|325262936|ref|ZP_08129672.1| RIP metalloprotease RseP [Clostridium sp. D5]
 gi|324032030|gb|EGB93309.1| RIP metalloprotease RseP [Clostridium sp. D5]
          Length = 344

 Score =  122 bits (306), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 143/315 (45%), Gaps = 34/315 (10%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           +++ HE GH+ +A+L  IRV  FS+G GP +IG   R G ++ + L+P GG     ED+ 
Sbjct: 13  VIIFHELGHFTLAKLNGIRVDEFSLGLGPTIIGKEFR-GTKFSLKLLPFGGACMMGEDDA 71

Query: 77  D---MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           D     SF   + W +I  + AGP+ N +MA++F        G   PVV  V     A  
Sbjct: 72  DDMSEGSFNSKSVWARISVIAAGPVFNFIMALIFSIILVAWIGYDAPVVQGVDKGYSAIE 131

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRL--QDT 191
            G+++GD I  L+G ++  ++EV+ +   N   +   V Y          + PR    D+
Sbjct: 132 QGIQEGDVITELNGKSIHLWKEVSLFNLMNSNADSVEVTYERDGQEYTATIEPRRLEGDS 191

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
           + R GI     +       +  +  + T+    +   D +  +  G +G+      KD  
Sbjct: 192 MQRLGITGSAVNTKAGL-VESVQYGAYTLRYWVNYTFDCLRMLVTGQIGI------KD-- 242

Query: 252 LNQISGPVGIARIAKNFFDHGFNA------------YIAFLAMFSWAIGFMNLLPIPILD 299
              +SGPVGI     NF D  +               I    + S  +G MNLLP+P LD
Sbjct: 243 ---MSGPVGIV----NFVDDTYKQAAPSGTVTVILNLINIAILLSANLGVMNLLPLPALD 295

Query: 300 GGHLITFLLEMIRGK 314
           GG L+   +E IR K
Sbjct: 296 GGRLVFLFIEAIRRK 310


>gi|260654956|ref|ZP_05860444.1| RIP metalloprotease RseP [Jonquetella anthropi E3_33 E1]
 gi|260630271|gb|EEX48465.1| RIP metalloprotease RseP [Jonquetella anthropi E3_33 E1]
          Length = 349

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 93/338 (27%), Positives = 151/338 (44%), Gaps = 23/338 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-------E 73
           HE GHY  AR   I+V  F+ G GP ++    R    W   L+PLGG+V  +       E
Sbjct: 20  HELGHYGAARAVGIKVHEFAFGMGP-VVCQRQRWHAVWSWRLLPLGGFVRMAGMGDEEDE 78

Query: 74  DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVM---KPVVSNVSPASP 130
           D      F    P++K+  VLAGP AN ++A +      Y  GV    +  V  V P  P
Sbjct: 79  DVPQTARFDGKKPYQKLFVVLAGPAANLLLAAVVAASVMYFGGVYDLSRSAVGAVMPGYP 138

Query: 131 AAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQD 190
           A  AG+  GD ++S++G   + +E +   +R            R + G  ++++  +   
Sbjct: 139 AEKAGLLPGDEVLSVNGQNTTDWESLVSAIRREGSSRPITFAVRRNGGTFNVRMTAQAAK 198

Query: 191 TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDT 250
                      P VGI     +       + +SF  G      ++   +  L       +
Sbjct: 199 N------PSDPPLVGI-----QPAKRRPGIGESFVDGFAFTFRLSFLMIKELGGMIAHPS 247

Query: 251 RLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEM 310
              Q++GPVGIA +A +    G  A ++FLA+ S  +G +NLLP P LDGG     ++EM
Sbjct: 248 -TAQVAGPVGIAVMAGDAARSGALALLSFLAVISLNLGIVNLLPFPALDGGRAFFAVIEM 306

Query: 311 IRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           I+G+ +   + R +   G  +++        +D+ GL+
Sbjct: 307 IQGRPVSEQIERRVHFAGFVVLMIFILAVTWHDVVGLI 344


>gi|167040290|ref|YP_001663275.1| putative membrane-associated zinc metalloprotease
           [Thermoanaerobacter sp. X514]
 gi|300914374|ref|ZP_07131690.1| membrane-associated zinc metalloprotease [Thermoanaerobacter sp.
           X561]
 gi|307724390|ref|YP_003904141.1| membrane-associated zinc metalloprotease [Thermoanaerobacter sp.
           X513]
 gi|166854530|gb|ABY92939.1| putative membrane-associated zinc metalloprotease
           [Thermoanaerobacter sp. X514]
 gi|300889309|gb|EFK84455.1| membrane-associated zinc metalloprotease [Thermoanaerobacter sp.
           X561]
 gi|307581451|gb|ADN54850.1| membrane-associated zinc metalloprotease [Thermoanaerobacter sp.
           X513]
          Length = 332

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 96/315 (30%), Positives = 149/315 (47%), Gaps = 20/315 (6%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L+  + L ++V+ HEFGH++VA+L   RV  FS+GFGP L          +    +  
Sbjct: 2   TILISIIVLSVLVMFHEFGHFIVAKLSGARVNEFSIGFGPRLFK-KKYGETEYSFRALLF 60

Query: 66  GGYVSFS-EDEK--DMRSFFCAAPWKKILTVLA-GPLANCVMAILFFTFFFYNTGVMKPV 121
           GGYV+   EDEK  D R+     PW   L V A GPL N ++A L     F+N G   P 
Sbjct: 61  GGYVALEGEDEKSSDPRAI-VNKPWPVRLAVFAAGPLMNILLAFLLLFIVFFNIGSPIPQ 119

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V +V    PA  AG+  GD I+ ++   ++ +EE+   +  N    +++ + R +  +L 
Sbjct: 120 VKSVMEGYPAEKAGIVPGDKIVMVNNTKINTWEELEKAISSNGERVLTIEIQRGN-QILQ 178

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
            +V P       +  I       GI   Y+      R++  +F   +++    ++  +  
Sbjct: 179 KQVKPIFDKNASKVMI-------GIVPDYE------RSISLAFKTAINQTIYFSKLIILS 225

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           L         +N I GPVGI +        G    +AF A+ S  +G  NLLP+P LDGG
Sbjct: 226 LVMLVTGKVSVNDIMGPVGIVQAVGTVAKTGVINLLAFSALISVNLGLFNLLPLPALDGG 285

Query: 302 HLITFLLEMIRGKSL 316
            ++  L E +RGK L
Sbjct: 286 RILFVLAEAVRGKPL 300


>gi|167037629|ref|YP_001665207.1| putative membrane-associated zinc metalloprotease
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|307264907|ref|ZP_07546469.1| membrane-associated zinc metalloprotease [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|320116044|ref|YP_004186203.1| membrane-associated zinc metalloprotease [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|326389443|ref|ZP_08211010.1| membrane-associated zinc metalloprotease [Thermoanaerobacter
           ethanolicus JW 200]
 gi|166856463|gb|ABY94871.1| putative membrane-associated zinc metalloprotease
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|306920165|gb|EFN50377.1| membrane-associated zinc metalloprotease [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|319929135|gb|ADV79820.1| membrane-associated zinc metalloprotease [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|325994448|gb|EGD52873.1| membrane-associated zinc metalloprotease [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 332

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 149/315 (47%), Gaps = 20/315 (6%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L+  + L ++V+ HEFGH++VA+L   RV  FS+GFGP L          +    +  
Sbjct: 2   TILISIIVLSVLVMFHEFGHFIVAKLSGARVNEFSIGFGPRLFK-KKYGETEYSFRALLF 60

Query: 66  GGYVSFS-EDEK--DMRSFFCAAPWKKILTVLA-GPLANCVMAILFFTFFFYNTGVMKPV 121
           GGYV+   EDEK  D R+     PW   L V A GPL N ++A L     F+N G   P 
Sbjct: 61  GGYVALEGEDEKSNDPRAI-VNKPWPVRLAVFAAGPLMNILLAFLLLFIVFFNIGSPIPQ 119

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V +V    PA  AG+  GD I+ ++   ++ +EE+   +  N    +++ + R +  +L 
Sbjct: 120 VKSVMEGYPAEKAGILPGDKIVMVNNTKINTWEELEKAISSNGERVLTIEIQRGN-QILQ 178

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
            +V P       +         +GI   Y+      R++  +F   +++    ++  +  
Sbjct: 179 KQVKPIFDKNASKV-------MIGIVPDYE------RSISLAFKTAINQTIYFSKLIILS 225

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           L         +N I GPVGI +        G    +AF A+ S  +G  NLLP+P LDGG
Sbjct: 226 LVMLVTGKVSVNDIMGPVGIVQAVGTVAKTGVINLLAFSALISVNLGLFNLLPLPALDGG 285

Query: 302 HLITFLLEMIRGKSL 316
            ++  L E +RGK L
Sbjct: 286 RILFVLAEAVRGKPL 300


>gi|33240754|ref|NP_875696.1| membrane-associated Zn-dependent protease [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
 gi|33238282|gb|AAQ00349.1| Predicted membrane-associated Zn-dependent protease
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 360

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 100/332 (30%), Positives = 160/332 (48%), Gaps = 50/332 (15%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +++  HE GH++ A L  IRV  FS+GFGP LI      GV + +  +PLGG+VSF +
Sbjct: 10  LALLIFFHESGHFLAATLQGIRVSGFSIGFGPALIK-KEFQGVTYSIRALPLGGFVSFPD 68

Query: 74  DE------KDMRSFFCAAP-WKKILTVLAGPLANCVMAILFF----TFF-FYNTGVMKPV 121
           DE      K+        P ++++L + AG +AN ++A L      TF    N      +
Sbjct: 69  DEQESTISKEDPDLLSNRPIFQRLLVISAGVIANLLIAWLALCGQATFIGIPNQPDPGVL 128

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITV----SAFEEVAPYVRENPLHEISLVLYREHV 177
           + +V     AA++G+K GD IIS+DGI +     A E +   ++ +P   IS+   ++  
Sbjct: 129 IIDVQNQQSAALSGLKAGDQIISIDGINLGSGQEAVESMVDKIKNSPGQTISI--EKDTN 186

Query: 178 GVLHL-KVMPRLQDTVDRFGIKRQV-------PSVGIS--FSYDETK---LHSRTVLQSF 224
           G   + K+ P     V + G + QV       P+ G++  F Y  +K   L S+T+ Q +
Sbjct: 187 GTKGIIKLTPIEHLGVGKIGAQLQVNINGSIRPANGLTDIFYYTNSKFFNLLSKTI-QGY 245

Query: 225 SRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFS 284
                + +S ++                 Q+SGPV I  +       G +  I F A+ S
Sbjct: 246 KSLFTDFNSTSK-----------------QLSGPVKIVELGAQLSGQGASGLILFAALIS 288

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
             +  +N LP P+LDGG     L+E +RGK +
Sbjct: 289 INLAVLNSLPFPLLDGGQFTLILIEALRGKPI 320


>gi|304320065|ref|YP_003853708.1| hypothetical protein PB2503_02452 [Parvularcula bermudensis
           HTCC2503]
 gi|303298968|gb|ADM08567.1| hypothetical protein PB2503_02452 [Parvularcula bermudensis
           HTCC2503]
          Length = 497

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 117/238 (49%), Gaps = 36/238 (15%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   + + V L  IV IHE+GH+  ARLC ++V +FS+GFG  ++  T R G  WK++ I
Sbjct: 9   LVSLVAFAVLLAFIVFIHEYGHFKTARLCGVKVETFSIGFGKAMLQWTDRKGTVWKIAAI 68

Query: 64  PLGGYVSFSED--------------------------------EKDMRSFFCAAP-WKKI 90
           PLGGYV F  D                                E++ R  F   P W++ 
Sbjct: 69  PLGGYVKFFGDANAASAGTEAKGARPATTQFGSEKDRLAALLTEEEKRVCFHFKPVWQRA 128

Query: 91  LTVLAGPLANCVMAILFFT--FFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGI 148
           L V AGP+AN ++  L F+   F   T  + PVV  V+P + A  AG + GD I+S++G 
Sbjct: 129 LIVAAGPVANFILGALIFSAILFLLGTRTVDPVVGRVAPNTVADAAGFEPGDRILSVNGR 188

Query: 149 TVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGI 206
           T+ +F ++   VR      ++ V+ R+      +   PR  +  D +G K ++  +GI
Sbjct: 189 TLRSFNDLVTRVRLAADETLTFVVERDGE-TETITATPRRTEQTDAYGNKVRMGQLGI 245



 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 61/113 (53%), Gaps = 18/113 (15%)

Query: 253 NQISGPVGIARIAKNFFDHGF----------------NAYIAFLAMFSWAIGFMNLLPIP 296
            Q+ GPV IA+ A      GF                + +I+   + S +IGFMNLLPIP
Sbjct: 381 RQMGGPVKIAQYAGQAAKSGFEPTYDIPLSDRLKISLSQFISLAGLISVSIGFMNLLPIP 440

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCII-LFLFFLGIRNDIYGLM 348
           +LDGGHL+ +  E I G+ L   V  +  R+GL I+  F+ F+ I ND+ GL+
Sbjct: 441 VLDGGHLVYYGYEAIAGRPLSDRVQGIGFRVGLAIVGTFMIFV-IVNDVVGLV 492


>gi|90022235|ref|YP_528062.1| peptidase RseP [Saccharophagus degradans 2-40]
 gi|89951835|gb|ABD81850.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Saccharophagus degradans 2-40]
          Length = 466

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 93/162 (57%), Gaps = 9/162 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L + +++ I+V IHE+GH+ VAR C ++VL FS+GFGP L+  T + G  + +S I
Sbjct: 22  LSTLLWFLIAISILVAIHEYGHFYVARRCGVKVLRFSIGFGPRLLTWTDKKGTEFALSAI 81

Query: 64  PLGGYVSF---SEDEKDMR----SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           PLGGYV      E E D      +F    PW++IL   AGPLAN + AIL F       G
Sbjct: 82  PLGGYVKMLDEREGEVDEAERPYAFSSKKPWQRILIAFAGPLANFIFAILLFWLIVAVRG 141

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV 156
              M PVV  V P S AA+AG++ G  I+++DG    + E V
Sbjct: 142 EFQMFPVVGEVKPNSVAALAGLEAGQEILAIDGEPTPSTEAV 183



 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 123/235 (52%), Gaps = 24/235 (10%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           V+S V+   PA  AG + GD +++ DGI + +  +   Y+ E P  E+ + + R    ++
Sbjct: 242 VISEVTEGKPAFDAGFEAGDIVVATDGIPMGSSRKWTTYISERPNQELEVEVERAGE-II 300

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVL---QSFSRGLDE------- 230
            LKV P  + + D     + V  +G+  + +    + R      ++F RG+ +       
Sbjct: 301 ALKVTPAQETSED----GKTVGRIGVGVTTNYKGSYRRIEYGPGEAFVRGVQKTWETVDF 356

Query: 231 -ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
            + SI +  LG +S+          +SGP+GIA++A +    G  A+++FLAM S  +G 
Sbjct: 357 VLLSIKKLILGEIST--------KNLSGPIGIAKVAGDSAKAGSWAFVSFLAMISVYLGV 408

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +NLLP+P+LDGGH++  L+E ++G  L   V  +  + GL ++L L  +   ND+
Sbjct: 409 LNLLPVPVLDGGHILFGLIEWVKGSPLSERVQALGYQAGLAMVLCLMVVAFYNDL 463


>gi|291296168|ref|YP_003507566.1| membrane-associated zinc metalloprotease [Meiothermus ruber DSM
           1279]
 gi|290471127|gb|ADD28546.1| membrane-associated zinc metalloprotease [Meiothermus ruber DSM
           1279]
          Length = 337

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 90/340 (26%), Positives = 149/340 (43%), Gaps = 23/340 (6%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED- 74
           I + +HE GHY+ AR+  + V +F VGFGP L+    R G  W+++ IPLGGY       
Sbjct: 12  ISIFVHELGHYLAARVQGVGVKNFGVGFGPTLLKF-ERWGTTWRLNAIPLGGYAEIEGMM 70

Query: 75  EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAA 132
             D   +   + W K L ++AG + N ++A           G+   +  V+ V P S A 
Sbjct: 71  PGDTHGYARLSSWGKFLILVAGVVMNLLLAWGVLAALASIQGIPQTRAEVTEVLPGSLAE 130

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTV 192
            AG + GD I+SL+G  ++A+++V  +              R+  G     V+    +  
Sbjct: 131 QAGFRVGDRILSLNGEKLTAYDQVTRF--------------RQSTGEKVFVVLRDGAEVT 176

Query: 193 DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE----ISSITRGFLGVLSSAFGK 248
            RF        +GI +  +          Q F+R + E    +    + F G ++     
Sbjct: 177 LRFNWDNTQARLGIVYRPELVGYTRINFFQGFARAIGETVVAVPRFVQEFAGSIARIL-S 235

Query: 249 DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLL 308
             +   ++GPVGI  I     + G    +  LA  + ++   NLLPIP LDGG ++  + 
Sbjct: 236 GQQAQGVAGPVGIVNITGQAAEQGLGTLVGLLAAINLSLAVFNLLPIPGLDGGRILVLVA 295

Query: 309 EMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            +I G  +       ++  G   ++ L  L   NDI  L+
Sbjct: 296 NVISGGRIKPETEARLSYGGFIFLILLIVLVTINDIRNLV 335


>gi|156741798|ref|YP_001431927.1| peptidase M50 [Roseiflexus castenholzii DSM 13941]
 gi|156233126|gb|ABU57909.1| peptidase M50 [Roseiflexus castenholzii DSM 13941]
          Length = 371

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/307 (30%), Positives = 153/307 (49%), Gaps = 20/307 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GH++ A    I+V  F +G+ P  + +  R+GV++ ++ +P+GG+V F  + + +  
Sbjct: 26  HELGHFLTAVWFGIKVEEFGLGYPPRAMVLFERNGVKYTLNWLPIGGFVRFGGEGEQIYG 85

Query: 79  -RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV----VSNVSPASPAAI 133
             S   A+PWKKI  + AGPL N ++A L F+  F   GV +      +  V PA+PA  
Sbjct: 86  VGSLSAASPWKKIAVLFAGPLMNLLLAFLIFSGIFMARGVPEAFNGARIDVVYPATPAER 145

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYV-RENPLHEISLVLYREHVG-VLHLKVMPRLQDT 191
           AG++ GD ++SL+G T+     V   +  EN    I  V+ R+    VL +   P  +D 
Sbjct: 146 AGLQSGDLLVSLNGRTLDTDLSVIRLIAAENRGRTIEAVVERDGARVVLMITPGPWQRDG 205

Query: 192 V---DRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFG- 247
           V   + FG     P++ I  +     L++      FS   D +     G   +L S  G 
Sbjct: 206 VAFENGFGFA-YTPNIQIVPATPLKALNA-----GFSYTFDILGRFIAGIGQMLGSLLGI 259

Query: 248 KDTRLNQISGPVGIARIAKNFFDH-GFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
            +     ++G VGIAR         G+  +  + A+ S  +  +NLLPIP LDG H++  
Sbjct: 260 TEAPQGGVAGVVGIARGTGEVIQRDGWLGFWQWTALISLNLFLINLLPIPALDGSHILFS 319

Query: 307 LLEMIRG 313
           L+E+ RG
Sbjct: 320 LIEIARG 326


>gi|159030797|emb|CAO88475.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 363

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 102/332 (30%), Positives = 165/332 (49%), Gaps = 46/332 (13%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +++V+HE GH+  AR  +I V  FS+GFGP L     +    + +  IPLGGYV F +
Sbjct: 10  LALLIVVHELGHFAAARWQSIHVNRFSIGFGPALAKYQGKE-TEYALRAIPLGGYVGFPD 68

Query: 74  DEKDMR------SFFCAAP-WKKILTVLAGPLANCV---------MAILFFTFFFYNTGV 117
           D+ D +            P + + + + AG +AN +         +A + F    Y  GV
Sbjct: 69  DDPDSQIPNNDPDLLRNRPVFDRAIVISAGVIANLIFAYFLLVTQVATVGFPQINYQEGV 128

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLD----GITVSAFEEVAPYVRENPLHEISLVLY 173
           + P V   S  S A  AG++ GD +++++    G + +A  +    ++ +P   + L + 
Sbjct: 129 IIPEVF-TSENSVAKQAGIQAGDIVLAINDQPLGASQNAIIDFRDIIQSSPDQPLKLTIK 187

Query: 174 REHVGVLHLKVMPRL-QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
           R     L L V P L  D   + G++       ++ + +ET+L +    Q+FS G  E  
Sbjct: 188 RP-TETLDLIVTPELGSDGQGKIGVR-------LAPNGEETRLKADNFGQAFSLGAGEFQ 239

Query: 233 SIT----RGFLGVLSSAFGKDTRLNQISGPVGI----ARIAKNFFDHGFNAYIAFLAMFS 284
            +T    +GF G L S F KD+ + Q++GPV I    A IA+N   + F     F A+ S
Sbjct: 240 RLTLLTVQGF-GQLVSNF-KDS-VQQVAGPVKIVEYGAAIARNDAGNLFQ----FAALIS 292

Query: 285 WAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
             +  +N+LP+P LDGG L+  L+E + GK L
Sbjct: 293 INLAVINILPLPALDGGQLVFLLIEALVGKPL 324


>gi|294461973|gb|ADE76542.1| unknown [Picea sitchensis]
          Length = 501

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 167/357 (46%), Gaps = 37/357 (10%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L  IV +HE GH++ A L NIRV  FS+GFGP L+ +  R+ V   +  IPLGGYV F +
Sbjct: 147 LAAIVTVHECGHFLAAYLQNIRVNKFSIGFGPTLLKLNLRN-VECSLRAIPLGGYVGFPD 205

Query: 74  DEKDM------RSFFCAAP-WKKILTVLAGPLANCVMA--ILFFTFFFYNTGVMKP---- 120
            E+D       +      P   +++  +AG +AN V A  ILF           +P    
Sbjct: 206 GEQDSGIAADDKDLLRNRPVIDRVIVTIAGVVANIVFAYTILFVQVLTVGAVEKEPFPGV 265

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPY-----VRENPLHEISLVLYRE 175
           ++  V   S AA  G++ GD ++ ++G      E  A +     +++NP  ++S ++ R 
Sbjct: 266 MIPQVFSYSAAARDGMESGDVVLGVNGRLFGVSEPEAVFDLVDVIKKNPGKKLSFLVERR 325

Query: 176 HVGVLHLKVMP--RLQDTVDRFGIK----RQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
              V  + V P   ++D   + G++     ++  V  +   + T   S+   +  S  +D
Sbjct: 326 QSDVKQILVTPDVSMEDGTGKIGVQLAPNAKIIKVRANDLAEATVRASKEFRRLLSTVMD 385

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
           E+  I   FL    +A        ++SGPV I  I              F A+ +  +  
Sbjct: 386 ELKQI---FLNFSKTA-------TKLSGPVAIVAIGAEVARSSSEGMFQFAAIVNLNLAV 435

Query: 290 MNLLPIPILDGGHLITFLLEMIR-GKSLGVSVTRVITRMGLCIILFL-FFLGIRNDI 344
           +NLLP+P LDGG+L    LE  R GK L   V + I   G+ ++ FL  FL +R+ +
Sbjct: 436 VNLLPLPALDGGYLALIALEAARGGKKLPHEVEQGIMSSGIALVFFLGVFLIVRDTL 492


>gi|308182433|ref|YP_003926560.1| hypothetical protein HPPC_01305 [Helicobacter pylori PeCan4]
 gi|308064618|gb|ADO06510.1| hypothetical protein HPPC_01305 [Helicobacter pylori PeCan4]
          Length = 350

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 99/359 (27%), Positives = 177/359 (49%), Gaps = 27/359 (7%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+++AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 2   FIVAVLMLAFLIFVHELGHFIIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 60

Query: 67  GYVSF-----SEDEKDMR-----SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV        E+E++       S+   +P++K+  +  G   N + AIL   +FF   G
Sbjct: 61  GYVKLKGMDKEENEENKTHQANDSYAQKSPFQKLWILFGGAFFNFLFAIL--VYFFLALG 118

Query: 117 ---VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + 
Sbjct: 119 GEKVLLPVIGDLE--KNALEAGLLKGDKILSINHKQIASFREIRSVV-AHARGELVLEIE 175

Query: 174 REHVGVLHLKVMPR----LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
           R H  +L  ++ P+    + D+ D   I +    +GI     +T + S ++ Q+F + L 
Sbjct: 176 RNH-QILEKRLTPKIVALISDSNDPNEIIK-YKVIGIKPDMQKTAVISYSLFQAFEKALS 233

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
                    +  L         + ++SG VGI     +      +  + F A  S  +G 
Sbjct: 234 RFKEGVVLIVDSLRRLITGSASVKELSGVVGIVGALSH--ASSVSMLLLFGAFLSINLGI 291

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +NLLPIP LDG  ++  + + I   +L   +   +   G+  + F+ FLG+ NDI  L+
Sbjct: 292 LNLLPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGFLFFIMFLGLFNDITRLL 350


>gi|15644886|ref|NP_207056.1| hypothetical protein HP0258 [Helicobacter pylori 26695]
 gi|2495696|sp|P56136|Y258_HELPY RecName: Full=Putative zinc metalloprotease HP_0258
 gi|2313352|gb|AAD07326.1| conserved hypothetical integral membrane protein [Helicobacter
           pylori 26695]
          Length = 348

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 98/357 (27%), Positives = 177/357 (49%), Gaps = 25/357 (7%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 2   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 60

Query: 67  GYVSFS---EDEKDMR-----SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV      ++E  M      S+   +P++K+  +  G   N + AIL   +FF   G  
Sbjct: 61  GYVKLKGMDKEENGMNETTDDSYAQKSPFQKLWILFGGAFFNFLFAIL--VYFFLALGGE 118

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
            V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V      E+ L + R 
Sbjct: 119 KVLLPVIGDLD--KNALEAGLLKGDKILSINHKKIASFREIRSVV-ARARGELVLEIERN 175

Query: 176 HVGVLHLKVMPR----LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
           H  VL  ++ P+    + D+ D   + R   ++GI     +  + S ++ Q+F + L   
Sbjct: 176 H-QVLEKRLTPKIVAVISDSNDPNEMIRY-KAIGIKPDMQKMGVVSYSLFQAFEKALSRF 233

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
                  +  L       + + ++SG VGI     +   +  +  + F A  S  +G +N
Sbjct: 234 KEGVVLIVDSLRRLIMGSSSVKELSGVVGIVGALSH--ANSLSMLLLFGAFLSINLGILN 291

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ ND+  L+
Sbjct: 292 LLPIPALDGAQMLGVVFKNIFHITLPTPIQNALWLAGVGFLVFIMFLGLFNDLTRLL 348


>gi|223985638|ref|ZP_03635688.1| hypothetical protein HOLDEFILI_02994 [Holdemania filiformis DSM
           12042]
 gi|223962405|gb|EEF66867.1| hypothetical protein HOLDEFILI_02994 [Holdemania filiformis DSM
           12042]
          Length = 348

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 97/340 (28%), Positives = 155/340 (45%), Gaps = 29/340 (8%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDM-- 78
           HE GH + A+  ++    FS+G GP+L     +    + +  +P+GGYV+ + +E     
Sbjct: 17  HECGHLIAAKCFHVYCGEFSIGMGPKLWAWKGKE-TTFTLRALPIGGYVAMAGEEGSEFE 75

Query: 79  -----RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG----VMKPVVSNVSPAS 129
                R+    + WK+I+ +LAG + N V+A L F       G      K VV  V   S
Sbjct: 76  GVPHERTIKGVSHWKQIIIMLAGVIMNFVLAWLIFASIILINGSYNIAPKAVVGGVVEGS 135

Query: 130 PAAIAGVKKGDCIISL---DGITV--SAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           PA  AG  +GD I  +   DG  V  S F E+  Y  +N    ++  L R     L   V
Sbjct: 136 PAEAAGFAQGDVITKVVFADGTVVKPSNFYEILTYSMDNT-DPVTYTLKRGD-ETLEKTV 193

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSS 244
            P   +    + +  ++P          T++ + T+L S   G   +    +  +  L+ 
Sbjct: 194 TPVYNEQEQSWLVGIKIPPA--------TQVKT-TLLNSGYYGAQYMGQTVKELVTALTR 244

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
              K      +SGPVGI ++ +     G   YI  +A+ S  +G  NLLP+PILDGG ++
Sbjct: 245 LV-KGIGFEDLSGPVGIYQVTEQQASLGLQNYILLIALLSLNVGVFNLLPLPILDGGRIL 303

Query: 305 TFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
             ++EMI GK L   +   IT +G+ ++L L       D+
Sbjct: 304 LVIVEMIIGKPLNQKLEAGITAVGVALVLLLMVYVTWQDL 343


>gi|254432837|ref|ZP_05046540.1| RIP metalloprotease RseP [Cyanobium sp. PCC 7001]
 gi|197627290|gb|EDY39849.1| RIP metalloprotease RseP [Cyanobium sp. PCC 7001]
          Length = 362

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 100/313 (31%), Positives = 152/313 (48%), Gaps = 44/313 (14%)

Query: 19  VIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE--- 75
           V+HE GH++ A    IRV SFS+GFGP L     R GV++ +  IPLGG+V+F +D+   
Sbjct: 15  VVHEAGHFLAATWQGIRVSSFSIGFGPVLF-ERQRRGVQFALRAIPLGGFVAFPDDDEDS 73

Query: 76  ---KDMRSFFCAAPW-KKILTVLAGPLANCVMAILFF----------TFFFYNTGVMKPV 121
              KD        P  ++ L + AG LAN ++A L              F    GV+   
Sbjct: 74  AIPKDDPDLLSNRPLHQRALVIAAGVLANLLLAWLVLVGQGLVVGIPAGFSATPGVL--- 130

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEE-VAPYVRE---NPLHEISLVLYREHV 177
           VS V P  PAA AG++ GD I++L G  +   ++ VA  V +   +P   + LV  R   
Sbjct: 131 VSGVQPGLPAAAAGLQPGDRIVTLAGEEIGGGQQAVAALVEQIKGSPERTLPLVAERGQQ 190

Query: 178 GVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKL--HSRTVLQSFSRGLDEISSIT 235
             L L++ P      D  GI R    +G     + T+    +R+ L++  +   + S + 
Sbjct: 191 -RLQLRLTPD-----DLAGIGR----IGAQLQPNGTEQFRPARSPLEAIRQANRDTSLLV 240

Query: 236 R----GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
           R    GFL  L + FG+    +Q+SGPV I  +  +    G  +   F A+ S  +  +N
Sbjct: 241 RRTAGGFL-TLITHFGETA--SQVSGPVKIVEMGASLAQQGGGSLFLFTALISINLAVLN 297

Query: 292 LLPIPILDGGHLI 304
            LP+P+LDGG  +
Sbjct: 298 ALPLPLLDGGQFV 310


>gi|326791503|ref|YP_004309324.1| membrane-associated zinc metalloprotease [Clostridium lentocellum
           DSM 5427]
 gi|326542267|gb|ADZ84126.1| membrane-associated zinc metalloprotease [Clostridium lentocellum
           DSM 5427]
          Length = 343

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 165/344 (47%), Gaps = 37/344 (10%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED-- 74
           IV++HE+GHY+ A+ C + V  F+VG GP ++  T +    + + L+P+GG+ S  E+  
Sbjct: 14  IVIVHEWGHYITAKKCGVLVHEFAVGMGP-ILWSTKKGETVYSIRLLPIGGFCSMEEEVG 72

Query: 75  -EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
              + R+     PW+K+L V AG + N V+A +  +      G     ++++    PA  
Sbjct: 73  ESVNPRAMAAKKPWQKLLIVSAGAIMNFVLACVLLSIVVGYQGYGSNEIASLEADMPAVQ 132

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVD 193
           AG+K GD II++DG  V              L ++S VL +E     +   + R  +T  
Sbjct: 133 AGLKVGDQIIAIDGHKVER------------LSDLSKVLEKEEKA--YTLTVKRGSETFT 178

Query: 194 RFGIKRQVPSVGIS-FSYDETKLHSRTVLQSFSRGLDE----ISSITRGFLGVLSSAFGK 248
                + +P    S   +  T +H   + ++   G+      I+ + + F+ + + A G 
Sbjct: 179 TPITSKWMPKEERSRLGFSPTFIH-FNIWENIKSGVIWACLIIAQVWKAFVDLFTGAVG- 236

Query: 249 DTRLNQISGPVGIARIAKNFFDHGFNA---YIAFLAMFSWA------IGFMNLLPIPILD 299
              +NQ+SG VG+   +   +D    +    IA L M + A      +  +NL P+P LD
Sbjct: 237 ---MNQLSGIVGVVNQSAEIWDTSMQSGGLSIAILNMMTIAAALSANLAVVNLFPLPALD 293

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
           GG ++  L+EM+RGK +       +  +G  +++ L  + I ND
Sbjct: 294 GGRIVFVLVEMLRGKPVPPEKEGAVHFIGFVLLMILTVVLIYND 337


>gi|317177073|dbj|BAJ54862.1| hypothetical protein HPF16_0265 [Helicobacter pylori F16]
          Length = 349

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/356 (26%), Positives = 174/356 (48%), Gaps = 23/356 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV     +K+          S+   +P++K+  +  G   N + AIL   +FF   G  
Sbjct: 62  GYVKLKGMDKEENETNESANDSYAQKSPFQKLWILFGGAFFNFLFAIL--VYFFLALGGE 119

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
            V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + R 
Sbjct: 120 KVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVVARSR-GELVLEIERN 176

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
           H  +L  ++ P++   +       ++     +GI     +T + S ++ Q+F + L    
Sbjct: 177 H-QILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVVSYSLFQAFEQALSRFK 235

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
                 +  L         + ++SG VGI     +      +  + F A  S  +G +NL
Sbjct: 236 EGVVLIVDSLRRLIMGSASVKELSGVVGIVGALSH--ASSLSMLLLFGAFLSINLGILNL 293

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIP LDG  ++  + + I   +L   +   +   G+ +++F+ FLG+ NDI  L+
Sbjct: 294 LPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGLLVFIMFLGLFNDITRLL 349


>gi|87123700|ref|ZP_01079550.1| hypothetical protein RS9917_08831 [Synechococcus sp. RS9917]
 gi|86168269|gb|EAQ69526.1| hypothetical protein RS9917_08831 [Synechococcus sp. RS9917]
          Length = 366

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 150/320 (46%), Gaps = 34/320 (10%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRS 80
           HE GH++ A    IRV  FSVGFGP LI    R GV + + L+PLGG+VSF +D+ D   
Sbjct: 17  HEAGHFLAAVGQGIRVNGFSVGFGPALIKTEWR-GVTYALRLLPLGGFVSFPDDDDDSPI 75

Query: 81  FFCAAPW-------KKILTVLAGPLANCVMAILFFTFFFYNTGV---MKP--VVSNVSPA 128
                         ++IL + AG LAN ++A +         G+    +P  +V  V P 
Sbjct: 76  PTDDPDLLRNRPIPQRILVISAGVLANLILAWVLLVGQSTLVGLPAEAEPGVLVVAVQPG 135

Query: 129 SPAAIAGVKKGDCIISLDG----ITVSAFEEVAPYVRENPLHEISLVLYR----EHVGVL 180
             AA AG++ GD I+ LDG        A   +   V+  P   ++L+  R    E     
Sbjct: 136 EAAARAGLQAGDRILRLDGELLGTGQDAVRSLVDQVQSEPGQSLALLTQRPTGTEQPSTE 195

Query: 181 H-LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL 239
             L + P  +D + R G + Q+       +       ++T L++   G  E   + R  +
Sbjct: 196 QILTLTPEDRDGLGRIGAQLQI-------NRGSALRPAQTPLEAIGFGTAEFGGLLRNTV 248

Query: 240 ---GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
              G L + FG+  R  Q+SGPV I  +       G    + F A+ S  +  +N LP+P
Sbjct: 249 EGYGGLITHFGETAR--QVSGPVKIVEMGAQLSSQGQGGLVLFTALISVNLAVLNALPLP 306

Query: 297 ILDGGHLITFLLEMIRGKSL 316
           +LDGG L+  LLE +RG+ L
Sbjct: 307 LLDGGQLVLILLEAVRGRPL 326


>gi|302386243|ref|YP_003822065.1| membrane-associated zinc metalloprotease [Clostridium
           saccharolyticum WM1]
 gi|302196871|gb|ADL04442.1| membrane-associated zinc metalloprotease [Clostridium
           saccharolyticum WM1]
          Length = 352

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 93/346 (26%), Positives = 160/346 (46%), Gaps = 27/346 (7%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY-VSFSED 74
           +IV+IHE GH++ A++  I V+ FS+G GP L+    R    + V  +PLGG  +   ED
Sbjct: 13  LIVLIHELGHFLFAKMNGIAVVEFSIGMGPRLVRF-KRGETIYSVKALPLGGSCMMLGED 71

Query: 75  EK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAA 132
           E+  D R+F   +   ++  + AGP+ N ++A           G     +  V+  SPA 
Sbjct: 72  EENPDERAFQNKSIPARMSVIAAGPIFNFILAFFLALILVGMNGYDTTYIKEVTENSPAY 131

Query: 133 IAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE------HVGVLHLKVMP 186
            AG++ GD ++ ++G  VS + +   +    P  +++LV +        +  +    V P
Sbjct: 132 EAGIRPGDKLLKINGENVSMYRDYILFKLLRPEEKMNLVEFSRTDPSTGNAIIQSSTVTP 191

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF 246
           +  +   ++ I       GI+ + +  K  S   L  +  G  E+    +  +  L   F
Sbjct: 192 QYSEESGKYLI-------GITIAPENKKAASIGELVKY--GYMEMEYDVKLTVKSLGMLF 242

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM--------FSWAIGFMNLLPIPIL 298
                +N +SGPVGI  +  +    G +  +A   M         S  +G MNLLPIP L
Sbjct: 243 TGKASVNDLSGPVGIVVMIDDSVKAGLSVSVAAALMNVISMCILLSANLGVMNLLPIPAL 302

Query: 299 DGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           DGG L+  ++E IRGK +      ++  + +  ++ L    + NDI
Sbjct: 303 DGGRLLFLMIEAIRGKRMDPEKEGLVNMISMAALMALMIFVVFNDI 348


>gi|299144042|ref|ZP_07037122.1| RIP metalloprotease RseP [Peptoniphilus sp. oral taxon 386 str.
           F0131]
 gi|298518527|gb|EFI42266.1| RIP metalloprotease RseP [Peptoniphilus sp. oral taxon 386 str.
           F0131]
          Length = 340

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/331 (26%), Positives = 160/331 (48%), Gaps = 29/331 (8%)

Query: 15  IIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGV--RWKVSLIPLGGYVSFS 72
           ++++ +HE GH+ VA++  I+V  FS+G GP+   I  + G+  ++ + ++P+GGYV+  
Sbjct: 12  MLVITLHELGHFSVAKMVGIKVNEFSIGMGPK---IFQKEGLETKYSIRILPIGGYVAME 68

Query: 73  -EDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPAS 129
            EDE+  D RSF     +K++  V+AG   N ++A++ F       G     + ++   S
Sbjct: 69  GEDERSDDPRSFNNVNVFKRMAVVVAGVCMNFILAVIAFFIVAVIVGTPTNTIGSIVDNS 128

Query: 130 PAAIAGVKKGDCIISLDGITVSAFEEVAPYV---RENPLHEISLVLYREHVGVLHLKVMP 186
            A  AG+  GD II ++ I    +E++   +   +EN   +I + + R H          
Sbjct: 129 SAYHAGLYAGDKIIEINDIPTKNWEDIVFNISNSKENS--DIRIKITRNH---------- 176

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF 246
              + V     K     + I  + +  K  S  +  SF   LD I  I   F+  +   F
Sbjct: 177 --NELVKHVIAKSNNGRIQIGITPNYEKSISNAIKYSF---LDTIQVIKDVFM-TIKLLF 230

Query: 247 GKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITF 306
             +  +  +SGPVG+  +       G    +  + + S  +G +NLLPIP LDGG L+  
Sbjct: 231 KGNVDVTMLSGPVGVISVIGQATSLGMVYLLKMIGIISANLGVVNLLPIPALDGGKLLFL 290

Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFF 337
           ++E + GK +   +   ++ +G+  +LFL  
Sbjct: 291 IIEKLIGKKINEKIENTLSLIGISFLLFLML 321


>gi|261839114|gb|ACX98879.1| zinc metalloprotease [Helicobacter pylori 52]
          Length = 349

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/356 (26%), Positives = 172/356 (48%), Gaps = 23/356 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV     +K+          S+   +P++K+  +  G   N + AIL   +FF   G  
Sbjct: 62  GYVKLKGMDKEENETNESANDSYAQKSPFQKLWILFGGAFFNFLFAIL--VYFFLALGGE 119

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
            V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + R 
Sbjct: 120 KVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVV-AHARGELVLEIERN 176

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
           H  +L  ++ P++   +       ++     +GI     +T + S ++ Q+F + L    
Sbjct: 177 H-QILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVVSYSLFQAFEKALSRFK 235

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
                    L         + ++SG VGI     +      +  + F A  S  +G +NL
Sbjct: 236 EGVVLIADSLRRLITGSASVKELSGVVGIVGALSH--ADSLSMLLLFGAFLSINLGILNL 293

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIP LDG  ++  + + I   +L   V   +   G+  ++F+ FLG+ ND+  L+
Sbjct: 294 LPIPALDGAQMLGVVFKNIFKITLPAFVQNALWLAGVGFLVFIMFLGLFNDLTRLL 349


>gi|118577234|ref|YP_899474.1| peptidase M50 [Pelobacter propionicus DSM 2379]
 gi|118504739|gb|ABL01221.1| peptidase M50 [Pelobacter propionicus DSM 2379]
          Length = 325

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 156/330 (47%), Gaps = 22/330 (6%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRS 80
           HE GH+  AR  +I V  FS+GFG  + G   R+G  + +  IPLGGY+    D+   R 
Sbjct: 15  HEAGHFFAARWFHISVPEFSIGFGARVFGW-KRNGTTYNLRAIPLGGYIK--TDDLSGRP 71

Query: 81  FFCAAPWKKILTVLAGPLANCVMAILFFTFF-FYNTGVMKPVVSNVSPASPAAIAGVKKG 139
                  +++L  LAGP AN + A L FTF  F     +   +  V    PAA AG++ G
Sbjct: 72  VR-----QRVLVALAGPAANLLFAYLVFTFTSFVGVPQLTTRIGTVFTGHPAASAGIQPG 126

Query: 140 DCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKR 199
           D +IS++G  V+ + E+   + +    E+ L +  E      + + P +++     G+K 
Sbjct: 127 DRVISVNGTHVTTWTEMITLIDQGRDREVKLTVETEQRD-RSISLKPEIREGRGVIGVKA 185

Query: 200 QVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPV 259
              S   S   +  +       + +      + S +  FL ++S         N++ GP+
Sbjct: 186 DGESTSTSSGANAPQ-------EGWRLTWSNLKSSSGMFLSLVSF-----QNFNKLGGPL 233

Query: 260 GIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVS 319
            IA+        G    + F+A+ S  +  +NLLPIPILDGG ++    E I  K    +
Sbjct: 234 YIAKAGAEQSHLGMIPLLYFMAIISSNLVTLNLLPIPILDGGLVLLAAWEGIFRKPFNAT 293

Query: 320 VTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
            TRV+T + L +++ L    + NDI  +++
Sbjct: 294 FTRVLTGLSLGLMVSLALFALINDIARMIK 323


>gi|308061612|gb|ADO03500.1| hypothetical protein HPCU_01615 [Helicobacter pylori Cuz20]
          Length = 349

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 175/357 (49%), Gaps = 25/357 (7%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV     +K+          S+   +P++K+  +  G   N + AIL   +FF   G  
Sbjct: 62  GYVKLKGMDKEENETNESANDSYAQKSPFQKLWILFGGAFFNFLFAIL--VYFFLALGGE 119

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
            V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + R 
Sbjct: 120 KVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVV-AHARGELVLEIERN 176

Query: 176 HVGVLHLKVMPR----LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
           H  VL  ++ P+    + D+ D   I +    +GI     +T + S ++ Q+F + L   
Sbjct: 177 H-QVLEKRLTPKIVALISDSNDPNEIIKY-KVIGIKPDMQKTGVISYSLFQAFEKALSRF 234

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
                  +  L         + ++SG VGI     +      +  + F A  S  +G +N
Sbjct: 235 KEGVVLIVDSLRRLITGSASVKELSGVVGIVGALSH--ASSVSMLLLFGAFLSINLGILN 292

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ NDI  L+
Sbjct: 293 LLPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGFLVFIMFLGLFNDITRLL 349


>gi|94985147|ref|YP_604511.1| peptidase M50 [Deinococcus geothermalis DSM 11300]
 gi|94555428|gb|ABF45342.1| peptidase M50 and PDZ domain [Deinococcus geothermalis DSM 11300]
          Length = 372

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 98/362 (27%), Positives = 160/362 (44%), Gaps = 34/362 (9%)

Query: 8   LLYTVSLI-IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           LL+T+ +I +   +HE  H+ +AR   + V +FSVG GP L+    R G  W++SL+P+G
Sbjct: 16  LLWTLVIIGVATFLHELAHFALARWQGVAVKTFSVGMGPVLLRRVWR-GTEWRLSLLPIG 74

Query: 67  GYVSFS-------ED---EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV           D    +  R F     W K+  +LAGPL N V+A+   T  F   G
Sbjct: 75  GYVEIDGMAPAEGPDGVYRQPTRGFAALPNWGKVAVLLAGPLMNLVLALGLMTVTFTAQG 134

Query: 117 VMKP---VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV--APYVRENPLHEI--- 168
           V  P    +  V P S A   G++ GD I +++G  +     V   P+     L +    
Sbjct: 135 VPAPDRARIEAVLPGSRAQALGLQAGDVITAINGRNLPHTYTVNGQPHAGWESLRDTLAT 194

Query: 169 ----SLVLYREHVG-VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQS 223
               +L + R      +      R+     R GI+      G         L  +T LQ+
Sbjct: 195 SGPKTLTVVRNGAAREISFNWQARVNGIQQRLGIQ-----YGPDVQPASVPLALKTSLQT 249

Query: 224 FSRGLDEISSITRGFLGVLSSAFGKDTRLNQ-ISGPVGIARIAKNFFDHGFNAYIAFLAM 282
            +   + +  + R F  +    F  D   +Q +SGP+G A+I          A +    +
Sbjct: 250 TA---EAVPQLLRAFGNLFVRFFTLDLSQDQNVSGPIGTAQIVSQAAALSPWALVQVAIL 306

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            + ++ F NL+PIP LDGG ++  L+  +RG+ L ++  + I   G   ++ L    +  
Sbjct: 307 LNLSLAFFNLIPIPGLDGGRILLVLMSALRGRPLTLAQEQAINFAGFAFVMLLMTFVVVR 366

Query: 343 DI 344
           D+
Sbjct: 367 DV 368


>gi|254778962|ref|YP_003057067.1| putative peptidase M50 (membrane-associated zinc metallopeptidase),
           MEROPS family; putative membrane protein [Helicobacter
           pylori B38]
 gi|254000873|emb|CAX28807.1| Putative peptidase M50 (membrane-associated zinc metallopeptidase),
           MEROPS family; putative membrane protein [Helicobacter
           pylori B38]
          Length = 348

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/356 (26%), Positives = 180/356 (50%), Gaps = 23/356 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+++AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 2   FIVAVLMLAFLIFVHELGHFIIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 60

Query: 67  GYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV     +K+          S+   +P++K+  +  G   N + AIL + FF   +G  
Sbjct: 61  GYVKLKGMDKEENGTNETANDSYAQKSPFQKLWILFGGAFFNFLFAILVY-FFLALSGEK 119

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           V+ P++ ++  ++    AG+ KGD I+S++   +++F E+   V      E+ L + R H
Sbjct: 120 VLLPIIGDLEKSTLE--AGLLKGDKILSINHEKIASFREIRSVV-ARARGELILEIERNH 176

Query: 177 VGVLHLKVMPR----LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
             +L  ++ P+    + D+ D   + R   ++GI     +T + S +++Q+F + L    
Sbjct: 177 -QILEKQLTPKIVAVISDSNDPNEMIR-YKAIGIKPDMQKTGVISYSLIQAFKQALSRFK 234

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
                    L       + + ++SG +GI     +   +  +  + F A  S  +G +NL
Sbjct: 235 EGVVLIGDSLRRLIMGSSSVKELSGVIGIVGALSH--ANSLSMLLLFGAFLSINLGILNL 292

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ NDI  L+
Sbjct: 293 LPIPALDGAQMLGVVFKNIFHIALPTPIQNALWLAGVGFLVFVMFLGLFNDITRLL 348


>gi|302670322|ref|YP_003830282.1| peptidase M50 family protein [Butyrivibrio proteoclasticus B316]
 gi|302394795|gb|ADL33700.1| peptidase M50 family [Butyrivibrio proteoclasticus B316]
          Length = 350

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 99/349 (28%), Positives = 160/349 (45%), Gaps = 37/349 (10%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           ++V  HEFGH++VA+   IRV  F +G GP  I    +    + + L+P+GG   F    
Sbjct: 14  VLVASHEFGHFIVAKSGGIRVNEFFIGMGPT-IWKKQKGETLYSIKLLPIGGACVFDGMD 72

Query: 73  --EDEK---DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSP 127
              +EK   D RSF  A  W++I T+ AGP AN ++A +        +    PV+SN++ 
Sbjct: 73  PIAEEKEGYDERSFLNAPVWRRIATLFAGPFANFIIAYILAVVLVNFSTWDFPVISNMTE 132

Query: 128 ASPAAIAGVKKGDCIISLDGITVSAFEEV---APYVRENPLHEISLVLYREHVGVLHLKV 184
            S A  AG++ GD  IS+DG  V    EV   + +   +P+     ++Y          +
Sbjct: 133 DSAAVEAGMQVGDKFISVDGEKVYMAGEVTLISQFAEGSPME----IVYERDGQRYTTTL 188

Query: 185 MPRLQDTVDRFGIKRQVPSVGISF-SYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLS 243
            P+  D   R+        +GI    Y E K       QS       +    +     L+
Sbjct: 189 QPKYSDEAHRY-------YMGIYLGEYGEVKGP-----QSLKYAWYNVRYYFKATYRSLA 236

Query: 244 SAFGKDTRLNQISGPVGIARIAKNFFD----HGFNAYI----AFLAMFSWAIGFMNLLPI 295
             F      + +SGPVG+ ++  + ++    +G +A +    +   + S  +G MNLLPI
Sbjct: 237 LLFKGRLTADDVSGPVGMVKMVDDTYEEVKPYGISAVVLTMLSLTVLLSVNLGVMNLLPI 296

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           P LDGG L+   +E+I GK +       +  +G+  +L L    + NDI
Sbjct: 297 PALDGGRLVFQFIEVIFGKPVPPEKEGFVHMIGMVALLGLMVFVLFNDI 345


>gi|295098987|emb|CBK88076.1| RIP metalloprotease RseP [Eubacterium cylindroides T2-87]
          Length = 357

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 101/359 (28%), Positives = 159/359 (44%), Gaps = 40/359 (11%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + V L +I+V+HE GH +VA+   +    FS+G GP L     +    + +  IP GGYV
Sbjct: 9   FIVLLSVIIVVHELGHMLVAKHFGVYCHEFSLGMGPVLYQKKGKE-TTYSIRAIPFGGYV 67

Query: 70  SFSEDEK--------------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT 115
             + +E               + R       ++K+L +LAG + N ++A + F       
Sbjct: 68  LMAGEEDGSQDDETEWLKEVPENRKLTSKPTYQKVLVMLAGVIMNFLLAWVIFIGISLAN 127

Query: 116 GVMK----PVVSNVSPASPAAIAGVKKGDCIISL--DGITVSAFEEVAPYVRENPLHEIS 169
           G  +    PVV  V   SPA+ AG++K D IIS   DG      EE+ P  + + L  + 
Sbjct: 128 GYRQSDPLPVVYEVIENSPASEAGLQKDDEIISARADG------EEIKPETQYDLLKFVQ 181

Query: 170 LVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYD-ETKLHSRTVLQSFSRGL 228
           L     H   L + V    Q+       +    S G +  Y     L       SF  G 
Sbjct: 182 L-----HHDTLEITVSRNGQEFETTITPEYDKESQGYTLGYTVAAYLEPIPWYMSFVEGT 236

Query: 229 DEISSITRGF---LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSW 285
            ++   T      LG+L S       L+Q+SGPVGI  +     + G NAY++ + + S 
Sbjct: 237 KDLWDSTVEIYQSLGLLLSG----QALDQLSGPVGILNVTARTAELGLNAYLSLVGLISV 292

Query: 286 AIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
            +G  NL+PIP LDGG ++  L+E I  + +  ++   +  +   ++L L      NDI
Sbjct: 293 NVGIFNLIPIPALDGGRVLVLLIEKILRRKINTALVENVIMISFVLLLGLMIFATYNDI 351


>gi|297379483|gb|ADI34370.1| membrane-associated zinc metalloprotease [Helicobacter pylori
           v225d]
          Length = 350

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 177/359 (49%), Gaps = 28/359 (7%)

Query: 9   LYTVSLIII---VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
           ++TV+++++   + +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPL
Sbjct: 1   MFTVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPL 59

Query: 66  GGYVSFSEDEKDMR----------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT 115
           GGYV     +K+            S+   +P++K+  +  G   N + AIL   +FF   
Sbjct: 60  GGYVKLKGMDKEENETNEVNQANDSYAQKSPFQKLWILFGGAFFNFLFAIL--VYFFLAL 117

Query: 116 G---VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
           G   V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L +
Sbjct: 118 GGEKVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVVV-HARGELVLEI 174

Query: 173 YREHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLD 229
            R H  VL  ++ P++   +       ++     +GI     ET + S ++ Q+F + L 
Sbjct: 175 ERNH-QVLEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQETGVVSYSLFQAFEKALS 233

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
                    +  L         + ++SG VGI     +      +  + F A  S  +G 
Sbjct: 234 RFKEGVVLIVDSLRRLITGSASVKELSGVVGIVGALSH--ASSVSMLLLFGAFLSINLGI 291

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +NLLPIP LDG  ++  + + I   +L   +   +   G+ +++F+ FLG+ ND+  L+
Sbjct: 292 LNLLPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGLLVFIMFLGLFNDLTRLL 350


>gi|291459113|ref|ZP_06598503.1| RIP metalloprotease RseP [Oribacterium sp. oral taxon 078 str.
           F0262]
 gi|291418367|gb|EFE92086.1| RIP metalloprotease RseP [Oribacterium sp. oral taxon 078 str.
           F0262]
          Length = 396

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 109/388 (28%), Positives = 165/388 (42%), Gaps = 60/388 (15%)

Query: 12  VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY--- 68
           ++L  ++  HE GH+++A+ C + VL FSVG GP LI    R+  R+ + L+P GG    
Sbjct: 8   LALGFLIFFHELGHFLMAKACGVGVLEFSVGMGPRLISRVFRN-TRYSLKLLPFGGSCAM 66

Query: 69  ----------------------------------VSFSEDEKDMRSFFCAAPWKKILTVL 94
                                             V + E E   RSF     W++ L   
Sbjct: 67  LGEDSAGSGDFSTADGEIMEEEREEEDPWIDFDGVRYRESELSRRSFQNRPGWQRFLICF 126

Query: 95  AGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCI--ISLDGIT--- 149
            G   N ++A L   F  + +G+ +PV+    P S A  AG ++GD +  ISLDG     
Sbjct: 127 GGVFHNLLLAFLLALFVVHFSGMDRPVIDAAQPGSSAESAGFERGDLLSGISLDGKRFRR 186

Query: 150 VSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG--IKRQVPSVGIS 207
           +  F E+  ++    LH  S+    +   VL L+     ++   +F     ++     + 
Sbjct: 187 IETFRELYLWLY---LHSDSI----KENSVLELRCQRNGREERMKFSPWYDKESGKYRLG 239

Query: 208 FSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKN 267
             +   ++   TV  SF     E+          L   F    R N++ GPVG   +  +
Sbjct: 240 LEFSGKRVRPETVGDSFLYAYQELRYNVVVVFDSLQLLFRGRIRRNELMGPVGTVTVIGD 299

Query: 268 FFDHG-----FNAYIAFLA---MFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVS 319
             +       FNA++  L    M S  +  MNLLPIP LDGG L+  LLEMI  K L   
Sbjct: 300 TVEQSTRYGLFNAFLVLLNLCIMLSANLAVMNLLPIPALDGGRLLFILLEMISRKRLNPK 359

Query: 320 VTRVITRMGLCIILFLFFLGIRNDIYGL 347
           V   I R+G+ ++L L  L   NDI  L
Sbjct: 360 VEETINRIGMIVLLLLMALIFLNDIVNL 387


>gi|291550821|emb|CBL27083.1| RIP metalloprotease RseP [Ruminococcus torques L2-14]
          Length = 343

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 164/352 (46%), Gaps = 41/352 (11%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           IV+ HE GH+++A+   IRV  FS+G GP + G       ++ + L+P GG     ED+ 
Sbjct: 13  IVIFHELGHFLLAKKNKIRVDEFSLGLGPTIFG-KQFGETKFSLKLLPFGGACMMGEDDV 71

Query: 77  D---MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAI 133
           D     SF   + W ++  ++AGP+ N ++A +        TG   P+VSNV+    A  
Sbjct: 72  DDMSEGSFNSKSVWARMSVIVAGPVFNLILAWILCMIIIGWTGYRAPIVSNVTDGYSAQE 131

Query: 134 AGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE--ISLVLYREHVGVLHLKVMPRLQDT 191
            G++ GD I  + G +V  + +++ Y   N +H    S+ +  E  G  +  V+   Q+ 
Sbjct: 132 EGIEPGDVIKKIGGKSVYIWNDISLY---NMMHAGTKSVEVEYERDGKDYTVVLEPKQNA 188

Query: 192 VDRFGIKRQVPSVGISFS-------YDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSS 244
            D F      P +GI+         +   +  + TV    +  +D +  +  G +GV   
Sbjct: 189 GDAF------PLLGITGGEMVRPGLFGTVRYGAYTVKYWITYTVDSLKMLVGGKVGV--- 239

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFL--------AMFSWAIGFMNLLPIP 296
              KD     +SGPVGI     N +     A +  +         + +  +G MNLLP+P
Sbjct: 240 ---KD-----LSGPVGIVSAVDNVYQEAAPAGMVVVILNLLNIGVLLTANLGVMNLLPLP 291

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            LDGG L+  ++E +RGK +      ++   G  +++ L  + + NDI  L+
Sbjct: 292 ALDGGRLVFLIIEAVRGKRVPPEKEGMVHFAGFVLLMALMVVIMFNDILKLV 343


>gi|332673099|gb|AEE69916.1| RIP metalloprotease RseP [Helicobacter pylori 83]
          Length = 349

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 96/356 (26%), Positives = 171/356 (48%), Gaps = 23/356 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV     +K+          S+    P++K+  +  G   N + AIL   +FF   G  
Sbjct: 62  GYVKLKGMDKEENETNESANDSYAQKNPFQKLWILFGGAFFNFLFAIL--VYFFLALGGE 119

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
            V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V      E+ L + R 
Sbjct: 120 KVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVV-ARARGELVLEIERN 176

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
           H  +L  ++ P++   +       ++     +GI     +T + S ++ Q+F + L    
Sbjct: 177 H-QILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVVSYSLFQAFEQALSRFK 235

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
                    L         + ++SG VGI     +      +  + F A  S  +G +NL
Sbjct: 236 EGVVLIADSLRRLIMGSASVKELSGVVGIVGALSH--ASSLSMLLLFGAFLSINLGILNL 293

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIP LDG  ++  + + I   +L   V   +   G+ +++F+ FLG+ NDI  L+
Sbjct: 294 LPIPALDGAQMLGVVFKNIFKITLPAFVQNALWLAGVGLLVFIMFLGLFNDITRLL 349


>gi|308063120|gb|ADO05007.1| hypothetical protein HPSAT_01290 [Helicobacter pylori Sat464]
          Length = 351

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 174/358 (48%), Gaps = 25/358 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR----------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV     +K+            S+   +P++K+  +  G   N + AIL   +FF   G
Sbjct: 62  GYVKLKGMDKEENETNETNQVHDSYVQKSPFQKLWILFGGAFFNFLFAIL--VYFFLALG 119

Query: 117 ---VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + 
Sbjct: 120 GEKVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVV-AHARGELVLEIE 176

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDE 230
           R H  +L  ++ P++   +       ++     +GI     +T + S ++ Q+F + L  
Sbjct: 177 RNH-QILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVVSYSLFQAFEKALSR 235

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
                   +  L      +  + ++SG VGI     +      +  + F A  S  +G +
Sbjct: 236 FKEGVVLIVDSLRRLITGNASVKELSGVVGIVGALSH--ASSVSMLLLFGAFLSINLGIL 293

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NLLPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ ND+  L+
Sbjct: 294 NLLPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGFLVFIMFLGLFNDLTRLL 351


>gi|114569937|ref|YP_756617.1| putative membrane-associated zinc metalloprotease [Maricaulis maris
           MCS10]
 gi|114340399|gb|ABI65679.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Maricaulis
           maris MCS10]
          Length = 480

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 118/245 (48%), Gaps = 28/245 (11%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF---- 71
           I+VVIHE GHY   R C +   +FS+GFGP L     + G  W+V+ +PLGGYV F    
Sbjct: 20  IVVVIHELGHYWAGRFCGVHAEAFSMGFGPTLFSWRDKRGTVWRVAALPLGGYVKFLGDA 79

Query: 72  ---SEDEKDM-------------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT 115
              SE + D              R +     W++     AGP+AN ++AI  F       
Sbjct: 80  GAASEPDADKLAQLRAQMGEAADRCYHFKPIWQRAFITAAGPIANFILAITIFAALSLTL 139

Query: 116 G--VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
           G   ++PVV  V   SPA  AG++ GD ++++DG  V AF ++   V      E+++ + 
Sbjct: 140 GNRELQPVVGAVVADSPADNAGIRVGDRVVAIDGREVRAFNDIMRIVISGGTSELAVDIE 199

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDE----TKLHSRTVLQSFSRGLD 229
           R+   ++ L+++       D FG  R++P +GI    D      +  S   L  F  G D
Sbjct: 200 RDGT-LIPLQIVAARNTVEDEFGGTRRLPQLGIQAFSDPVVGGVEPGSPAALAGFEPG-D 257

Query: 230 EISSI 234
            I+S+
Sbjct: 258 RIASL 262



 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 111/253 (43%), Gaps = 35/253 (13%)

Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178
            PVV  V P SPAA+AG + GD I SLDG+ V++F++ +  V       +  V       
Sbjct: 236 DPVVGGVEPGSPAALAGFEPGDRIASLDGLPVASFQQFSQLVVA--ADGVVPVEIERDGQ 293

Query: 179 VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSR---------GLD 229
            + L V PR  +T D         +  +S +Y    L S   L  + R         G+ 
Sbjct: 294 AMTLTVSPR--ETPDG--------ATNVSPAYARLGLVSGGRLIEYRRYNPIEAVGYGIS 343

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDH-------GFNAYIAFL-- 280
           +  ++    +  +++          ++GP+GIA  A              F+A  A L  
Sbjct: 344 QTGAVVSTTVDYVTNIITGRASPELLNGPLGIATAAGQVAQRSIEGHSSAFDAARALLVN 403

Query: 281 -----AMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335
                 + S  +G +NLLPIPILDGGHL+ +  E +  + L +    +  R+GL  +L L
Sbjct: 404 LINLAGVLSVGLGLVNLLPIPILDGGHLVYYGYEAVARRPLSMQAQALGFRVGLVFVLGL 463

Query: 336 FFLGIRNDIYGLM 348
             +   ND+  L+
Sbjct: 464 MLVATWNDLNYLL 476


>gi|296132877|ref|YP_003640124.1| membrane-associated zinc metalloprotease [Thermincola sp. JR]
 gi|296031455|gb|ADG82223.1| membrane-associated zinc metalloprotease [Thermincola potens JR]
          Length = 366

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 151/332 (45%), Gaps = 45/332 (13%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           ++++ HE GH++VA+L  ++V  FS+GFGP +     +    + +  +PLGG+V  +   
Sbjct: 22  MMIIFHELGHFLVAKLMGVQVFEFSIGFGPRIYRFV-KGETFYTLRALPLGGFVRMAGMD 80

Query: 73  --EDEKDM---------------------RSFFCAAPWKKILTVLAGPLANCVMAILFFT 109
             ED ++M                     RSF      ++I  + AGPL N V+A+  + 
Sbjct: 81  AEEDNREMEKRKELCAEKGVDFDFCVDPERSFTNKGALQRIAVIAAGPLMNFVLAVFLYA 140

Query: 110 FFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEIS 169
             +   G+   V+  VSP  PAA AG+K GD +++++   V  +E +   +  +   +++
Sbjct: 141 IMYAYIGLPVNVIKEVSPGKPAAAAGIKPGDKVVAVNNKPVRTWEGLVDVIHNSANKKVT 200

Query: 170 LVLYREHVGVLHLKVMPRLQDT--VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRG 227
           L + R++       V+P L  T  +   GI   +   GI  S     +H+  VL      
Sbjct: 201 LTVERDN-RRQSFTVVPELDKTNKIGLIGIAPVIERPGILKSISLGTVHTYRVL------ 253

Query: 228 LDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAI 287
                 +T  FLG +   F K   + ++SGPV I        + G    I      S  I
Sbjct: 254 -----VLTFDFLGKM---FAKQVPV-ELSGPVRITMELGKAAEMGIMPLIQLAGFLSIQI 304

Query: 288 GFMNLLPIPILDGGHLITFLLEMIRGKSLGVS 319
           G  NL PIP LDG  +I   +E +RG+ +  S
Sbjct: 305 GLFNLFPIPALDGSRIIFLGIEGLRGRPVDPS 336


>gi|119386705|ref|YP_917760.1| putative membrane-associated zinc metalloprotease [Paracoccus
           denitrificans PD1222]
 gi|119377300|gb|ABL72064.1| site-2 protease, Metallo peptidase, MEROPS family M50B [Paracoccus
           denitrificans PD1222]
          Length = 441

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 123/234 (52%), Gaps = 11/234 (4%)

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           M P+V+ ++P SPAA AG+K GD I+++DG  VS F+E+  +V E     + L ++RE  
Sbjct: 211 MPPLVTGIAPRSPAATAGLKPGDVILAIDGEPVSRFDELRRHVAEAEGRPVLLKVWREGE 270

Query: 178 GVLHLKVMPRLQD--TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSF----SRGLDEI 231
           G     +  R QD  T D +  +R +  V    +Y E       + ++     +R  D I
Sbjct: 271 GEADYTLAAREQDLPTGDGYA-RRWLIGVTGGGTYFEPATRPAAMGEALGIGAARTWDII 329

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
           +S   G   +++   G       + G + IA         G   +I ++A+ S AIGF+N
Sbjct: 330 ASSVSGLWAMITGQIGS----CNLGGAISIAETTGQAASAGGGNFIWWIAVLSAAIGFLN 385

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIY 345
           LLP+P+LDGGHL+ +L E + G+     V  +++ +GL  +L L  LG+ ND++
Sbjct: 386 LLPVPVLDGGHLMFYLYEAVAGRRPSDRVMDILSALGLAAVLSLMVLGLTNDLF 439



 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 97/199 (48%), Gaps = 22/199 (11%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + V+L +IV +HE+GHY++ RLC I+   FS+GFGP L     R G  W+V+ IPLGGYV
Sbjct: 18  FIVALSVIVTVHEYGHYIIGRLCGIKAEVFSLGFGPRLAARRDRHGTVWQVAAIPLGGYV 77

Query: 70  SF------------SEDEKDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTG 116
            F              D    R     AP W +  TV AGP+ N +++IL F       G
Sbjct: 78  RFLGDADAASAGSVPVDPARARQSLTGAPLWARFATVAAGPVFNFILSILVFAGMAIWQG 137

Query: 117 VMKPV----VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRE---NPLHEIS 169
           +  PV    V  + P  P     ++ GD +++LDG  V+ + ++     E    P H+ +
Sbjct: 138 L--PVDEVRVGQLHPTPPGVEMQLQPGDRVLALDGRPVANWRDLGAAAGELPSRPSHDWT 195

Query: 170 LVLYREHVGVLHLKVMPRL 188
           ++     + V     MP L
Sbjct: 196 VLRDGTEITVPGPDPMPPL 214


>gi|93006533|ref|YP_580970.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Psychrobacter cryohalolentis K5]
 gi|92394211|gb|ABE75486.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Psychrobacter cryohalolentis K5]
          Length = 457

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 102/163 (62%), Gaps = 15/163 (9%)

Query: 6   CFLLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITS-RSGVRWKV 60
            FLL  ++ I +    + +HE+GHY+VARLC +RVL++S+GFGP+L G TS +SG+ +++
Sbjct: 2   TFLLTLLAAIFVLGPLIALHEWGHYIVARLCGVRVLTYSIGFGPKLFGWTSKKSGIDYRI 61

Query: 61  SLIPLGGYVSF--------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAI-LFFTFF 111
           S +PLGGYV          ++DE+ + +F    P KKI  V AGP+ N V+AI LF+  F
Sbjct: 62  SALPLGGYVKMLDEREGEVAKDEQHL-AFNRQHPLKKIAIVAAGPIMNFVIAIALFWVLF 120

Query: 112 FYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFE 154
              +  +   +  V P +PAAIA +  GD I+++DG  V  +E
Sbjct: 121 MTPSEQLATKIGQVLPDTPAAIAQLPAGDKIVAIDGHDVQTWE 163



 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 128/233 (54%), Gaps = 14/233 (6%)

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
           P+V +V+P   A+  G+K GD I +++   ++ +      +R+NP   ++  + R    +
Sbjct: 227 PIVGDVTPDGAASRQGLKAGDRITAINDEAINDWISATRIIRDNPETLLTFSVLRNDKPI 286

Query: 180 LHLKVMPR-----LQDTVDRFGIKRQVPSVGISFSYDETKLH--SRTVLQSFSRGLDEIS 232
             L++MP+     L +   + G       + I  +Y  T ++  + ++++SF +  ++++
Sbjct: 287 -ELQIMPQGKKDNLGNDYGQIGAMVAQSEIVIPDAYKTTVVYGPAESLIKSFEK-TEQLA 344

Query: 233 SITRGFLG-VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
            +T   +G +LS   G    L+ +SGP+ IA++AK  FD  +   ++  A+ S ++  +N
Sbjct: 345 VMTVSSMGKMLSGMIG----LDNLSGPITIAKVAKQSFDISWQMVLSTAALISLSLAVLN 400

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LLPIP+LDGGH++ +L+E+IRGK L   V  V   +GL ++     L I NDI
Sbjct: 401 LLPIPVLDGGHIVYYLIELIRGKPLSEGVQMVGLNIGLLLLAGFMVLAIGNDI 453


>gi|308184063|ref|YP_003928196.1| hypothetical protein HPSJM_01415 [Helicobacter pylori SJM180]
 gi|308059983|gb|ADO01879.1| hypothetical protein HPSJM_01415 [Helicobacter pylori SJM180]
          Length = 349

 Score =  119 bits (298), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 95/356 (26%), Positives = 172/356 (48%), Gaps = 23/356 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV     +K+          S+   +P++K+  +  G   N + AIL   +FF   G  
Sbjct: 62  GYVKLKGMDKEENETNESANDSYAQKSPFQKLWILFGGAFFNFLFAIL--VYFFLALGGE 119

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
            V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V      E+ L + R 
Sbjct: 120 KVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRDVVAHAK-GELVLEIERN 176

Query: 176 HVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
           H  +L  ++ P++   +       ++     +GI     +T + S ++ Q+F + L    
Sbjct: 177 H-QILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVISYSLFQAFEKALSRFK 235

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
                 +  L         + ++SG VGI     +      +  + F A  S  +G +NL
Sbjct: 236 EGVVLIVDSLRRLITGSASVKELSGVVGIVGALSH--ASSVSMLLLFGAFLSINLGILNL 293

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIP LDG  ++  + + I    L   +   +  +G+  ++F+ FLG+ NDI  L+
Sbjct: 294 LPIPALDGAQMLGVVFKNIFKIILPAFMQNALWLVGVGFLVFIMFLGLFNDITRLL 349


>gi|317008908|gb|ADU79488.1| hypothetical protein HPIN_01160 [Helicobacter pylori India7]
          Length = 350

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 177/357 (49%), Gaps = 24/357 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR---------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG- 116
           GYV     +K+ +         S+   +P++K+  +  G   N + A+L + FF   +G 
Sbjct: 62  GYVKLKGMDKEEKGINETQADDSYAQKSPFQKLWILFGGAFFNFLFAVLVY-FFLALSGE 120

Query: 117 -VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE 175
            V+ P++  +     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + R 
Sbjct: 121 KVLLPIIGGLE--KNALEAGLLKGDKILSINHKKIASFREIRSLV-AHARGELVLEIERN 177

Query: 176 HVGVLHLKVMPRL----QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
           H  +L  ++ P++     D+ D   I  Q   +GI     +  + S +++Q+F + L   
Sbjct: 178 H-QILEKRLTPKIVAIISDSNDPNEI-IQYKIIGIKPDMQKMGVVSYSLIQAFKQALSRF 235

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
                     L         + ++SG VGI     +   +  +  + F A  S  +G +N
Sbjct: 236 EEGVVLIGDSLRRLIMGSASVKELSGVVGIVGALSH--ANNLSMLLLFGAFLSINLGILN 293

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDG  ++  + + I   +L   +   +   G+ +++F+ FLG+ NDI  L+
Sbjct: 294 LLPIPALDGAQMLGVVFKNIFHITLPTPIQNALWLAGVGLLVFIMFLGLFNDITRLL 350


>gi|188527065|ref|YP_001909752.1| hypothetical protein HPSH_01340 [Helicobacter pylori Shi470]
 gi|188143305|gb|ACD47722.1| hypothetical protein HPSH_01340 [Helicobacter pylori Shi470]
          Length = 351

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 95/358 (26%), Positives = 173/358 (48%), Gaps = 25/358 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR----------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV     +K+            S+   +P++K+  +  G   N + AIL   +FF   G
Sbjct: 62  GYVKLKGMDKEENETNETNQVHDSYAQKSPFQKLWILFGGAFFNFLFAIL--VYFFLALG 119

Query: 117 ---VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLY 173
              V+ PV+ ++     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + 
Sbjct: 120 GEKVLLPVIGDLE--KNALEAGLLKGDKILSINHKKIASFREIRSVVARSR-GELVLEIE 176

Query: 174 REHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDE 230
           R H  VL  ++ P++   +       ++     +GI     +T + S ++ Q+F + L  
Sbjct: 177 RNH-QVLEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVVSYSLFQAFEKALSR 235

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
                   +  L         + ++SG VGI     +      +  + F A  S  +G +
Sbjct: 236 FKEGVVLIVDSLRRLITGSASVKELSGVVGIVGALSH--ASSVSMLLLFGAFLSINLGIL 293

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NLLPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ ND+  L+
Sbjct: 294 NLLPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGFLVFIMFLGLFNDLTRLL 351


>gi|220903792|ref|YP_002479104.1| membrane-associated zinc metalloprotease [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219868091|gb|ACL48426.1| membrane-associated zinc metalloprotease [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 396

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 103/386 (26%), Positives = 172/386 (44%), Gaps = 48/386 (12%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   +  T+ L  ++  HE GH+ VAR   + V +FS+GFGP+++         + +SLI
Sbjct: 2   LTTIIAVTLVLGGLIFFHELGHFAVARGFGMGVSTFSLGFGPKIL-KRKWGKTEYALSLI 60

Query: 64  PLGGYVSFSEDEKD---------MRSFFCAAPWKKILTVLAGPLANCVMAIL--FFTFFF 112
           PLGGYV+   ++ D           SF     W+++L V AGP+AN ++A L  +   F 
Sbjct: 61  PLGGYVALVGEQDDSELPEGFTREESFSLRPAWQRLLVVAAGPVANMLLAWLLCWILAFG 120

Query: 113 YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
           + T  + P V  +    PAA AGV+ GD I+S++G  +  +E++   +  +    + + L
Sbjct: 121 WGTPQLLPQVGGLVEDGPAARAGVEAGDTIVSINGQPIVDWEDMTRAIAASDGQAMLVKL 180

Query: 173 YREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISF---SYDETKLHSRTVLQSFSRGLD 229
            R H       V P+  +     G   Q  + G +    S    ++     ++    G D
Sbjct: 181 KRPHRAE---SVAPQADEGATAQGSHAQTAANGDAIAPASLLTVEIRPEMAVRKTIFGED 237

Query: 230 E------------ISSITRGFLGVLSSAFGKDTR------------------LNQISGPV 259
           E            +  +  GF G   +   + +                   L+Q+ GP+
Sbjct: 238 EKAWLVGIRNTGAVRLVEHGFWGAAVAGASQTSNMLALTWKSFVKLVERVVPLDQVGGPI 297

Query: 260 GIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVS 319
            I ++       G    +A  A+ S  +G +NLLPIP+LDGG ++  L EMI  + +   
Sbjct: 298 MIMQMVGKQAHEGMAGLLALAALISINLGVLNLLPIPVLDGGQIVFCLWEMIFRRPVNAR 357

Query: 320 VTRVITRMGLCIILFLFFLGIRNDIY 345
           V     R GL +++ L  L   NDI+
Sbjct: 358 VQDYAMRAGLALLVTLMLLATYNDIW 383


>gi|294101869|ref|YP_003553727.1| membrane-associated zinc metalloprotease [Aminobacterium
           colombiense DSM 12261]
 gi|293616849|gb|ADE57003.1| membrane-associated zinc metalloprotease [Aminobacterium
           colombiense DSM 12261]
          Length = 345

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 94/327 (28%), Positives = 152/327 (46%), Gaps = 31/327 (9%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS--- 72
           I VV HE+GHY  A+ C ++V  F+ G GP L     R  + W +   P+GG+V  +   
Sbjct: 14  ICVVTHEYGHYRTAKACGVQVHEFAFGMGPVLWQKKGRETL-WSIRAFPVGGFVRLAGMD 72

Query: 73  -----EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMK---PVVSN 124
                E+ K+ + F     W++   +L GPL N ++A+     F    GV+    PVV +
Sbjct: 73  EEQPGEEVKEGKGFNDKKAWQRFFILLNGPLVNILLAMALTAIFLSAHGVIDMSSPVVGD 132

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLK- 183
           +    PA    ++ GD I +++G+ VS +  +A  +R+    E  + L  E  G L LK 
Sbjct: 133 IMENLPAQHIELQPGDIIRTVNGVHVSDWPSMAKAIRDEA-KEGPVTLEIERGGQLLLKE 191

Query: 184 -VMP-RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
             +P   +      GI+  +   G+  ++  T   S TV  S    ++ I  I R  L  
Sbjct: 192 VAIPYSAKYGAQLLGIRPPMMRYGLLSAW--TNAFSYTVNMS----VEMIQGIVRWVL-- 243

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
                    +   +SGP+GIA +A      G   +I+FL++ +  +G +NL P P LDGG
Sbjct: 244 -------QAQDVDVSGPIGIATMAGEAAKQGIWPFISFLSLINLNLGLINLFPFPALDGG 296

Query: 302 HLITFLLEMIRGKSLGVSVTRVITRMG 328
            L+  + E++  K L   +   I   G
Sbjct: 297 RLVFIVGEIVTKKRLPERIENFIHLAG 323


>gi|116072763|ref|ZP_01470029.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Synechococcus sp. BL107]
 gi|116064650|gb|EAU70410.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Synechococcus sp. BL107]
          Length = 360

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 147/310 (47%), Gaps = 24/310 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMR- 79
           HE GH++ A L  IRV  FS+GFGP LI    R GV + + L+PLGG+V+F +D++D   
Sbjct: 17  HEAGHFLAATLQGIRVSGFSIGFGPALI-KRQRKGVTYALRLLPLGGFVAFPDDDEDSTI 75

Query: 80  -----SFFCAAPW-KKILTVLAGPLANCVMAILFFTFFFYNTGV-MKP----VVSNVSPA 128
                      P  ++ L + AG LAN  +A++         G+   P    +V NV P 
Sbjct: 76  PLDDPDLLRNRPIPQRALVIAAGILANLALALVILIGQAAIVGLPADPDPGVLVVNVQPD 135

Query: 129 SPAAIAGVKKGDCIISLD----GITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
             AA AG + GD I+S++    G   +  E +   V+  P   +++   R+   +  +++
Sbjct: 136 GAAARAGFRPGDQILSINSNKLGAGQAGVETMVKLVKAAPSMSLAVERVRQSQ-LEQIEL 194

Query: 185 MPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSS 244
            P   D   R G + Q     +S +          V  +  + +  +     G+ G++++
Sbjct: 195 KPSNVDGQGRIGAQLQA---NLSGAIRPVNGLGELVQHTGGQFVRLVGQTASGYAGLITN 251

Query: 245 AFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLI 304
                    Q+SGPV I  +       G +  + F+A+ S  +  +N LP+P+LDGG + 
Sbjct: 252 F---KATAGQVSGPVKIVEMGAQLSRQGGSGLVLFMALISINLAVLNALPLPLLDGGQMA 308

Query: 305 TFLLEMIRGK 314
             L+E +RGK
Sbjct: 309 LLLIEGVRGK 318


>gi|332967727|gb|EGK06834.1| RIP metalloprotease RseP [Kingella kingae ATCC 23330]
          Length = 452

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 120/229 (52%), Gaps = 16/229 (6%)

Query: 125 VSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKV 184
           V   SPAA AG++KGD II+++G     +++    VREN    +S V ++     L  K+
Sbjct: 225 VGENSPAAKAGLQKGDQIIAINGTATPTWDDWTKIVRENAGANLS-VSFKRGEQTLQTKL 283

Query: 185 MPRLQDTVDRFGI---------KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
           MP   +  D+  I           +  +  +   Y  + LH+   LQ   + + + +S+T
Sbjct: 284 MPEPVELPDKSQIVGRVGVGVGADEAWAKQVRHHYYPSSLHA---LQLGWQKMVDYTSMT 340

Query: 236 RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPI 295
             F G L +    +  L+ ISGP+ IA +A      G+  YI FLA+ S ++G MNLLPI
Sbjct: 341 FSFFGKLVTG---NASLSHISGPITIAEVAGETAKIGWQPYIEFLALVSISLGAMNLLPI 397

Query: 296 PILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           P+LDGGHL+ +  E IRG+ L  +V  +  R+GL  +L +  L   NDI
Sbjct: 398 PVLDGGHLVYYTAEWIRGRPLSKAVQDMGLRLGLAAMLTMMILAFFNDI 446



 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 96/165 (58%), Gaps = 10/165 (6%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           M +L   + + ++++++V +HE GH +VAR C I+VL FSVGFG        R+ + W +
Sbjct: 1   MSFLQTLVAFLIAILLLVSLHELGHLLVARWCGIKVLRFSVGFGTPFYTKRWRN-IEWCL 59

Query: 61  SLIPLGGYVSFSE-------DEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY 113
           + IPLGGYV   +       DE    +F    P+K+I TV+AGPL N V+A+L +   F 
Sbjct: 60  APIPLGGYVKMVDTREGNVSDEDLPYAFDKQHPFKRIATVVAGPLTNLVLAVLLYWVSFV 119

Query: 114 NTGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV 156
             GV  ++P+V  V P + AA AG + GD I+ ++G  V  F +V
Sbjct: 120 LGGVHEVRPIVGTVHPNTLAAQAGFQVGDQIVRVNGEVVRTFADV 164


>gi|172035546|ref|YP_001802047.1| putative peptidase M50 [Cyanothece sp. ATCC 51142]
 gi|171697000|gb|ACB49981.1| putative peptidase M50 [Cyanothece sp. ATCC 51142]
          Length = 361

 Score =  119 bits (297), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 176/352 (50%), Gaps = 35/352 (9%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           LII++V+HE GH+  ARL  I V  FS+GFGP L     +    + +  IPLGG+V F +
Sbjct: 10  LIILIVVHELGHFSAARLQGIHVTRFSIGFGPVLAKYKGKE-TEYTLCAIPLGGFVGFPD 68

Query: 74  DEK------DMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVS- 123
           D+       D        P + + + + AG +AN + A           GV  ++P +S 
Sbjct: 69  DDPESNIAPDDPDLLRNRPIFDRAIVISAGVIANLIFAYFLLVGQTATIGVQELQPGLSI 128

Query: 124 -NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA----PYVRENPLHEISLVLYREHVG 178
             V   S A +AG++ GD I+S+D  ++  F +        V+ +    + L + RE   
Sbjct: 129 PQVDENSAAMVAGIESGDVILSVDNQSLGDFPDATTLFIEKVKNSAGQPLDLKVERED-K 187

Query: 179 VLHLKVMPRLQDTVD-RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT-- 235
           ++ L V+P   +  + + G+   +P+V ++         S+ +L++FS   +   ++T  
Sbjct: 188 IVDLTVIPEANEEGEGKIGVAL-LPNVQLN--------RSQNLLEAFSYSAEAYQNVTML 238

Query: 236 --RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
             +GF  ++S+ F ++ +  Q++GPV I     +  ++       F A+ S  +  +N L
Sbjct: 239 TLQGFWQLISN-FQENAK--QVAGPVKIVEYGASIAENNLGNLFQFGALISINLAIINTL 295

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL-FFLGIRNDI 344
           P+P LDGG L+  L+E + GK L + +   I + GL ++L L  F+ IR+ +
Sbjct: 296 PLPALDGGQLVFLLIEGLLGKPLPLKLQEGIMQTGLVLLLSLGIFIIIRDTV 347


>gi|146297350|ref|YP_001181121.1| putative membrane-associated zinc metalloprotease
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410926|gb|ABP67930.1| putative membrane-associated zinc metalloprotease
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 350

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 170/357 (47%), Gaps = 29/357 (8%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
            L+  + L I+++IHEFGH++V +L  + V  F++GFGP++  I  +    + V    +G
Sbjct: 4   LLIALIVLTIVILIHEFGHFIVCKLSGVLVEEFALGFGPKIFSIKGKE-TEYSVRAFLIG 62

Query: 67  GYVS-FSEDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVS 123
           GYV    ED++    R+   A   K+IL VL GPL N V+AI+      Y  G     + 
Sbjct: 63  GYVKPLGEDQEVDHPRALNKAKVHKRILMVLMGPLMNFVLAIVIMMGIGYFVGFGTNTIG 122

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLK 183
            V P  PA   G+K GD II LDG  V  +++V+ Y+    +H +   LY++    L +K
Sbjct: 123 KVEPTMPAYQVGIKPGDKIIELDGNRVFVWDQVSFYLA---VHNM---LYKDK--PLEVK 174

Query: 184 VMPRLQD----TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL 239
           V+   Q        ++    +   +GIS    +    +      F+    EI     G +
Sbjct: 175 VLRDGQVYSFFVTPKYDPNTKSKRIGISPKISQKNFLNSVYYSIFAT-YAEIKETIYGVV 233

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNA-YIAFLAMFSW-------AIGFMN 291
            +LS   GK +  +++ GPVGI +      + GF   +I+ L    W        +G +N
Sbjct: 234 LILS---GKVSG-SEVMGPVGIVKTIGQAANAGFKQNFISGLLNILWLMQLISVNLGVIN 289

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           L+P P LDG  L+ +L E + GK        +I  +G  ++L L  +   NDI  ++
Sbjct: 290 LIPFPALDGSRLVFYLYEAVVGKPFNREKEALIHTIGFVLLLLLLVIVTFNDIKNII 346


>gi|313679980|ref|YP_004057719.1| membrane-associated zinc metalloprotease [Oceanithermus profundus
           DSM 14977]
 gi|313152695|gb|ADR36546.1| membrane-associated zinc metalloprotease [Oceanithermus profundus
           DSM 14977]
          Length = 349

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 96/348 (27%), Positives = 160/348 (45%), Gaps = 34/348 (9%)

Query: 18  VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVS------- 70
           + IHE GHY+ ARL  +RV +FS+GFGP L+ +   +G  W++SLIPLGGY         
Sbjct: 15  IFIHELGHYLAARLQGVRVPAFSIGFGPPLLRM-RWAGTEWRLSLIPLGGYAEIEGMAPD 73

Query: 71  FSEDEKDM---RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPV-----V 122
           F+ + K +     F   A   K+L ++ G + N ++A     + +   G+ KPV     V
Sbjct: 74  FTPEGKPIPPRHGFAGLALPGKVLILVGGVIMNLLLAWFLMAWVYTAQGIPKPVETHAQV 133

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
            +V   S A   G++ GD I+++DG  +  + ++         H +++    + + +  +
Sbjct: 134 ISVVEGSLAQEIGLRPGDLIVAIDGRPLQHYTDLNEVKSRTGPHTLTVERQGKTIEIRFV 193

Query: 183 KVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSR--TVLQSFSRGLDE-ISSITRGFL 239
                   T D+ G++      G    Y+         T + +  R L E + S TRG  
Sbjct: 194 -----WDGTRDKLGVR-----YGPEVVYERPGFVRAFVTAVDTSLRFLPEMLRSFTRGLA 243

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILD 299
           G+L  +       N++ GPVGI  +A      G  A +   A+ + ++   NLLPIP LD
Sbjct: 244 GLLVGSPS-----NELVGPVGIVNLAGEAAKAGLMAVVQLAALINLSLAVFNLLPIPGLD 298

Query: 300 GGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           GG L+   L  + G  +      +I  +G   ++ L  L    D+  L
Sbjct: 299 GGRLLLVFLNAVSGGRIRPEHEALINFIGFVFLILLMVLVTFQDVQRL 346


>gi|256750781|ref|ZP_05491666.1| membrane-associated zinc metalloprotease [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256750364|gb|EEU63383.1| membrane-associated zinc metalloprotease [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 332

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 97/344 (28%), Positives = 156/344 (45%), Gaps = 22/344 (6%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             L+  + L ++V+ HEFGH++VA+L   RV  FS+GFGP L          +    +  
Sbjct: 2   TILISIIVLSVLVMFHEFGHFIVAKLSGSRVNEFSIGFGPRLFK-KKYGETEYSFRALLF 60

Query: 66  GGYVSFS-EDEK--DMRSFFCAAPWKKILTVLA-GPLANCVMAILFFTFFFYNTGVMKPV 121
           GGYV+   EDEK  D R+     PW   L V A GPL N ++A L     F++ G   P 
Sbjct: 61  GGYVALEGEDEKSNDPRAI-VNKPWPVRLAVFAAGPLMNILLAFLLLFIVFFSIGRPIPQ 119

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE-HVGVL 180
           + +V    PA  AG+  GD I+ ++   ++ +EE+   +      EI + + R+ ++   
Sbjct: 120 IKSVMEGYPAEKAGILPGDKIVMVNNTKINTWEELEKAISSTKDKEIQITIERDSNIITK 179

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240
            +K +   Q + +  GI   +P             + R++  +F+  +D+     +  + 
Sbjct: 180 DIKPVFDKQSSKNMIGI---IPE------------YKRSLPWAFTNAIDKTVYFLKMIVI 224

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
            L    G     N I GPVGI          G    + F A  S  +G  NLLP P LDG
Sbjct: 225 TLGMLIGGKVSANDIMGPVGIVYTIGTVAKTGLLNLMTFSAFISAYLGLFNLLPFPALDG 284

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           G ++  L+E +RG+ +       I  +G  I++ L       D+
Sbjct: 285 GRILFVLIEAVRGEPVPPEKEGYIHYIGFMILIALILFVTYRDV 328


>gi|298245129|ref|ZP_06968935.1| membrane-associated zinc metalloprotease [Ktedonobacter racemifer
           DSM 44963]
 gi|297552610|gb|EFH86475.1| membrane-associated zinc metalloprotease [Ktedonobacter racemifer
           DSM 44963]
          Length = 399

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 107/403 (26%), Positives = 178/403 (44%), Gaps = 74/403 (18%)

Query: 5   DCFLLYTVSLI-IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV--- 60
           + +LL  + +  ++V++HEFGH++ AR   IRV  F +G  P L+G   R    W+V   
Sbjct: 3   NWYLLAAIPVFGLLVLVHEFGHFITARWAGIRVDEFGIGLPPRLVGFRRRPQGGWEVVWF 62

Query: 61  ------------------------------------SLIPLGGYVSF------SEDEK-- 76
                                               +L+P+GG+V        + DE   
Sbjct: 63  GGRSEQMEGLESPLTGTSGGVSQGHASAKQNTIYSINLLPIGGFVRMPGEDGDAHDEDGH 122

Query: 77  -DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP-VVSNVSPASPAAIA 134
            D  SF      K+I  + AG + N ++AI  FT  +       P +++ V+  SPAA A
Sbjct: 123 YDSESFAAKPAGKRIAVLCAGVIMNVLLAIALFTIAYGQGEPTTPAIIAQVNAGSPAAAA 182

Query: 135 GVKKGDCIISLDGITVSAFEEVAPYVRENPLH-------EISLVLYRE-HVGVLHLKVMP 186
           G+   D I+S++G +V+ F+EV   V +           ++ LV+ R+     LH+ V  
Sbjct: 183 GLHADDKILSVNGQSVTQFQEVKDIVDKASTQSKGQQTVDVKLVVERKGEPQPLHMTVHA 242

Query: 187 RLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAF 246
            +    D+  +     +V +S            + Q+  RG+ +  S TR F+  +    
Sbjct: 243 LVNPPADKGHLGVLGKTVNVSIP----------LWQAPIRGIQQTLSTTRLFIVTIGQMI 292

Query: 247 GKDTRLNQISGPVGIARI----AKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGH 302
               +  QI+GPVGI +I    A+     G+   +   AM S  +  +N+LP P LDGG 
Sbjct: 293 VGAIQ-PQIAGPVGIVKITGEVAQTVPVVGWWYILNLTAMLSINLAIVNILPFPALDGGR 351

Query: 303 LITFLLEMIR-GKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           ++   +EMIR GK L      +I  +G+ I+L L  +   +D+
Sbjct: 352 VVLIFIEMIRGGKRLRPEREGLINLVGMAILLTLMVVVTVSDV 394


>gi|207092658|ref|ZP_03240445.1| hypothetical protein HpylHP_07301 [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 349

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 176/356 (49%), Gaps = 23/356 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ IHE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFIHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-- 116
           GYV     +K+          S+   +P++K+  +  G   N + AIL + FF   +G  
Sbjct: 62  GYVKLKGMDKEENGTNESMHDSYAQKSPFQKLWILFGGAFFNFLFAILVY-FFLALSGEK 120

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           V+ PV+  +     A  AG+ KGD I+S++   +++F E+   V  +   E+ L + R H
Sbjct: 121 VLLPVIGALD--KNALEAGLLKGDKILSINHEKIASFREIRSVV-AHARGELVLEIERNH 177

Query: 177 VGVLHLKVMPR----LQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEIS 232
             +L  ++ P+    + D+ D   + R   ++GI     +T + S ++ Q+F + L    
Sbjct: 178 -QILEKRLTPKIVAVISDSNDPNEMIRY-KAIGIKPDMQKTGVISYSLFQAFEKALSRFK 235

Query: 233 SITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
                 +  L         + ++SG VGI     +   +  +  +   A  S  +G +NL
Sbjct: 236 EGVVLIVDSLRRLIMGSASVKELSGVVGIVGALSH--ANSLSMLLLLGAFLSINLGILNL 293

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ ND+  L+
Sbjct: 294 LPIPALDGAQMLGVVFKNIFKITLPAFMQNALWLAGVGFLVFIMFLGLFNDLTRLL 349


>gi|296330871|ref|ZP_06873346.1| inner membrane zinc metalloprotease required for the
           extracytoplasmic stress response mediated by sigma(E)
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305674389|ref|YP_003866061.1| inner membrane zinc metalloprotease required for the
           extracytoplasmic stress response mediated by sigma(E)
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296151876|gb|EFG92750.1| inner membrane zinc metalloprotease required for the
           extracytoplasmic stress response mediated by sigma(E)
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305412633|gb|ADM37752.1| inner membrane zinc metalloprotease required for the
           extracytoplasmic stress response mediated by sigma(E)
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 420

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 130/276 (47%), Gaps = 23/276 (8%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F     W++I  + AGP+ N ++A +         GV   +PV+  ++    AA AG+
Sbjct: 159 RQFGSKPVWQRIKAIAAGPIMNFILAYVILVMLGLIQGVPSNEPVLGQLTDNGRAAEAGL 218

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRL-----QDT 191
           K+GD I S++G  + ++ ++   V+ENP  E+ + + R +   LH+ V P       + T
Sbjct: 219 KEGDYIQSINGEKMRSWTDIVSAVKENPEKEMDVAVKRNN-KTLHIAVTPEAVKDENKKT 277

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
           + RFG            SY  T+   + VL + + G      +T+  L  LS       +
Sbjct: 278 IGRFG------------SYAPTE---KGVLSAVAYGATSTVDVTKAILTNLSKLVTGQFK 322

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
           L+ +SGPVGI  +       G      F A  S  +G +NLLPIP LDGG L+   +E I
Sbjct: 323 LDMLSGPVGIYDMTDQVAKTGLVNLFQFAAFLSINLGIVNLLPIPALDGGRLLFLFIEAI 382

Query: 312 RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           RGK +       +  +G+  ++ L  +   NDI  L
Sbjct: 383 RGKPINREKEAFVVFIGVAFLMLLMLVVTWNDIQRL 418



 Score = 44.7 bits (104), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH ++A+   I    F++GFGP++        V + + L+P+GG+V  + ++ 
Sbjct: 14 LVFFHELGHLLLAQRAGILCREFAIGFGPKIFSFKKNETV-YTIRLLPVGGFVRMAGEDP 72

Query: 77 DM 78
          +M
Sbjct: 73 EM 74


>gi|257455341|ref|ZP_05620576.1| RIP metalloprotease RseP [Enhydrobacter aerosaccus SK60]
 gi|257447303|gb|EEV22311.1| RIP metalloprotease RseP [Enhydrobacter aerosaccus SK60]
          Length = 455

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 104/164 (63%), Gaps = 15/164 (9%)

Query: 7   FLLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITS-RSGVRWKVS 61
           F+L  ++ I++    V +HE+GHY+VARLC ++VL++S+GFGP+L+  TS ++G+ + VS
Sbjct: 3   FILTVLAAIVVLGPLVALHEWGHYIVARLCGVKVLTYSIGFGPKLLSWTSKKTGINYAVS 62

Query: 62  LIPLGGYVSFSEDEKDMR--------SFFCAAPWKKILTVLAGPLANCVMAI-LFFTFFF 112
            IPLGGYV    DE++ +        +F    PWKKI  V AGP+ N ++AI L++  F 
Sbjct: 63  AIPLGGYVKML-DEREGKVNPAERHLAFNTQQPWKKIAIVAAGPVMNLLIAIFLYWLLFI 121

Query: 113 YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV 156
             T V+   V ++ P SP +   +K GD I+++D   + +++++
Sbjct: 122 TPTQVLATKVGSILPNSPVSQTSLKVGDEIVAVDNKPIQSWQDI 165



 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 155/323 (47%), Gaps = 15/323 (4%)

Query: 31  LCNIRVLSFSVGFGPELIGITSRSGVRWK------VSLIPLGGYVSFSEDEKDMRSFFCA 84
           L N  V   S+  G E++ + ++    W+         +   G V+ + +    ++   A
Sbjct: 135 LPNSPVSQTSLKVGDEIVAVDNKPIQSWQDINYALADRMGESGQVNLTVNGTQGQTN-VA 193

Query: 85  APWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIIS 144
            P ++ + V AG   N + ++    +       +  V+  + P S AA  G++ GD I  
Sbjct: 194 VPIQRFMKVEAGKATNPIDSLGAIPW----QPKIPAVIGEIVPNSAAARQGLQVGDTITR 249

Query: 145 LDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQ-DTV-DRFG-IKRQV 201
           ++G  VS +   +  V+ +P   ++L + R+   +  L+VMP+ + DT+ +RFG I    
Sbjct: 250 VNGQPVSDWLAFSQVVKSSPEQLLTLEVQRQG-KITTLQVMPQAKKDTMGNRFGQIGAAA 308

Query: 202 PSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGI 261
            +  ++   D  K    T +Q+  + + +   ++   L  +         +  +SGP+ I
Sbjct: 309 AASKVTPPPDYIKTIQYTPIQAVEKSVQQTVDLSAMTLKSMGKMLMGTIGVENLSGPITI 368

Query: 262 ARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVT 321
           A++A   F  G+ A ++F+A+ S ++  +NLLP+P+LDGGH++ +  E I GK +   V 
Sbjct: 369 AKVANQSFSIGWEAVLSFMAIISLSLAVLNLLPVPVLDGGHIVMYAYEAIFGKPMPEKVQ 428

Query: 322 RVITRMGLCIILFLFFLGIRNDI 344
            +   +GL ++     L I NDI
Sbjct: 429 MMGMNIGLVLLAGFMLLAIGNDI 451


>gi|210622744|ref|ZP_03293336.1| hypothetical protein CLOHIR_01284 [Clostridium hiranonis DSM 13275]
 gi|210154076|gb|EEA85082.1| hypothetical protein CLOHIR_01284 [Clostridium hiranonis DSM 13275]
          Length = 344

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/342 (23%), Positives = 159/342 (46%), Gaps = 22/342 (6%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED- 74
           I++ HE GH++ A+   I +L F++G GP++   T +    + + LIP+GG+V+ + ED 
Sbjct: 16  IILFHELGHFIFAKRSGIGILEFAIGMGPKVWS-TKKGETEYSIRLIPIGGFVAMAGEDG 74

Query: 75  ------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPA 128
                 E +M SF     W+++ T+ AGP+ N ++ ++     F   G  +  ++NV   
Sbjct: 75  AENDPEETNMDSFGDKTIWQRVQTIAAGPIFNIILTVILLAGVFTYMGTPQTELANVVKG 134

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRL 188
           +PA  AG++ GD ++ + G+ +  + +V+  V ++   +  +V+ R+             
Sbjct: 135 TPAYEAGIEPGDKVVEIGGMEIKNWADVSAAVDKSGNKKTEIVVDRDG-------KEKTF 187

Query: 189 QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGK 248
           + T ++    R V  +    S +        V+ ++   +  ++ + + F G L      
Sbjct: 188 EITPEKSKDNRYVLGIEAKMSRNPFVAIKNAVVSTWEMSVQMVTFVVQLFTGNLPMKL-- 245

Query: 249 DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLL 308
               + + GPV +  +       G    I  +A+ S  +G +NL+P P LDG  L+  L+
Sbjct: 246 ---TDAVGGPVAVVSVVNEASKVGVLNLIYVMAVISLNLGILNLVPFPALDGFRLLMLLI 302

Query: 309 EMIR-GKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           E +R GK L       +  +G   ++        NDI  L++
Sbjct: 303 EFLRGGKKLDPEKEGFVNMLGFAALMAFIVFITYNDILKLIR 344


>gi|240146855|ref|ZP_04745456.1| RIP metalloprotease RseP [Roseburia intestinalis L1-82]
 gi|257200988|gb|EEU99272.1| RIP metalloprotease RseP [Roseburia intestinalis L1-82]
 gi|291536048|emb|CBL09160.1| RIP metalloprotease RseP [Roseburia intestinalis M50/1]
 gi|291538541|emb|CBL11652.1| RIP metalloprotease RseP [Roseburia intestinalis XB6B4]
          Length = 343

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 140/309 (45%), Gaps = 28/309 (9%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE---KD 77
           HE GH+ +A+   IRV  F +G GP ++G+T +   ++ + L+P GG      ++    D
Sbjct: 17  HELGHFSLAKANGIRVNEFCLGLGPTILGMT-KGETKYSLKLLPFGGACMMEGEDGESTD 75

Query: 78  MRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
            R+F   + W +I  V AGP+ N +MA +F        G   P ++ VS    A  AG++
Sbjct: 76  DRAFGKKSVWARISVVAAGPVFNFIMAFVFSFILLSCNGYDVPKITEVSEGFAAEQAGMQ 135

Query: 138 KGDCIISLDGITVSAFEEVAPYVRENPLH--EISLVLYREHVGVLHLKVMPRLQDTVDRF 195
            GD I+ ++G  +  + EV+ Y   +  H  E   V Y         ++ P   + + R+
Sbjct: 136 AGDVIVKMNGKHIHFYREVSSY---SMFHAGETVEVTYERDGKRYTAELTPLYDEELGRY 192

Query: 196 GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQI 255
                       + +   ++    V ++      E+        G L         LN +
Sbjct: 193 -----------RYGFVGGEVEKGNVFKNLLYSGYEVKYWIDTTFGSLKMLATGGVTLNDM 241

Query: 256 SGPVGIARIAKNFFDH--GFNAYIAFLAMF------SWAIGFMNLLPIPILDGGHLITFL 307
           SGPVG+     + ++    +  Y AFL M       S  +G MNLLP+P LDGG L+  +
Sbjct: 242 SGPVGLVDAIGDSYEESVSYGYYAAFLQMLYICILISANLGVMNLLPLPALDGGRLVFLI 301

Query: 308 LEMIRGKSL 316
           +E IRGK +
Sbjct: 302 VEAIRGKKV 310


>gi|81428869|ref|YP_395869.1| putative membrane-associated zinc metalloendopeptidase
           [Lactobacillus sakei subsp. sakei 23K]
 gi|78610511|emb|CAI55562.1| Putative membrane-associated zinc metalloendopeptidase
           [Lactobacillus sakei subsp. sakei 23K]
          Length = 425

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/269 (30%), Positives = 136/269 (50%), Gaps = 13/269 (4%)

Query: 80  SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSN----VSPASPAAIAG 135
            F  A    ++LT  AGP  N ++AIL F  F + +G + P  SN    V   S A  AG
Sbjct: 161 QFQSATLINRMLTNFAGPFNNFILAILAFILFAFLSGGV-PQQSNQIGTVQENSAAQKAG 219

Query: 136 VKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRF 195
           +K  D ++ +D   V++F + +  + E+P   +++ + R       +KV P+     ++ 
Sbjct: 220 LKANDRLLKVDNKKVASFTDFSAIISEHPNETVAVRVQRGATEKT-IKVTPKAVKVANQ- 277

Query: 196 GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQI 255
             K +V  VG++    + K++  ++    S G  +  SI      +L S       L+++
Sbjct: 278 --KEKVGQVGVT---QKVKMN-HSLKAKISYGFTQAWSIASQIFKILGSFLTGGFSLDKL 331

Query: 256 SGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKS 315
           SGPVG+  +   F   GFNA + FLA  S  +G MNL+PIP LDGG L+  ++E IR K 
Sbjct: 332 SGPVGMYSMTTQFTQQGFNALVYFLAFLSLNLGIMNLIPIPALDGGKLVLNIIEAIRRKP 391

Query: 316 LGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +      ++T +G+ I++ L  L   NDI
Sbjct: 392 ISPEKEGIVTLIGVGIMVLLMVLVTWNDI 420



 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV---SFSE 73
          +VV+HEFGH+ +A+   I V  FSVG GP+L   T ++G  + +  +PLGGYV     ++
Sbjct: 14 LVVVHEFGHFYMAKRSGILVREFSVGMGPKLFA-TRKNGTTYTIRWLPLGGYVRMAGMAD 72

Query: 74 DEKDMRS 80
          DE ++ +
Sbjct: 73 DESEIEA 79


>gi|16078719|ref|NP_389538.1| inner membrane zinc metalloprotease [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|20978800|sp|O31754|RASP_BACSU RecName: Full=Zinc metalloprotease rasP; AltName: Full=Regulating
           alternative sigma factor protease; AltName:
           Full=Regulating anti-sigma-W factor activity protease
 gi|2634028|emb|CAB13529.1| inner membrane zinc metalloprotease required for the
           extracytoplasmic stress response mediated by sigma(E)
           (YaeL) [Bacillus subtilis subsp. subtilis str. 168]
          Length = 422

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 131/276 (47%), Gaps = 23/276 (8%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F     W++I  + AGP+ N ++A +         GV   +P++  ++    AA AG+
Sbjct: 161 RQFGSKPVWQRIKAIAAGPIMNFILAYVILVMLGLIQGVPSNEPMLGQLTDNGRAAEAGL 220

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRL-----QDT 191
           K+GD I S++G  + ++ ++   V+ENP  E+ + + R++   LH+ V P       + T
Sbjct: 221 KEGDYIQSINGEKMRSWTDIVSAVKENPEKEMDVAVKRDN-KTLHISVTPEAVKDENKKT 279

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
           + RFG            SY  T+   + VL + + G      +T+  L  LS       +
Sbjct: 280 IGRFG------------SYAPTE---KGVLSAVAYGATSTVDVTKAILTNLSKLVTGQFK 324

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
           L+ +SGPVGI  +       G      F A  S  +G +NLLPIP LDGG L+   +E I
Sbjct: 325 LDMLSGPVGIYDMTDQVAKTGIVNLFQFAAFLSINLGIVNLLPIPALDGGRLLFLFIEAI 384

Query: 312 RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           RGK +       +  +G+  ++ L  +   NDI  L
Sbjct: 385 RGKPINREKEAFVVFIGVAFLMLLMLVVTWNDIQRL 420



 Score = 44.7 bits (104), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 7  FLLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSL 62
          F+   ++ III    V  HE GH ++A+   I    F++GFGP++        V + + L
Sbjct: 2  FVNTVIAFIIIFGTLVFFHELGHLLLAQRAGILCREFAIGFGPKIFSFKKNETV-YTIRL 60

Query: 63 IPLGGYVSFSEDEKDM 78
          +P+GG+V  + ++ +M
Sbjct: 61 LPVGGFVRMAGEDPEM 76


>gi|326563737|gb|EGE13988.1| RIP metalloprotease RseP [Moraxella catarrhalis 46P47B1]
 gi|326566757|gb|EGE16896.1| RIP metalloprotease RseP [Moraxella catarrhalis 103P14B1]
 gi|326567401|gb|EGE17516.1| RIP metalloprotease RseP [Moraxella catarrhalis BC1]
 gi|326569320|gb|EGE19380.1| RIP metalloprotease RseP [Moraxella catarrhalis BC8]
 gi|326576669|gb|EGE26576.1| RIP metalloprotease RseP [Moraxella catarrhalis 101P30B1]
 gi|326577656|gb|EGE27533.1| RIP metalloprotease RseP [Moraxella catarrhalis O35E]
          Length = 457

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 110/188 (58%), Gaps = 14/188 (7%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITS-RSGVRWK 59
           M  L  FL     L  +V +HEFGHY+VARLC ++V ++S+GFGP+L+  TS RSG+R++
Sbjct: 1   MTALYMFLAAVCILGPLVALHEFGHYIVARLCGVKVQTYSIGFGPKLLAWTSKRSGIRYQ 60

Query: 60  VSLIPLGGYVSFSE-------DEKDMRSFFCAAPWKKILTVLAGPLANCVMAI-LFFTFF 111
           ++ IPLGGYV   +       DE    +F    P KKI  V AGP+ N ++AI LF+  F
Sbjct: 61  IAAIPLGGYVKMLDSRQESVADELKSVAFNHQHPLKKIAIVAAGPVMNFLIAIGLFWVLF 120

Query: 112 FYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV 171
              +  +   +  +   SPAA +G+  GD IIS+D  +V+ +++ A Y   + + E + +
Sbjct: 121 LLPSEQLNTRIGEIIDNSPAATSGLVVGDKIISIDSKSVNTWQQTA-YALASKMGESTTI 179

Query: 172 LYREHVGV 179
               H+GV
Sbjct: 180 ----HIGV 183



 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 117/242 (48%), Gaps = 26/242 (10%)

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           ++ PVV  V      A+ G+K GD   ++ G  ++ +      ++ NP   + + + R+ 
Sbjct: 223 IISPVVGEVLSDGAGALMGLKTGDVFTAIHGEPINDWLSATKIIQANPETMLDVTVMRQG 282

Query: 177 VGVLHLKVMPRLQDT----VDRFGIKRQVPSVGI-------SFSYDETKLHSRTVLQSFS 225
             V  LK+MPR   T    V + GI+ Q+ +  +       +  YD  +  ++ + +++ 
Sbjct: 283 KQV-DLKLMPRGVKTQNGVVGQLGIRPQIDTDTLIPDEYRMTIQYDVGEAFTQAIRRTYD 341

Query: 226 RG---LDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAM 282
                LD +  +  G +G+             +SGP+ IA ++K  F+ GF   ++  A+
Sbjct: 342 LSIMTLDAMGKMITGLIGI-----------ENLSGPIAIADVSKTSFELGFQEVLSTAAI 390

Query: 283 FSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRN 342
            S ++  +NLLPIP+LDGGHL+ +  E I GKS+  +V     + G  ++     L I N
Sbjct: 391 ISLSLAVLNLLPIPVLDGGHLVFYTYEWIMGKSMNEAVQMAAFKAGALLLFCFMLLAISN 450

Query: 343 DI 344
           DI
Sbjct: 451 DI 452


>gi|67921727|ref|ZP_00515244.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Crocosphaera watsonii WH 8501]
 gi|67856319|gb|EAM51561.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Crocosphaera watsonii WH 8501]
          Length = 363

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/354 (26%), Positives = 174/354 (49%), Gaps = 37/354 (10%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L+I++ +HE GH+  ARL  I V  FS+GFGP L     +    + +  IPLGG+V  + 
Sbjct: 10  LVILIFVHELGHFSAARLQGIHVTRFSIGFGPVLARYEGKE-TEYTLCAIPLGGFVLCAI 68

Query: 74  DEKDMRSFFCAAP---------WKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKP-- 120
            + D  S               + + + + AG +AN + A           GV  ++P  
Sbjct: 69  PDDDPESDIAPDDPDLLRNRPIFDRAIVISAGVIANLIFAYFLLVGQTATVGVQDLQPGL 128

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA----PYVRENPLHEISLVLYREH 176
           ++  V   S A +AG+K GD ++S+D  ++ +F E        V+      + L + RE 
Sbjct: 129 MIPQVDENSAAMVAGMKSGDIVLSVDNQSLGSFPEATTVFIDKVKNAAEQPLELEVKREE 188

Query: 177 VGVLHLKVMPRLQDTVD-RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT 235
             +++L V+P+  +  + + G+   +P+V ++         ++  LQ+FS G +   ++T
Sbjct: 189 -QIVNLTVIPQSNEQGEGKIGVGL-LPNVRLN--------RAQNFLQAFSYGAEAYQNVT 238

Query: 236 ----RGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
               +GF  ++S+ F ++ +  Q++GPV I     +   +       F A+ S  +  +N
Sbjct: 239 VLTLQGFWQLISN-FQENAQ--QVAGPVKIVEYGASIAQNNAGNLFQFGALISINLAVIN 295

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL-FFLGIRNDI 344
            LP+P LDGG L+  ++E + GK L + +   I + GL ++L L  F+ IR+ +
Sbjct: 296 TLPLPALDGGQLVFLIIEGLFGKPLPLKLQEGIMQTGLVLLLSLAIFIIIRDTV 349


>gi|160893348|ref|ZP_02074135.1| hypothetical protein CLOL250_00897 [Clostridium sp. L2-50]
 gi|156865040|gb|EDO58471.1| hypothetical protein CLOL250_00897 [Clostridium sp. L2-50]
          Length = 365

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 103/361 (28%), Positives = 165/361 (45%), Gaps = 45/361 (12%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGY-----VS 70
           +I+  HE GH++VA++ +I V  FS+GFGP+L     +   ++ + LIPLGGY       
Sbjct: 12  VIIFFHELGHFIVAKINHITVKEFSMGFGPKLFQFHKKE-TQYTLRLIPLGGYCMMLSED 70

Query: 71  FSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG-------------- 116
             E+E D  SF   + W ++  VLAGP  N V+A LF     +  G              
Sbjct: 71  DEENENDENSFEKKSIWARMAVVLAGPAMNFVIAFLFSMVIIHFCGSDPAIIGAVYNKDN 130

Query: 117 VMKPVVSNVSP----ASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR-ENPLHEISLV 171
           + K  + N         PA  AG+  GD ++ ++G TV  F E+  Y++       I L 
Sbjct: 131 IEKYQIKNAEEYFNGVYPAEEAGISDGDRVLKIEGSTVKNFRELQIYLQIYGDGSPIDLT 190

Query: 172 LYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
           L +E   V    V P    T D  G K  + SVG     +  +L   +  ++        
Sbjct: 191 LEKEDGTVYDTTVYP--AKTPD--GYKIGIMSVGYQLPKNFGELCKYSAYETRYW----- 241

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHG--------FNAYIAFLAMF 283
             +   FL  L     +    +++SGPVG+A+   + F+          F  ++ ++ + 
Sbjct: 242 --VKATFLS-LKLIVTRQVSSDEVSGPVGVAKNMNDTFNEAAKSSVLDLFLNWMNYIVLL 298

Query: 284 SWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
           S  +G MNLLPIP LDGG  I  L+E +  K +      ++T +G  +++ L  + + ND
Sbjct: 299 SANLGVMNLLPIPGLDGGRFIFLLIEAVTRKKVPKDKENIVTLIGFVLVMLLMVVILFND 358

Query: 344 I 344
           I
Sbjct: 359 I 359


>gi|284929673|ref|YP_003422195.1| hypothetical protein UCYN_11450 [cyanobacterium UCYN-A]
 gi|284810117|gb|ADB95814.1| Yup8H12 [cyanobacterium UCYN-A]
          Length = 359

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 93/322 (28%), Positives = 154/322 (47%), Gaps = 32/322 (9%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L+I++V+HE GH+  ARL  I V  FS+GFGP L     R    + + LIPLGG+V F +
Sbjct: 8   LVILIVVHELGHFSAARLQGIHVKRFSIGFGPVLARYKGRE-TEYTLCLIPLGGFVGFPD 66

Query: 74  DEK------DMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKP--VV 122
           D+       D  +     P   + + + AG +AN V A           G+  ++P  +V
Sbjct: 67  DDPESEISIDDPNLLRNRPITDRAIVISAGVIANLVFAYFLLVGQTATMGIQDLQPGLMV 126

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVA----PYVRENPLHEISLVLYREHVG 178
             +   S A  AG+K+GD I+S+D   +  F E        V+ +    ++L + R+   
Sbjct: 127 PQIDNNSAAMDAGIKEGDIILSIDQYPLKEFPEATTLFVEKVKNSINKPLNLTIKRKE-E 185

Query: 179 VLHLKVMPRL-QDTVDRFGIKRQVPSVGISFSYDETKL---HSRTVLQSFSRGLDEISSI 234
           +L L V+P L ++   + G+   +P+V +S + +  ++    S+T L +F+  +     +
Sbjct: 186 ILDLTVIPELTEEGKGKIGVGL-LPNVQLSRAKNLVEIFVYSSKTYLNAFTLTIKGFWQL 244

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
            R F             + Q++GPV I     +   +       F A+ S  +  +N+LP
Sbjct: 245 IRHF----------QENIEQVAGPVKIVEYGASIAQNNLGNLFQFGALISINLAVINILP 294

Query: 295 IPILDGGHLITFLLEMIRGKSL 316
           +P LDGG LI  L+E   GK L
Sbjct: 295 LPALDGGQLIFLLIEGFLGKPL 316


>gi|108756877|ref|YP_630776.1| M50A family peptidase [Myxococcus xanthus DK 1622]
 gi|108460757|gb|ABF85942.1| peptidase, M50A (S2P protease) subfamily [Myxococcus xanthus DK
           1622]
          Length = 555

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 90/156 (57%), Gaps = 10/156 (6%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + + L ++V +HE GH++VA+ C ++VL FS+GFGP+LIG T +    ++++L+PLGGYV
Sbjct: 20  FVILLGVLVTVHELGHFLVAKACGVKVLKFSIGFGPKLIGFT-KGETEYQIALLPLGGYV 78

Query: 70  SFSED--------EKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNT-GVMKP 120
             + D        E+  R F    PWK+ L VLAGP  N +  IL + F F         
Sbjct: 79  KMAGDMPHEELSPEEASRGFLAQPPWKRGLIVLAGPAFNLIFPILVYFFVFLGPHQATST 138

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV 156
            V  VS   PA  AG++ GD I+S+DG  V  F ++
Sbjct: 139 YVGTVSEGMPAQAAGIRPGDRILSVDGEPVRTFNDM 174



 Score = 62.8 bits (151), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 89/197 (45%), Gaps = 11/197 (5%)

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL-YREHVGVL 180
           ++ V+P S A   G++ GD II+LDG    +F + +  +  N L E S  L +R   G  
Sbjct: 324 LATVAPGSAAEKGGLRPGDRIIALDGEKPESFVKFSSKL--NALKERSFQLTWRGADGER 381

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGIS----FSYDETKLHSRTVLQSFSRGLDEISSITR 236
              +      T D  G       +G+      + D   L   TV       L + + I  
Sbjct: 382 TETLAQAPLKTEDEMGTASSPIVLGVRNWVLSAADMPVLDEVTVHLGPGAALKQAALIVP 441

Query: 237 GFLGVLSSAFGK----DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
             +G +    G        +N + GP+ + ++A    + G ++++  +A+ S  +G MNL
Sbjct: 442 KIVGQMVRVLGGLLVGSVPMNTVGGPIMMYQLASKSAEQGLDSFLHLMALISINLGVMNL 501

Query: 293 LPIPILDGGHLITFLLE 309
           LPIP+LDG HL++   E
Sbjct: 502 LPIPVLDGFHLLSAAWE 518


>gi|326561014|gb|EGE11379.1| RIP metalloprotease RseP [Moraxella catarrhalis 7169]
 gi|326571473|gb|EGE21488.1| RIP metalloprotease RseP [Moraxella catarrhalis BC7]
 gi|326575244|gb|EGE25172.1| RIP metalloprotease RseP [Moraxella catarrhalis CO72]
          Length = 457

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 110/188 (58%), Gaps = 14/188 (7%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITS-RSGVRWK 59
           M  L  FL     L  +V +HEFGHY+VARLC ++V ++S+GFGP+L+  TS RSG+R++
Sbjct: 1   MTALYMFLAAVCILGPLVALHEFGHYIVARLCGVKVQTYSIGFGPKLLAWTSKRSGIRYQ 60

Query: 60  VSLIPLGGYVSFSE-------DEKDMRSFFCAAPWKKILTVLAGPLANCVMAI-LFFTFF 111
           ++ IPLGGYV   +       DE    +F    P KKI  V AGP+ N ++AI LF+  F
Sbjct: 61  IAAIPLGGYVKMLDSRQESVADELKSVAFNHQHPLKKIAIVAAGPVMNFLIAIGLFWVLF 120

Query: 112 FYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLV 171
              +  +   +  +   SPAA +G+  GD IIS+D  +V+ +++ A Y   + + E + +
Sbjct: 121 LLPSEQLNTRIGEIIDNSPAATSGLVVGDKIISIDSKSVNTWQQTA-YALASKMGESTTI 179

Query: 172 LYREHVGV 179
               H+GV
Sbjct: 180 ----HIGV 183



 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 116/233 (49%), Gaps = 8/233 (3%)

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           ++ PVV  V      A+ G+K GD   ++ G  ++ +      ++ NP   + + + R+ 
Sbjct: 223 IISPVVGEVLSDGAGALMGLKTGDVFTAIHGEPINDWLSATKIIQANPETMLDVTVMRQG 282

Query: 177 VGVLHLKVMPRLQDT----VDRFGIKRQVPSVGISFSYDETKLHSR-TVLQSFSRGLDEI 231
             V  LK+MPR   T    V + GI+ Q+ +   +   DE ++  +  V ++F++ +   
Sbjct: 283 KQV-DLKLMPRGVKTQNGVVGQLGIRPQIDTD--TLIPDEYRMTIQYGVGEAFTQAIRRT 339

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
             ++   L  +         +  +SGP+ IA ++K  F+ GF   ++  A+ S ++  +N
Sbjct: 340 YDLSIMTLDAMGKMITGLIGIENLSGPIAIADVSKTSFELGFQEVLSTAAIISLSLAVLN 399

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LLPIP+LDGGHL+ +  E I GKS+  +V     + G  ++     L I NDI
Sbjct: 400 LLPIPVLDGGHLVFYTYEWIMGKSMNEAVQMAAFKAGALLLFCFMLLAISNDI 452


>gi|221309534|ref|ZP_03591381.1| hypothetical protein Bsubs1_09126 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313858|ref|ZP_03595663.1| hypothetical protein BsubsN3_09057 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318781|ref|ZP_03600075.1| hypothetical protein BsubsJ_08986 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323053|ref|ZP_03604347.1| hypothetical protein BsubsS_09097 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|291484211|dbj|BAI85286.1| hypothetical protein BSNT_02694 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 420

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 131/276 (47%), Gaps = 23/276 (8%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPASPAAIAGV 136
           R F     W++I  + AGP+ N ++A +         GV   +P++  ++    AA AG+
Sbjct: 159 RQFGSKPVWQRIKAIAAGPIMNFILAYVILVMLGLIQGVPSNEPMLGQLTDNGRAAEAGL 218

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRL-----QDT 191
           K+GD I S++G  + ++ ++   V+ENP  E+ + + R++   LH+ V P       + T
Sbjct: 219 KEGDYIQSINGEKMRSWTDIVSAVKENPEKEMDVAVKRDN-KTLHISVTPEAVKDENKKT 277

Query: 192 VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTR 251
           + RFG            SY  T+   + VL + + G      +T+  L  LS       +
Sbjct: 278 IGRFG------------SYAPTE---KGVLSAVAYGATSTVDVTKAILTNLSKLVTGQFK 322

Query: 252 LNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMI 311
           L+ +SGPVGI  +       G      F A  S  +G +NLLPIP LDGG L+   +E I
Sbjct: 323 LDMLSGPVGIYDMTDQVAKTGIVNLFQFAAFLSINLGIVNLLPIPALDGGRLLFLFIEAI 382

Query: 312 RGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           RGK +       +  +G+  ++ L  +   NDI  L
Sbjct: 383 RGKPINREKEAFVVFIGVAFLMLLMLVVTWNDIQRL 418



 Score = 44.7 bits (104), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 17 IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
          +V  HE GH ++A+   I    F++GFGP++        V + + L+P+GG+V  + ++ 
Sbjct: 14 LVFFHELGHLLLAQRAGILCREFAIGFGPKIFSFKKNETV-YTIRLLPVGGFVRMAGEDP 72

Query: 77 DM 78
          +M
Sbjct: 73 EM 74


>gi|226356275|ref|YP_002786015.1| membrane-associated zinc metalloproteases [Deinococcus deserti
           VCD115]
 gi|226318265|gb|ACO46261.1| putative membrane-associated zinc metalloproteases; putative
           membrane protein [Deinococcus deserti VCD115]
          Length = 376

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 100/367 (27%), Positives = 163/367 (44%), Gaps = 40/367 (10%)

Query: 8   LLYTVSLIIIVV-IHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           L++T  L+ +   +HE  HY +AR   + V SFSVG GP L+  + R G  W++SL+P+G
Sbjct: 16  LIWTAVLLSVATFLHELAHYALARAQGVPVKSFSVGMGPVLLRRSWR-GTEWRLSLLPIG 74

Query: 67  GYVSFS----------EDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV             +     R F       KI  +LAGPL N ++A+   T  F   G
Sbjct: 75  GYVEIDGMAPEEGPGGQLRSPTRGFAALPALGKIAVLLAGPLMNLILALGLMTALFSTQG 134

Query: 117 VMKP---VVSNVSPASPAAIAGVKKGDCI-----------ISLDGITVSAFEEVAPYVRE 162
           +  P    + +V+  S A   G+K GD I           +S DG T + +E +   +  
Sbjct: 135 MPAPDRARIESVNAGSRAEALGLKAGDVITAINGQDIPDIVSTDGQTRAGWETLRTTL-A 193

Query: 163 NPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQ 222
            P   +  V   +   V   +V    Q TV+    +RQ+  +GI +  D   +   +V  
Sbjct: 194 RPGPHVFTVRSTQGGAVRTREVRFDWQPTVNG---QRQL--LGIRYGPD---IQPVSVPA 245

Query: 223 SFSRGLDEISSITRGFLGVLSSAFGK-----DTRLNQISGPVGIARIAKNFFDHGFNAYI 277
           +F+  +     +    L    S F +      +R   +SGP+G A I     +    A +
Sbjct: 246 AFAASVTTTVEVVPQVLRAFGSLFARFVTLDISRDENVSGPIGTAEIVSRAAELSPWALV 305

Query: 278 AFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFF 337
               M + ++ F NL+PIP LDGG ++  LL  ++G+ L  +  + I   G   ++ L  
Sbjct: 306 QVAIMLNLSLAFFNLIPIPGLDGGRILLVLLGALKGRPLTFAQEQAINIAGFAFVMMLML 365

Query: 338 LGIRNDI 344
             +  D+
Sbjct: 366 FVVVRDV 372


>gi|302872255|ref|YP_003840891.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575114|gb|ADL42905.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 349

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 170/358 (47%), Gaps = 31/358 (8%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
            +L  + L I++++HEFGH++V +L  + V  F++GFGP+L  I  +    + V    +G
Sbjct: 3   LILALIVLTIVILVHEFGHFIVCKLSGVLVEEFAIGFGPKLFSIKGKE-TEYSVRAFLIG 61

Query: 67  GYVSFSEDEKDM---RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVS 123
           GYV    ++KD+   R+   A   K+IL VL GP+ N V+AI+      Y  G     + 
Sbjct: 62  GYVKPLGEDKDIDHPRALNNAKVHKRILMVLMGPVMNFVLAIIIMMGIGYFIGFGTNTIG 121

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR-ENPLH---EISLVLYREHVGV 179
            V P  PA  AG++ GD I++LD   V  +++V+ Y+   N L+   E+ + + R     
Sbjct: 122 RVEPNMPAYEAGIRSGDRIVALDKNRVYVWDQVSFYLAVHNMLYKDREVEIKVLRNGKQY 181

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL-DEISSITRGF 238
           +  +VMP+            +   +G+S     +K+  + +  S   GL    + I    
Sbjct: 182 I-FRVMPKYDPNT-------KTKRIGVS-----SKISRKNLFDSIYYGLFGTYAEIKETI 228

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA--------FLAMFSWAIGFM 290
             V+    G+    ++I GPVG+ +      + GF   +          + + S  +G +
Sbjct: 229 YSVVLMITGR-VSASEIMGPVGMVKTIGEAANAGFKQSVLSGLLNILWLMQLISVNLGVI 287

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NL+P P LDG  L+ +L E +  K        +I  +G  ++LFL  +   NDI  ++
Sbjct: 288 NLIPFPALDGSRLVFYLYEAVARKPFNREKEALIHTIGFVLLLFLLVIVTFNDIKNII 345


>gi|114331994|ref|YP_748216.1| putative membrane-associated zinc metalloprotease [Nitrosomonas
           eutropha C91]
 gi|114309008|gb|ABI60251.1| putative membrane-associated zinc metalloprotease [Nitrosomonas
           eutropha C91]
          Length = 455

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 121/231 (52%), Gaps = 6/231 (2%)

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
           ++ PV+  V     A  AG+K GD +++++G  VSA+E+V   VR NP H +S+ + R+ 
Sbjct: 222 IVAPVIDQVMVGGAAERAGLKTGDRVVAINGKEVSAWEDVVDMVRSNPGHTLSVEVMRDD 281

Query: 177 VGV---LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS 233
             +   L  + +      + + GI  ++    +     +T       L   +    E+S 
Sbjct: 282 RELAMSLQPETVSEGHAEIGKAGITPEIHHEILENLLVKTSYPPMAALVKAATKTWEMSY 341

Query: 234 ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
            T   LG + +    D  L  ISGP+ IA  A      GF AY+ FLA+ S ++G +NLL
Sbjct: 342 FTVRMLGKMVTG---DVSLKNISGPITIANYAGQSAQIGFTAYLGFLALISISLGVLNLL 398

Query: 294 PIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           PIP+LDGGHL+ +L+E++RG  L   V  +  ++G+ +++ L    I ND+
Sbjct: 399 PIPVLDGGHLMYYLIEVVRGIPLSERVMYIGNQIGMALLITLMMFAIYNDL 449



 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 93/178 (52%), Gaps = 13/178 (7%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG---VR 57
           M  L     + ++L +++  HEFGHY+VAR C ++VL FS+GFG  L     R G     
Sbjct: 1   MTLLSTIFAFVIALGLLITFHEFGHYLVARWCGVKVLRFSLGFGQPL--FKKRLGNDQTE 58

Query: 58  WKVSLIPLGGYVSFSEDEKDM-------RSFFCAAPWKKILTVLAGPLAN-CVMAILFFT 109
           W V+ IPLGGYV   ++ +         R+F      K+   V+AGP+AN  +  +L++ 
Sbjct: 59  WVVAAIPLGGYVKMLDEREGRVPADELPRAFNRQPVSKRFAIVVAGPVANFLLAILLYWL 118

Query: 110 FFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE 167
            F      +KP++  + PA+ AA AG + GD I  +    ++ ++E    + +N + +
Sbjct: 119 LFILGVSGVKPILGEIEPATLAASAGFRNGDTITGIGDQAITTWQEARLLLLDNAVDK 176


>gi|317012102|gb|ADU82710.1| hypothetical protein HPLT_01340 [Helicobacter pylori Lithuania75]
          Length = 351

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 94/357 (26%), Positives = 177/357 (49%), Gaps = 23/357 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSF-----SEDEKDMR-----SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV        E+E++       S+   +P++K+  +  G   N + AIL + FF   +G
Sbjct: 62  GYVKLKGMDKEENEENKTHQANDSYAQKSPFQKLWILFGGAFFNFLFAILVY-FFLALSG 120

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+ P++ ++   S A  AG+ KGD I+S++   +++F E+   V      E+ L + R
Sbjct: 121 EKVLLPIIGDLE--SNALEAGLLKGDKILSINHKKIASFREIRSVV-ARARGELVLEIER 177

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
            H  +L  ++ P++   +       ++     +GI     +  + S +++Q+F + L   
Sbjct: 178 NH-QILEKRLTPKIVAVISESNDPNEMIRYKIIGIKPDMQKMGVVSYSLIQAFKQALSRF 236

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
                  +  L         + ++SG VGI     +   +  +  + F A  S  +G +N
Sbjct: 237 KEGVVLIVDSLRRLIMGSASVKELSGVVGIVGALSH--ANSVSMLLLFGAFLSINLGILN 294

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ ND+  L+
Sbjct: 295 LLPIPALDGAQMLGVVFKNIFHITLPAFMQNALWLAGVGFLVFIMFLGLFNDLTRLL 351


>gi|20807848|ref|NP_623019.1| membrane-associated Zn-dependent protease 1 [Thermoanaerobacter
           tengcongensis MB4]
 gi|254479459|ref|ZP_05092786.1| RIP metalloprotease RseP [Carboxydibrachium pacificum DSM 12653]
 gi|20516411|gb|AAM24623.1| predicted membrane-associated Zn-dependent protease 1
           [Thermoanaerobacter tengcongensis MB4]
 gi|214034602|gb|EEB75349.1| RIP metalloprotease RseP [Carboxydibrachium pacificum DSM 12653]
          Length = 332

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 94/315 (29%), Positives = 149/315 (47%), Gaps = 20/315 (6%)

Query: 6   CFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPL 65
             +L  + L ++V+ HEFGH++VA+L   RV  FS+GFGP L          +    +  
Sbjct: 2   TIILSIIVLSVLVMFHEFGHFIVAKLSGARVNEFSIGFGPRLFK-KKYGETEYSFRALLF 60

Query: 66  GGYVSFS-EDEK--DMRSFFCAAPWKKILTVLA-GPLANCVMAILFFTFFFYNTGVMKPV 121
           GGYV+   EDEK  D R+     PW   L V A GPL N ++A L     F+  G   P 
Sbjct: 61  GGYVALEGEDEKSSDPRAIINK-PWPVRLAVFAAGPLMNILLAFLLLFIVFFYIGSPVPK 119

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           V  V    PA  AG+  GD I+ ++ I ++++E++   +  +    + + + R++  ++ 
Sbjct: 120 VQTVMEGYPAEKAGILPGDKILMINDIKINSWEQLEKAISSSNGKTLVMEIERDN-KIIK 178

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241
            +V P       +  I       GI  +Y+      R+ L +    +D     ++  +  
Sbjct: 179 KEVTPVFDKKASKVMI-------GIVPAYE------RSFLLAVKTAVDRTIYFSKLIVLS 225

Query: 242 LSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGG 301
           L+        +N+I GPVGI +        G    +AF A+ S  +G  NLLP P LDGG
Sbjct: 226 LAMLISGKVSVNEIMGPVGIVQAVGTVAKTGMINLLAFSALISVNLGLFNLLPFPALDGG 285

Query: 302 HLITFLLEMIRGKSL 316
            ++  L E +RGK L
Sbjct: 286 RILFVLAEAVRGKPL 300


>gi|312876749|ref|ZP_07736728.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796480|gb|EFR12830.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 349

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 173/358 (48%), Gaps = 31/358 (8%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
            +L  + L I++++HEFGH++V +L  + V  F++GFGP+L  I  +    + V    +G
Sbjct: 3   LILALIVLTIVILVHEFGHFIVCKLSGVLVEEFAIGFGPKLFSIKGKE-TEYSVRAFLIG 61

Query: 67  GYVS-FSEDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVS 123
           GYV    ED++    R+   A  +K+IL VL GP+ N V+AI+      Y  G     +S
Sbjct: 62  GYVKPLGEDQEVDHPRALNNAKVYKRILMVLMGPVMNFVLAIIIMMGIGYFIGFGTNTIS 121

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR-ENPLH---EISLVLYREHVGV 179
            V P  PA  AG++ GD I++LD   V  +++V+ Y+   N L+   E+ + + R+    
Sbjct: 122 KVEPNMPAYEAGIRSGDRIVALDKNRVYVWDQVSFYLAVHNMLYKDREVEIKVLRDGKEY 181

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL-DEISSITRGF 238
           +  +VMP+            +   +G++     +K+  + +  S   G+    + I    
Sbjct: 182 I-FRVMPKYDPNT-------KTKRIGVA-----SKISRKNLFDSIYYGIFGTYAEIKETI 228

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA--------FLAMFSWAIGFM 290
             V+    GK +  ++I GPVG+ +      + GF   +          + + S  +G +
Sbjct: 229 YSVVLMITGKVSG-SEIMGPVGMIKTIGEAANAGFKQSVLSGLLNVLWLMQLISVNLGVI 287

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NL+P P LDG  LI +L E +  K        +I  +G  ++LFL  +   NDI  ++
Sbjct: 288 NLIPFPALDGSRLIFYLYEAVARKPFNREKEALIHTIGFVLLLFLLVIVTFNDIKNII 345


>gi|2367602|gb|AAB69699.1| unknown [Helicobacter pylori]
          Length = 351

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 94/357 (26%), Positives = 176/357 (49%), Gaps = 23/357 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSF-----SEDEKDMR-----SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV        E+E++       S+   +P++K+  +  G   N + AIL + FF   +G
Sbjct: 62  GYVKLKGMDKEENEENKTNQANDSYAQKSPFQKLWILFGGAFFNFLFAILVY-FFLALSG 120

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+ PV+  +     A  AG+ KGD I+S++   +++F E+   V      E+ L + R
Sbjct: 121 EKVLLPVIGGLD--KNALEAGLLKGDKILSINHKKIASFGEIRSVVAR-ARGELVLEIER 177

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
            +  +L  ++ P++   +       ++    ++GI     +  + S +V Q+F + L   
Sbjct: 178 NN-QILEKRLTPKIVAVISESNDPNEMIRYKAIGIKPDMQKMGVVSYSVFQAFEKALSRF 236

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
                  +  L         + ++SG +GI     +   +  +  + F A  S  +G +N
Sbjct: 237 KEGVVLIVDSLRRLIMGSASVKELSGVIGIVGALSH--ANSVSMLLLFGAFLSINLGILN 294

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDG  ++  + + I   +L + +   +   G+  ++F+ FLG+ NDI  L+
Sbjct: 295 LLPIPALDGAQMLGVVFKNIFHITLPIPIQNALWLAGVGFLVFVMFLGLFNDITRLL 351


>gi|254785180|ref|YP_003072608.1| RIP metalloprotease RseP [Teredinibacter turnerae T7901]
 gi|237686834|gb|ACR14098.1| RIP metalloprotease RseP [Teredinibacter turnerae T7901]
          Length = 453

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 99/165 (60%), Gaps = 9/165 (5%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           M ++     + ++L+I+V IHEFGH+ VAR C +RVL FS+GFG  L     + G  + +
Sbjct: 1   MQFISTVFYFLIALMILVAIHEFGHFYVARRCGVRVLRFSIGFGSRLFSWRDKQGTEYAI 60

Query: 61  SLIPLGGYVS-FSEDEKDMR------SFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFF 112
           S IPLGGYV    E E ++       ++   +P ++I   +AGPLAN ++A IL++ FFF
Sbjct: 61  SAIPLGGYVKMLDEREGEVAPEDLPYTYNHKSPPQRIAIAMAGPLANLILAFILYWVFFF 120

Query: 113 YNTGV-MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV 156
              GV + PV+  V   S AA AG++KG  I+++DG  V +  +V
Sbjct: 121 VRGGVTLAPVIGAVDAGSIAAAAGLEKGQEIVAVDGRAVHSRRDV 165



 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 116/228 (50%), Gaps = 9/228 (3%)

Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLH 181
           +  V P S AA AG K+GD I+  DG+ +    +   YVR +P  EI +++ R++ G   
Sbjct: 227 IGTVEPESAAARAGFKEGDRILEADGVAMEDGRQWIDYVRAHPAEEIRVLVARDN-GQEE 285

Query: 182 LKVMPRLQDTVDRFGIKRQVPSVGI----SFSYDETKLHSRTVLQSFSRGLDEISSI-TR 236
           L + P ++   D  GI+     V +    S+  +  +      L S  +   E   + T 
Sbjct: 286 LFLTPGVKK--DSAGIEYGFAGVSLPQVDSWPEEMVRFQHFGPLDSAVKAAQETRDVVTM 343

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L V     G+ +  N +SGP+GIA++A +    G  +++ FLA  S  +G  NLLPIP
Sbjct: 344 VLLSVKKLVVGEISTKN-LSGPIGIAKVAGDSAKAGIWSFVNFLAYISVLLGVFNLLPIP 402

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +LDGGH++  L+E ++G  +   V     ++G+ +IL L  +   +DI
Sbjct: 403 VLDGGHIVYGLIEWVKGSPVSEKVQVWGYQVGMALILGLMAIAFYHDI 450


>gi|312793076|ref|YP_004025999.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312180216|gb|ADQ40386.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 349

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 173/358 (48%), Gaps = 31/358 (8%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
            +L  + L I++++HEFGH++V +L  + V  F++GFGP+L  I  +    + V    +G
Sbjct: 3   LILALIVLTIVILVHEFGHFIVCKLSGVLVEEFAIGFGPKLFSIKGKE-TEYSVRAFLIG 61

Query: 67  GYVS-FSEDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVS 123
           GYV    ED++    R+   A  +K+IL VL GP+ N V+AI+      Y  G     +S
Sbjct: 62  GYVKPLGEDQEVDHPRALNNAKVYKRILMVLMGPVMNFVLAIIIMMGIGYFIGFGTNTIS 121

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR-ENPLH---EISLVLYREHVGV 179
            V P  PA  AG++ GD I++LD   V  +++V+ Y+   N L+   E+ + + R+    
Sbjct: 122 KVEPNMPAYEAGIRSGDRIVALDKNRVYVWDQVSFYLAVHNMLYKDREVEIKVLRDGKEY 181

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL-DEISSITRGF 238
           +  +VMP+            +   +G++     +K+  + +  S   G+    + I    
Sbjct: 182 I-FRVMPKYDPNT-------KTKRIGVA-----SKISRKNLFDSIYYGIFGTYAEIKETI 228

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA--------FLAMFSWAIGFM 290
             V+    GK +  ++I GPVG+ +      + GF   +          + + S  +G +
Sbjct: 229 YSVVLMITGKVSG-SEIMGPVGMVKTIGEAANAGFKQSVLSGLLNVLWLMQLISVNLGVI 287

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           NL+P P LDG  L+ +L E +  K        +I  +G  ++LFL  +   NDI  ++
Sbjct: 288 NLIPFPALDGSRLVFYLYEAVARKPFNREKEALIHTIGFVLLLFLLVIVTFNDIKNII 345


>gi|257459426|ref|ZP_05624535.1| RIP metalloprotease RseP [Campylobacter gracilis RM3268]
 gi|257442851|gb|EEV17985.1| RIP metalloprotease RseP [Campylobacter gracilis RM3268]
          Length = 371

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 109/355 (30%), Positives = 172/355 (48%), Gaps = 22/355 (6%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSG-VRWKV 60
           F+   F++  +++  ++  HE GH++ AR   + V  FSVGFG ++   T R G  ++ +
Sbjct: 17  FYSINFMVTVLAISFLIFFHELGHFLAARALGVGVNVFSVGFGEKVF--TKRIGATQYAI 74

Query: 61  SLIPLGGYVSFSEDEK--------DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFF 112
           S IPLGGYVS    E         D  S+    P  +I+ + AGP  N ++A L +    
Sbjct: 75  SAIPLGGYVSLKGQEDLDPAAVSTDPDSYNSKGPIARIIILFAGPFFNLLLAFLIYIALG 134

Query: 113 YNTGVMK--PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL 170
           Y  GV K  P V  +S  S AA AG+   D I+S+DG  +  +++++  V   PL   SL
Sbjct: 135 Y-IGVEKLAPKVGKISSGSAAASAGLMLNDEILSIDGKQIREWDDISKQVTATPL---SL 190

Query: 171 VLYREHVGVLHLKVMPRL--QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL 228
            + R     L L++ P+L  + T+ R  I+  VP +GIS  Y+ T        +S S   
Sbjct: 191 EIMRGG-ERLSLQLTPKLGEKKTIWRESIR--VPLIGISPDYNATVTLYHKGARSLSFAW 247

Query: 229 DEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIG 288
           D+    ++  L  L           ++ G V I  I     D+G    +A +A+ S  +G
Sbjct: 248 DQTVEASKLILVGLEKLASGVVSPKEMGGIVAITDITSKAVDYGAAVLLALVALISVNLG 307

Query: 289 FMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
            +NL PIP LDGGH+   L E+I  + +   V    + +G+ I+  L    + ND
Sbjct: 308 LINLFPIPALDGGHIAFNLFELIFRRPVPKRVFVSASYVGMGILALLMIFTVLND 362


>gi|210134456|ref|YP_002300895.1| zinc metalloprotease [Helicobacter pylori P12]
 gi|210132424|gb|ACJ07415.1| zinc metalloprotease [Helicobacter pylori P12]
          Length = 351

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 173/357 (48%), Gaps = 23/357 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 3   FIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 61

Query: 67  GYVSFSEDEKDM----------RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV     +K+            S+   +P++K+  +  G   N + AIL + FF   +G
Sbjct: 62  GYVKLKGMDKEENEENEINQADDSYAQKSPFQKLWILFGGAFFNFLFAILVY-FFLALSG 120

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+ PV+  +     A  AG+ KGD I+S++   +++F E+   V      E+ L + R
Sbjct: 121 EKVLLPVIGGLE--KNALEAGLLKGDKILSINHQKIASFGEIRSVV-ARARGELVLEIER 177

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
            H  VL  ++ P++   +       ++     +GI     +T + S +++Q+F + L   
Sbjct: 178 NH-QVLEKRLTPKIVAVISESNDPNEMIRYKIIGIKPDMQKTGIVSYSLIQAFKQALSRF 236

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
                  +  L         + ++SG VGI     +      +  + F A  S  +G +N
Sbjct: 237 KEGVVLIVDSLRRLIMGSASVKELSGVVGIVGALSH--ASSLSMLLLFGAFLSINLGILN 294

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDG  ++  + + I   +L   V   +   G+  ++F+ FLG+ ND+  L+
Sbjct: 295 LLPIPALDGAQMLGVVFKNIFKITLPAFVQNALWLAGVGFLVFIMFLGLFNDLTRLL 351


>gi|161870880|ref|YP_001600054.1| integral membrane protein [Neisseria meningitidis 053442]
 gi|161596433|gb|ABX74093.1| integral membrane protein [Neisseria meningitidis 053442]
          Length = 474

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           V   V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L    E  G  
Sbjct: 245 VAGGVEKGSPAEKAGLKPGDRLTAADGKPITSWQEWANLTRQSPGRKIALTY--ERAGQT 302

Query: 181 HL-KVMPRLQDTVD-----RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI 234
           H   + P   +  D     R G++   P    ++     + +  +V+++F  G ++  S 
Sbjct: 303 HTADIRPDTVEQSDHTLIGRVGLR---PQPDRAWDAQIRRSYRPSVVRAFGMGWEKTVSH 359

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
           +   L         +  ++ ISGP+ IA IA    + G  +Y+ FLA+ S ++G +NLLP
Sbjct: 360 SWTTLKFFGKLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLP 419

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +P+LDGGHL+ +  E IRGK LG  V  +  R GL +++ +  +   NDI  L+
Sbjct: 420 VPVLDGGHLVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAIAFFNDITRLL 473



 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           L   L +  +++I+V +HEFGHY+VARLC ++V+ FSVGFG        R    W ++ I
Sbjct: 29  LHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFF-TRKRGDTEWCLAPI 87

Query: 64  PLGGYVSFSE------DEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       E D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 88  PLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 147

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF 153
             ++P V  V P + AA AG + GD I S++G  V+ +
Sbjct: 148 TELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADW 185


>gi|260435339|ref|ZP_05789309.1| RIP metalloprotease RseP [Synechococcus sp. WH 8109]
 gi|260413213|gb|EEX06509.1| RIP metalloprotease RseP [Synechococcus sp. WH 8109]
          Length = 360

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 146/314 (46%), Gaps = 32/314 (10%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK---- 76
           HE GH++ A    IRV  FS+GFGP LI    R GV + + L+PLGG+V+F +D +    
Sbjct: 17  HEAGHFLAATFQGIRVSGFSIGFGPALIK-RQRRGVTYALRLLPLGGFVAFPDDNEESTI 75

Query: 77  --DMRSFFCAAP-WKKILTVLAGPLANCVMA--ILFFTFFFY------NTGVMKPVVSNV 125
             D        P  ++ L V AG LAN  +A  +LF    F       + GV+   V  V
Sbjct: 76  PADDPDLLRNRPIPQQALVVAAGVLANLTLALVVLFAQAAFVGVPAAPDPGVL---VVQV 132

Query: 126 SPASPAAIAGVKKGDCIISLDGITVSA----FEEVAPYVRENPLHEISLVLYR-EHVGVL 180
            P   AA +G++ GD IISL+   ++A     E +   V+  P   I +   R E    L
Sbjct: 133 QPGGAAARSGLRAGDQIISLNTQPLAAGQRGVEAMVRDVKAAPERAIRVERKRGEDTSTL 192

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240
            L  +P  Q    + G + Q     IS      +     VL + S+    +    RG+ G
Sbjct: 193 EL--IPDDQQGTGKIGAQLQA---NISGEMRAVRSPGELVLTTGSQFSQMLQQTVRGYAG 247

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
           +L++         Q+SGPV I  +       G +  + F A+ S  +  +N LP+P+LDG
Sbjct: 248 LLTNF---RVTAGQVSGPVKIVEMGAQLSQQGGSGLVLFSALISINLAVLNSLPLPLLDG 304

Query: 301 GHLITFLLEMIRGK 314
             ++   ++ +RG+
Sbjct: 305 WQMMMLAIQSVRGR 318


>gi|312127161|ref|YP_003992035.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777180|gb|ADQ06666.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 349

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 98/354 (27%), Positives = 170/354 (48%), Gaps = 31/354 (8%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
            +L  + L I++++HEFGH++V +L  + V  F++GFGP+L  I  +    + V    +G
Sbjct: 3   LILALIVLTIVILVHEFGHFIVCKLSGVLVEEFAIGFGPKLFSIKGKE-TEYSVRAFLIG 61

Query: 67  GYVS-FSEDEK--DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVS 123
           GYV    ED++    R+   A  +K+IL VL GP+ N V+AI+      Y  G    ++ 
Sbjct: 62  GYVKPLGEDQEVDHPRALNNAKVYKRILMVLMGPVMNFVLAIIIMMGIGYFIGFGTNIIG 121

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR-ENPLH---EISLVLYREHVGV 179
            V P  PA  AG++ GD I++LD   V  +++V+ Y+   N L+   E+ + + R+    
Sbjct: 122 KVEPNMPAYEAGIRSGDRIVALDKNRVYVWDQVSFYLAVHNMLYKDREVEIKVLRDG-KQ 180

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGL-DEISSITRGF 238
              +VMP+            +   +G+S     +K+  + +  S   G+    + I    
Sbjct: 181 YTFRVMPKYDPNT-------KTKRIGVS-----SKISRKNLFDSIYYGIFGTYAEIKETI 228

Query: 239 LGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA--------FLAMFSWAIGFM 290
             V+    GK +  ++I GPVG+ +      + GF   +          + + S  +G +
Sbjct: 229 YSVVLMITGKVSG-SEIMGPVGMVKTIGEAANAGFKQSVLSGLLNVLWLMQLISVNLGVI 287

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           NL+P P LDG  L+ +L E +  K        +I  +G  ++LFL  +   NDI
Sbjct: 288 NLIPFPALDGSRLVFYLYEAVARKPFNREKEALIHTIGFVLLLFLLVIVTFNDI 341


>gi|134299816|ref|YP_001113312.1| putative membrane-associated zinc metalloprotease [Desulfotomaculum
           reducens MI-1]
 gi|134052516|gb|ABO50487.1| site-2 protease, Metallo peptidase, MEROPS family M50B
           [Desulfotomaculum reducens MI-1]
          Length = 347

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 173/359 (48%), Gaps = 30/359 (8%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +  F+       +++  HE GH++VA+   I V  FS+GFGP++ G  +R   R+ + L+
Sbjct: 1   MQTFIASVAVFGLLIFFHELGHFLVAKKVGIMVHEFSLGFGPKVFGF-NRGETRYNLRLL 59

Query: 64  PLGGYVSFS------EDEKDM---RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYN 114
           PLGG+V  +      ED++ +   R+F      ++   ++AGPL N V+A++ F   F  
Sbjct: 60  PLGGFVRMAGMDPNEEDDQGIPLDRTFNFKTALQRASVIIAGPLMNFVLAVVLFAVIFTL 119

Query: 115 TGV--MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
            G+      V  V    PA  AG+K GD I++++  +V  + ++     ++P   ++L +
Sbjct: 120 QGMPYATTEVGEVIKGFPAEKAGLKVGDRIVAVNDNSVEDWNQLVAETNKHPGESLNLTI 179

Query: 173 YREHVGVLHLKV-MPRLQDTVDRF--GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLD 229
            R   G   +K+ +  ++D   ++  GIK   P +         KL+    L + +    
Sbjct: 180 QR---GKEQVKLTLTTVKDVSGQYKIGIKPTQPLM--------KKLNPLAALAAGTSFTI 228

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
           ++S +   F+G +   F +   ++ ++GPVG+        + G    +   A  S  +G 
Sbjct: 229 QVSGLILSFIGQM---FTQQAPVD-LAGPVGVVNEIGKAAEFGIFQVMQLAAFLSINLGL 284

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
            NLLPIP LDG  ++  L E I G+ +  S    I  +G  ++L L  +   NDI  LM
Sbjct: 285 FNLLPIPALDGSRVLFLLWEKITGRPVEPSKESFIHLIGFGLLLLLMVVITYNDIVNLM 343


>gi|148653594|ref|YP_001280687.1| putative membrane-associated zinc metalloprotease [Psychrobacter
           sp. PRwf-1]
 gi|148572678|gb|ABQ94737.1| putative membrane-associated zinc metalloprotease [Psychrobacter
           sp. PRwf-1]
          Length = 479

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 100/160 (62%), Gaps = 11/160 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITS-RSGVRWKVSLIPL 65
           FL +   L  +V +HE+GHY+VAR+C ++VL++S+GFGP+L   TS ++G+ +++S +PL
Sbjct: 11  FLAFVAILGPLVALHEWGHYIVARMCGVKVLTYSIGFGPKLASWTSKKTGINYRLSALPL 70

Query: 66  GGYV--------SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAI-LFFTFFFYNTG 116
           GGYV        + +E EK + +F    P KKI  V AGP+ N ++AI LF   F   + 
Sbjct: 71  GGYVKMLDEREGAVAEHEKHL-AFNNQHPLKKIAIVAAGPVMNFIIAIALFSVLFLVPSE 129

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEV 156
            +   + ++ P +PAA   + KGD II++DG  V  +EE+
Sbjct: 130 QLNTRIGSILPDTPAATVNLPKGDKIIAVDGHKVQTWEEI 169



 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 111/233 (47%), Gaps = 7/233 (3%)

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHV 177
           ++P++  ++    A   G+K GD I++++   ++ + +    +R NP   +S  + R+  
Sbjct: 242 IEPIIGQLTQDGAAIRQGMKVGDKIVAINDQPINDWLDATRIIRANPETLLSFKVLRKDA 301

Query: 178 GVLH----LKVMPRLQDTV--DRFG-IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
             L     L++MP+ +       +G I   V  V I    D   + S   + +  +   +
Sbjct: 302 QGLEKPVMLQIMPQGKKATAGQTYGQIGAGVSPVEIVVPDDYKTMVSYDPISAVGKAFAK 361

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
              +    L  +         L+ +SGP+ IA I+K  F+  +   +A   + S ++  +
Sbjct: 362 TGQLATMTLNSMGKMITGKVGLDNLSGPITIAVISKQSFEISWEQVLANAGLISLSLAVL 421

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
           NLLPIP+LDGGHL+ +L+E+IRGK +   +  +   MG   +L    L I ND
Sbjct: 422 NLLPIPVLDGGHLLYYLIELIRGKPVSERMQIIGFNMGFLFLLAFMILAITND 474


>gi|261391719|emb|CAX49168.1| putative zinc metallopeptidase [Neisseria meningitidis 8013]
          Length = 446

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           V   V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L    E  G  
Sbjct: 217 VAGGVEKGSPAEKAGLKPGDRLTAADGKPIASWQEWANLTRQSPGKKITLTY--ERAGQT 274

Query: 181 HL-KVMPRLQDTVD-----RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI 234
           H   + P   +  D     R G++   P    ++     + +  +V+++F  G ++  S 
Sbjct: 275 HTADIRPDTVEQSDHTLIGRVGLR---PQPDRAWDAQIRRSYRPSVIRAFGMGWEKTVSH 331

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
           +   L         +  ++ ISGP+ IA IA    + G  +Y+ FLA+ S ++G +NLLP
Sbjct: 332 SWTTLKFFGKLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLP 391

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +P+LDGGHL+ +  E IRGK LG  V  +  R GL +++ +  +   ND+  L+
Sbjct: 392 VPVLDGGHLVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAVAFFNDVTRLL 445



 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L +  +++I+V +HEFGHY+VARLC ++V+ FSVGFG        R    W ++ I
Sbjct: 1   MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFF-TRKRGDTEWCLAPI 59

Query: 64  PLGGYVSFSE------DEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       E D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 60  PLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 119

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF 153
             ++P V  V P + AA AG + GD I S++G  V+ +
Sbjct: 120 TELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADW 157


>gi|332970845|gb|EGK09824.1| M50.004 family peptidase RseP [Psychrobacter sp. 1501(2011)]
          Length = 493

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 95/150 (63%), Gaps = 11/150 (7%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITS-RSGVRWKVSLIPLGGYVSF---- 71
           +V +HE+GHY+VARLC ++VL++S+GFGP+L   TS ++G  +++S +PLGGYV      
Sbjct: 21  LVALHEWGHYIVARLCGVKVLTYSIGFGPKLASWTSKKTGTNYRISALPLGGYVKMLDER 80

Query: 72  ----SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAI-LFFTFFFYNTGVMKPVVSNVS 126
               +E EK + +F    P KKI  V AGP+ N ++AI LF+  F   +  +   + ++ 
Sbjct: 81  EGEVAEAEKHL-AFNNQHPLKKIAIVAAGPVMNFIIAIALFWVLFLVPSEQLNTRIGSIL 139

Query: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEV 156
           P +PAA   + KGD I+++DG  V  +EEV
Sbjct: 140 PDTPAAAVNLPKGDKIVAVDGHQVQTWEEV 169



 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 113/233 (48%), Gaps = 7/233 (3%)

Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL-VLYREH 176
           ++P+V  ++    A   G+K GD II+++   V  +      +R+NP   ++  VL ++ 
Sbjct: 256 IEPIVGQLTEDGAAIRQGMKVGDKIIAINKQPVDDWLAATRIIRDNPETLLTFTVLRKDE 315

Query: 177 VGVLH---LKVMPRLQ--DTVDRFG-IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDE 230
            G  H   L++MP+ +  +    +G I   +  + I    D   + S   + +  +   +
Sbjct: 316 QGQSHEIDLQIMPQGKKGNAGQHYGQIGAGINPIEIVVPDDYKTMVSYDPMTAIGKAFAK 375

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
              +    L  +         L+ ISGP+ IA I+K  F+  +   +A   + S ++  +
Sbjct: 376 TGQLASMTLSSMGKMITGKVGLDNISGPITIAVISKQSFEISWEQVLANAGIISLSLAVL 435

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343
           NLLPIP+LDGGHL+ +L+E+IRG+ +   +  +   +G   +L    L I ND
Sbjct: 436 NLLPIPVLDGGHLLYYLIELIRGRPVSERMQIIGFNIGFLFLLGFMILAITND 488


>gi|261378083|ref|ZP_05982656.1| RIP metalloprotease RseP [Neisseria cinerea ATCC 14685]
 gi|269145531|gb|EEZ71949.1| RIP metalloprotease RseP [Neisseria cinerea ATCC 14685]
          Length = 446

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 125/237 (52%), Gaps = 17/237 (7%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           V+  V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L   R+     
Sbjct: 217 VIGGVEKGSPADKAGLKTGDKLTAADGKPITSWQEWANLTRQSPGRKIALTYERDG---- 272

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDET------KLHSRTVLQSFSRGLDEISS- 233
             +      DTV+R   K  +  VG+    D+       + +  +V+++F  G ++  S 
Sbjct: 273 QARTADIRPDTVER-SDKTLIGRVGLLPQSDKAWDRQIRRNYRPSVVRAFGMGWEKTVSY 331

Query: 234 --ITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
              T  F G L S    +   + ISGP+ IA IA    + G  +Y+ FLA+ S ++G +N
Sbjct: 332 SWTTVKFFGKLISG---NASASHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLN 388

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLP+P+LDGGHL+ +  E IRGK LG  +  +  R GL +++ +  +   NDI  L+
Sbjct: 389 LLPVPVLDGGHLVFYTAEWIRGKPLGERIQNIGLRFGLALMMLMMAIAFFNDITRLL 445



 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 90/166 (54%), Gaps = 13/166 (7%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L +  +++I+V +HEFGHY+VARLC ++VL FSVGFG        R    W ++ I
Sbjct: 1   MQTLLAFIFAILILVSLHEFGHYIVARLCGVKVLRFSVGFGKPFFS-RKRGDTEWCLAPI 59

Query: 64  PLGGYVSFSED------EKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       + D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 60  PLGGYVKMVDTREGEVAQADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 119

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITV----SAFEEVA 157
             ++P V  V P + AA AG + GD I S++   V    SA  E+A
Sbjct: 120 TEIRPYVGTVEPDTIAARAGFQSGDRIQSVNSTPVEDWGSAQTEIA 165


>gi|54296537|ref|YP_122906.1| hypothetical protein lpp0568 [Legionella pneumophila str. Paris]
 gi|53750322|emb|CAH11716.1| hypothetical protein lpp0568 [Legionella pneumophila str. Paris]
          Length = 450

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 120/228 (52%), Gaps = 1/228 (0%)

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
            + P+V  V P SPA  AG+K GD IIS++G   + +  +  YVRE P  +I+L + R+ 
Sbjct: 219 TIPPIVGEVVPDSPAEKAGLKIGDEIISVNGQHFNDWLYLVSYVRERPNSQINLDIKRQG 278

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +L + V    QD   +      V S  + +     +L  +  + +      +   +T 
Sbjct: 279 -KLLKITVHTGSQDNNGKLEGLIGVRSQKVDWPAHWLRLEQQPPISALGTAFKQTVQLTG 337

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
               ++         LN ISGPVGIA+ A +    G  +Y+ FLA+ S ++G +NLLPIP
Sbjct: 338 TTFILMGRLVTGKLGLNSISGPVGIAQGAGDSGRGGLVSYLFFLALVSISLGALNLLPIP 397

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +LDGGHL+ ++LE+IR K L   V  V    GL +++ L F+ + NDI
Sbjct: 398 MLDGGHLLYYVLEIIRRKPLSDGVKSVGIYFGLLLLVALMFVALSNDI 445



 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 18  VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF------ 71
           V IHE+GH+ VAR C ++VL FS GFG  L     + G  +  SL PLGGYV        
Sbjct: 16  VTIHEYGHFQVARWCGVKVLRFSFGFGKILARFYDKKGTEYAWSLFPLGGYVKMLDETEG 75

Query: 72  --SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNVSPA 128
             SE EK   +F   +   +I  V+AGPL N + A +  +         + P++ +V P 
Sbjct: 76  EVSEKEKPF-AFNNQSVLVRIAIVVAGPLFNFIFAFVALWLVLVIGMHSLAPMIESVRPN 134

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEE 155
           S AA AG+     I++L+G+ ++++ +
Sbjct: 135 SIAARAGLAPKQEILALNGVKINSWRD 161


>gi|325141197|gb|EGC63697.1| RIP metalloprotease RseP [Neisseria meningitidis CU385]
          Length = 446

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 121/232 (52%), Gaps = 7/232 (3%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE---HV 177
           V   V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L   R    H 
Sbjct: 217 VAGGVEKGSPAEKAGLKPGDRLTAADGKPIASWQEWANLTRQSPGKKITLTYERAGQTHT 276

Query: 178 GVLHLKVMPRLQDT-VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +    + +   T + R G++   P    ++     + +  +V+++F  G ++  S + 
Sbjct: 277 ADIRPDTVEQPDHTLIGRVGLR---PQPDRAWDAQIRRSYRPSVIRAFGMGWEKTVSHSW 333

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L         +  ++ ISGP+ IA IA    + G  +Y+ FLA+ S ++G +NLLP+P
Sbjct: 334 TTLKFFGKLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLPVP 393

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +LDGGHL+ +  E IRGK LG  V  +  R GL +++ +  +   ND+  L+
Sbjct: 394 VLDGGHLVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAVAFFNDVTRLL 445



 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 9/158 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L +  +++I+V +HEFGHY VARLC ++V+ FSVGFG        R    W ++ I
Sbjct: 1   MHTLLAFIFAILILVSLHEFGHYAVARLCGVKVVRFSVGFGKPFF-TRKRGDTEWCLAPI 59

Query: 64  PLGGYVSFSE------DEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       E D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 60  PLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 119

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF 153
             ++P V  V P + AA AG + GD I S++G  V+ +
Sbjct: 120 TELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADW 157


>gi|222823629|ref|YP_002575203.1| peptidase M50, membrane-associated zinc metallopeptidase
           [Campylobacter lari RM2100]
 gi|222538851|gb|ACM63952.1| peptidase M50, putative membrane-associated zinc metallopeptidase
           [Campylobacter lari RM2100]
          Length = 368

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 87/359 (24%), Positives = 168/359 (46%), Gaps = 21/359 (5%)

Query: 2   FWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVS 61
           F+   FL+    +  ++  HE GH++ A+   + V  FS+GFG  +   T ++   +++S
Sbjct: 17  FYSFNFLITLFVISFLIFFHELGHFLAAKHMRVDVEIFSIGFGKAVFKKTYKN-TEYRLS 75

Query: 62  LIPLGGYVSF--------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAIL-FFTFFF 112
            +P GGYV          S+   +  S+   +P  +I  + AGP  N  +A L +    F
Sbjct: 76  ALPFGGYVKLKGQDDLNPSKKNYEANSYNTLSPLARIYILFAGPFFNFFLAFLLYIAIAF 135

Query: 113 YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVL 172
                + PV+ N++P S A  A ++ GD I+++DG+ + +FEE++  V   P    +L+ 
Sbjct: 136 LGVQKLAPVIGNIAPNSAAQKANLQIGDKILAIDGVKIQSFEEISKLVHIKP----TLLN 191

Query: 173 YREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHS---RTVLQSFSRGLD 229
                 ++++ + P++    + F  K Q P +GI+   +   ++     ++  ++   ++
Sbjct: 192 IERDGKLINITLTPQIDQGYNEFYQKVQKPLIGIAPKGEFVTIYHPGINSLKYAYEESIE 251

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
               I +G   ++S     D +   + G + +  I     +          A+ S  +G 
Sbjct: 252 ASLLIFKGLAKIISGEL--DAK--NMGGIITMVDITSKAANTSIVVLFLITALISINLGV 307

Query: 290 MNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +NLLPIP LDGGH++  L E++  K +       ++  G+ ++L L      NDI   M
Sbjct: 308 LNLLPIPALDGGHILFNLYELVFKKEVPKVCFEYLSYFGMALLLSLMVFVTYNDITRFM 366


>gi|325133097|gb|EGC55769.1| RIP metalloprotease RseP [Neisseria meningitidis M6190]
 gi|325139075|gb|EGC61621.1| RIP metalloprotease RseP [Neisseria meningitidis ES14902]
          Length = 446

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 121/232 (52%), Gaps = 7/232 (3%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE---HV 177
           V   V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L   R    H 
Sbjct: 217 VAGGVEKGSPAEKAGLKPGDRLTAADGKPIASWQEWANLTRQSPGKKITLTYERAGQTHT 276

Query: 178 GVLHLKVMPRLQDT-VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +    + +   T + R G++   P    ++     + +  +V+++F  G ++  S + 
Sbjct: 277 ADIRPDTVEQPDHTLIGRVGLR---PQPDRAWDAQIRRSYRPSVVRAFGMGWEKTVSHSW 333

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L         +  ++ ISGP+ IA IA    + G  +Y+ FLA+ S ++G +NLLP+P
Sbjct: 334 TTLKFFGKLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLPVP 393

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +LDGGHL+ +  E IRGK LG  V  +  R GL +++ +  +   ND+  L+
Sbjct: 394 VLDGGHLVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAVAFFNDVTRLL 445



 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L +  +++I+V +HEFGHY+VARLC ++V+ FSVGFG        R    W ++ I
Sbjct: 1   MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFF-TRKRGDTEWCLAPI 59

Query: 64  PLGGYVSFSE------DEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       E D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 60  PLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 119

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF 153
             ++P V  V P + AA AG + GD I S++G  V+ +
Sbjct: 120 TELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADW 157


>gi|218767124|ref|YP_002341636.1| putative integral membrane protein [Neisseria meningitidis Z2491]
 gi|20978787|sp|Q9JX32|Y084_NEIMA RecName: Full=Putative zinc metalloprotease NMA0084
 gi|121051132|emb|CAM07403.1| putative integral membrane protein [Neisseria meningitidis Z2491]
 gi|254672757|emb|CBA06782.1| hypothetical zinc metalloprotease [Neisseria meningitidis alpha275]
          Length = 446

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 121/232 (52%), Gaps = 7/232 (3%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE---HV 177
           V   V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L   R    H 
Sbjct: 217 VAGGVEKGSPAEKAGLKPGDRLTAADGKPIASWQEWANLTRQSPGKKITLTYERAGQTHT 276

Query: 178 GVLHLKVMPRLQDT-VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +    + +   T + R G++   P    ++     + +  +V+++F  G ++  S + 
Sbjct: 277 ADIRPDTVEQPDHTLIGRVGLR---PQPDRAWDAQIRRSYRPSVVRAFGMGWEKTVSHSW 333

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L         +  ++ ISGP+ IA IA    + G  +Y+ FLA+ S ++G +NLLP+P
Sbjct: 334 TTLKFFGKLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLPVP 393

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +LDGGHL+ +  E IRGK LG  V  +  R GL +++ +  +   ND+  L+
Sbjct: 394 VLDGGHLVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAVAFFNDVTRLL 445



 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L +  +++I+V +HEFGHY+VARLC ++V+ FSVGFG        R    W ++ I
Sbjct: 1   MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFF-TRKRGDTEWCLAPI 59

Query: 64  PLGGYVSFSE------DEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       E D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 60  PLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 119

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF 153
             ++P V  V P + AA AG + GD I S++G  V+ +
Sbjct: 120 TELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADW 157


>gi|319411331|emb|CBY91742.1| putative zinc metallopeptidase [Neisseria meningitidis WUE 2594]
          Length = 446

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 121/232 (52%), Gaps = 7/232 (3%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE---HV 177
           V   V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L   R    H 
Sbjct: 217 VAGGVEKGSPAEKAGLKPGDRLTAADGKPIASWQEWANLTRQSPGKKITLTYERAGQTHT 276

Query: 178 GVLHLKVMPRLQDT-VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +    + +   T + R G++   P    ++     + +  +V+++F  G ++  S + 
Sbjct: 277 ADIRPDTVEQPDHTLIGRVGLR---PQPDRAWDAQIRRSYRPSVVRAFGMGWEKTVSHSW 333

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L         +  ++ ISGP+ IA IA    + G  +Y+ FLA+ S ++G +NLLP+P
Sbjct: 334 TTLKFFGKLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLPVP 393

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +LDGGHL+ +  E IRGK LG  V  +  R GL +++ +  +   ND+  L+
Sbjct: 394 VLDGGHLVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAVAFFNDVTRLL 445



 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L +  +++I+V +HEFGHY+VARLC ++V+ FSVGFG        R    W ++ I
Sbjct: 1   MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFF-TRKRGDTEWCLAPI 59

Query: 64  PLGGYVSFSE------DEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       E D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 60  PLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 119

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF 153
             ++P V  V P + AA AG + GD I S++G  V+ +
Sbjct: 120 TELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADW 157


>gi|87303147|ref|ZP_01085945.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Synechococcus sp. WH 5701]
 gi|87282314|gb|EAQ74274.1| Peptidase M50, putative membrane-associated zinc metallopeptidase
           [Synechococcus sp. WH 5701]
          Length = 362

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 152/313 (48%), Gaps = 44/313 (14%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           ++V+HE GH++ A    IRV  FS+GFGP L+    R GV++ +  IPLGGYV+F +DE+
Sbjct: 13  LIVVHEAGHFLAATWQGIRVSGFSIGFGPALL-QRQRRGVQFALRAIPLGGYVAFPDDEE 71

Query: 77  DMR------SFFCAAPW-KKILTVLAGPLANCVMA--ILFF--------TFFFYNTGVMK 119
           D              P  ++ L + AG +AN ++A  +LF           F    GV+ 
Sbjct: 72  DSEIPSDDPDLLRNRPLPQRALVIAAGVIANLLLAWAVLFGQGLMVGVPAGFSATPGVL- 130

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITV----SAFEEVAPYVRENPLHEISLVLYRE 175
             V+ V    PAA +G+  GD I+S+ G+ V     A  ++   ++  P  E +L +  E
Sbjct: 131 --VAAVQQGQPAAASGLMAGDRILSIGGVPVGGGSKAVVDLVADIQGAP--ERTLQIQAE 186

Query: 176 HVG-VLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLH-----SRTVLQSFSRGLD 229
             G  L L++ P  +D + R G + Q P+    F   +  L      +R  +Q   R +D
Sbjct: 187 RAGETLSLRLTPADRDGIGRIGAQLQ-PNGSEVFRPAKGPLELFGQTNRVFVQLIRRTVD 245

Query: 230 EISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGF 289
                  GF+  L + FG+     Q+SGPV I  +  +    G  +   F A+ S  +  
Sbjct: 246 -------GFV-ALVTHFGETA--PQVSGPVKIVEMGASLARQGGGSLFVFAALISINLAV 295

Query: 290 MNLLPIPILDGGH 302
           +N LP+P+LDGG 
Sbjct: 296 LNALPLPLLDGGQ 308


>gi|325129102|gb|EGC51951.1| RIP metalloprotease RseP [Neisseria meningitidis N1568]
          Length = 446

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 121/232 (52%), Gaps = 7/232 (3%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYRE---HV 177
           V   V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L   R    H 
Sbjct: 217 VAGGVEKGSPAEKAGLKPGDRLTAADGKPIASWQEWANLTRQSPGKKITLTYERAGQTHT 276

Query: 178 GVLHLKVMPRLQDT-VDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +    + +   T + R G++   P    ++     + +  +V+++F  G ++  S + 
Sbjct: 277 ADIRPDTVEQPDHTLIGRVGLR---PQPDRAWDAQIRRSYRPSVVRAFGMGWEKTVSHSW 333

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
             L         +  ++ ISGP+ IA IA    + G  +Y+ FLA+ S ++G +NLLP+P
Sbjct: 334 TTLKFFGKLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLPVP 393

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +LDGGHL+ +  E IRGK LG  V  +  R GL +++ +  +   ND+  L+
Sbjct: 394 VLDGGHLVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAVAFFNDVTRLL 445



 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L +  +++I+V +HEFGHY+VARLC ++V+ FSVGFG        R    W ++ I
Sbjct: 1   MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFF-TRKRGDTEWCLAPI 59

Query: 64  PLGGYVSFSE------DEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       E D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 60  PLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 119

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF 153
             ++P V  V P + AA AG + GD I S++G  V+ +
Sbjct: 120 TELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADW 157


>gi|71066085|ref|YP_264812.1| peptidase RseP [Psychrobacter arcticus 273-4]
 gi|71039070|gb|AAZ19378.1| RseP peptidase. Metallo peptidase. MEROPS family M50B
           [Psychrobacter arcticus 273-4]
          Length = 457

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 100/162 (61%), Gaps = 13/162 (8%)

Query: 6   CFLLYTVSLIII----VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITS-RSGVRWKV 60
            FLL  ++ I +    + +HE+GHY+VARLC ++VL++S+GFGP+L G TS +SG+ +++
Sbjct: 2   TFLLTLLAAIFVLGPLIALHEWGHYIVARLCGVKVLTYSIGFGPKLFGWTSKKSGIDYRI 61

Query: 61  SLIPLGGYVSFSED-------EKDMRSFFCAAPWKKILTVLAGPLANCVMAI-LFFTFFF 112
           S +PLGGYV   ++       E+   +F    P KKI  V AGP+ N V+AI LF+  F 
Sbjct: 62  SALPLGGYVKMLDEREGEVAKEEQHLAFNRQHPLKKIAIVAAGPIMNFVIAIVLFWVLFM 121

Query: 113 YNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFE 154
             +  +   +  V P +PAA+A +  GD I+++DG  V  +E
Sbjct: 122 TPSEQLATKIGQVLPDTPAAMAQLPVGDKIVAIDGHDVQTWE 163



 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 126/233 (54%), Gaps = 14/233 (6%)

Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179
           P+V +++P   A+  G+K  D I +++   ++ +      +R+NP   ++  + R+   +
Sbjct: 227 PIVGDLTPDGAASRQGLKVSDRITAINDEAINDWISATRIIRDNPETLLTFSVLRDDKPI 286

Query: 180 LHLKVMPR-----LQDTVDRFGIKRQVPSVGISFSYDETKLHS--RTVLQSFSRGLDEIS 232
             L++MP+     L +   + G       + I   Y  T ++    ++++SF +  ++++
Sbjct: 287 -ELQIMPQGKKDNLGNDYGQIGAMVAQSEIIIPDEYKTTVVYGPGESLIKSFEK-TEQLA 344

Query: 233 SITRGFLG-VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
            +T   +G +LS   G    L+ +SGP+ IA++AK  FD  +   ++  A+ S ++  +N
Sbjct: 345 VMTVSSMGKMLSGMIG----LDNLSGPITIAKVAKQSFDISWQMVLSTAALISLSLAVLN 400

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           LLPIP+LDGGH++ +L+E+IRGK L   V  V   +GL ++     L I NDI
Sbjct: 401 LLPIPVLDGGHIVYYLIELIRGKPLSEGVQMVGLNIGLLLLAGFMVLAIGNDI 453


>gi|291276686|ref|YP_003516458.1| putative membrane-associated zinc metalloprotease [Helicobacter
           mustelae 12198]
 gi|290963880|emb|CBG39716.1| putative membrane-associated zinc metalloprotease [Helicobacter
           mustelae 12198]
          Length = 353

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 166/354 (46%), Gaps = 44/354 (12%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF-- 71
           L  ++  HE GH++ A+L  I V  FS+GFG +L+  T R G  + +SLIPLGGYV    
Sbjct: 10  LAFLIFFHELGHFLAAKLFGIHVEVFSIGFGKKLLTKTHR-GTEYALSLIPLGGYVKLKG 68

Query: 72  --------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF-FYNTGVMKPVV 122
                   S+  KD  S+    P  +I  + AGP  N ++A L +         V+ PVV
Sbjct: 69  QNDLDALHSQGGKD--SYSDKNPLVRIAVLFAGPFFNLILAFLIYVVVAMMGIQVIPPVV 126

Query: 123 SNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHL 182
             V   SPA  AG+  GD I+S++   V+ + +V   + +    +I L + R ++     
Sbjct: 127 GKVLKDSPAYEAGILPGDRILSINNQGVNRWNQVYELISQE--QKIQLRILRNNMEYEFF 184

Query: 183 KVMPRLQDTVD------RFGI--KRQVPSVGISF----SYDETKLHSRTVLQSFSRGLDE 230
                ++D  +      R GI  K ++ ++ + F     Y  TK+   + L         
Sbjct: 185 LQTKPIEDPANSQKKHYRIGIVAKNEIETLYLPFDGALEYGCTKVWESSFL--------- 235

Query: 231 ISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
              I  G   +L  A      + +ISGPV I      F    F   + ++A+ S  +G +
Sbjct: 236 ---ILSGLQKLLQGAI----PMTEISGPVMIVDSIAQFAQKDFVVMLLWVALISVNLGIL 288

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           NLLPIP LDGG ++  L E++  K L     + +T +G  I+L L  LG+ NDI
Sbjct: 289 NLLPIPALDGGQILFNLYELLTRKPLHEQGVKYLTLLGWLILLGLMSLGLYNDI 342


>gi|254805773|ref|YP_003083994.1| hypothetical zinc metalloprotease [Neisseria meningitidis alpha14]
 gi|254669315|emb|CBA08326.1| hypothetical zinc metalloprotease [Neisseria meningitidis alpha14]
          Length = 446

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           V   V   SPA  AG+K GD + + DG  +++++E A   R++P  +I+L    E  G  
Sbjct: 217 VAGGVEKGSPAEKAGLKPGDRLTAADGKPIASWQEWANLTRQSPGKKITLTY--ERAGQT 274

Query: 181 HL-KVMPRLQDTVD-----RFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI 234
           H   + P   +  D     R G++   P    ++     + +  +V+++F  G ++  S 
Sbjct: 275 HTADIRPDTVEQSDHTLIGRVGLR---PQPDRAWDAQIRRSYRPSVVRAFGMGWEKTVSH 331

Query: 235 TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLP 294
           +   L         +  ++ ISGP+ IA IA    + G  +Y+ FLA+ S ++G +NLLP
Sbjct: 332 SWTTLKFFGKLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLP 391

Query: 295 IPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           +P+LDGGHL+ +  E IRGK LG  V  +  R GL +++ +  +   ND+  L+
Sbjct: 392 VPVLDGGHLVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAVAFFNDVTRLL 445



 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 9/158 (5%)

Query: 4   LDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLI 63
           +   L +  +++I+V +HEFGHY VA+LC ++VL FSVGFG        R    W ++ I
Sbjct: 1   MHTLLAFIFAILILVSLHEFGHYAVAKLCGVKVLRFSVGFGKPFF-TRKRGDTEWCLAPI 59

Query: 64  PLGGYVSFSE------DEKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTF-FFYNT 115
           PLGGYV   +       E D+  +F    P K+I  V AGPL N  +A+L +   F +  
Sbjct: 60  PLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGV 119

Query: 116 GVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF 153
             ++P V  V P + AA AG + GD I S++G  V+ +
Sbjct: 120 TELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADW 157


>gi|315282165|ref|ZP_07870633.1| RIP metalloprotease RseP [Listeria marthii FSL S4-120]
 gi|313614197|gb|EFR87873.1| RIP metalloprotease RseP [Listeria marthii FSL S4-120]
          Length = 420

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 133/269 (49%), Gaps = 15/269 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFF-FYNTGV--MKPVVSNVSPASPAAIAG 135
           RSF   +   + +T+ AGPL N ++AIL FT   F   GV      + NV P   AA AG
Sbjct: 159 RSFNAKSLGNRAMTIFAGPLFNFILAILIFTALAFVQGGVPSSDNTLGNVLPDGAAAEAG 218

Query: 136 VKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRF 195
           +KKGD ++S+DG  + ++ ++   V ENP   +   + R+      + V P  Q+     
Sbjct: 219 LKKGDEVLSIDGKDMKSWTDIVQSVSENPGKTLDFKVDRDG-KTQDIDVKPATQEEN--- 274

Query: 196 GIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQI 255
              ++V  +G+    D +   +  +   F++  + I  I      +L + F     L+ +
Sbjct: 275 --GKKVGKIGVETPMDTS--FTAKITNGFTQTWNWIVQI----FTILGNMFTGGFSLDML 326

Query: 256 SGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKS 315
           +GPVGI    +    +GF   + + A+ S  +G +NLLP+P LDGG L+ FL E++RGK 
Sbjct: 327 NGPVGIYTSTQQVVQYGFMTVLNWTAVLSINLGIVNLLPLPALDGGRLMFFLYELVRGKP 386

Query: 316 LGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +      +I   G  +++ L  L   NDI
Sbjct: 387 IDPKKEGIIHFAGFALLMVLMILVTWNDI 415



 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 40/65 (61%), Gaps = 2/65 (3%)

Query: 16 IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-ED 74
          +IV  HE GH++ A+   I V  FS+GFGP++     +   ++ + L+P+GGYV  + ED
Sbjct: 13 LIVFFHELGHFLFAKRAGIMVKDFSIGFGPKIFAYRKKE-TQYTIRLLPIGGYVRMAGED 71

Query: 75 EKDMR 79
           +++ 
Sbjct: 72 GEEIE 76


>gi|209525885|ref|ZP_03274420.1| membrane-associated zinc metalloprotease [Arthrospira maxima
           CS-328]
 gi|209493694|gb|EDZ94014.1| membrane-associated zinc metalloprotease [Arthrospira maxima
           CS-328]
          Length = 366

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 96/334 (28%), Positives = 152/334 (45%), Gaps = 34/334 (10%)

Query: 16  IIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE 75
           I++V+HE GH+M ARL +I V  FS+GFGP L          + +   PLGG+V F +++
Sbjct: 12  ILIVVHELGHFMAARLQHIHVNRFSIGFGPVLWKYQGPE-TEYALRGFPLGGFVGFPDED 70

Query: 76  ------KDMRSFFCAAP-WKKILTVLAGPLANCVMAILFFTF---------FFYNTGVMK 119
                 KD  +     P   + + + AG +AN + A L             F Y  GV  
Sbjct: 71  PDSEIPKDDPNLLSNRPILDRAIVISAGVIANLIFAYLLLVVQVGMIGVPDFDYQPGVRV 130

Query: 120 P-VVSNVSPASPAAIAGVKKGDCIISLDGITVSA----FEEVAPYVRENPLHEISLVLYR 174
           P V S+VS  S AA AG++  D IIS++G  + A       +   ++ NP   + + + R
Sbjct: 131 PSVASDVS--SAAAKAGIEDNDLIISVNGEELGAESKSITRLIEVIQSNPNQPLKMEVQR 188

Query: 175 EHVGVLHLKVMPRL-QDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISS 233
               ++ ++V P    D   R G++       +S +    +  +  ++ +F +G +E   
Sbjct: 189 GDR-IIPVEVTPEPGSDGKGRIGVQ-------LSPNGQIVRYQADGIIDAFVKGAEEFQR 240

Query: 234 ITRGFLGVLSSAFGK-DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNL 292
           I    L   S           Q+SGPV I  I  N      +    F A+ S  +  +N+
Sbjct: 241 IFNLTLAGFSQLINNFRETAPQLSGPVAIVAIGANIARSDASNLFQFAALISINLAIINI 300

Query: 293 LPIPILDGGHLITFLLEMIRGKSLGVSVTRVITR 326
           LP+P LDGG L   L+E +RGK L   V   + +
Sbjct: 301 LPLPALDGGQLAFLLIEALRGKPLPQRVQESVMQ 334


>gi|312135562|ref|YP_004002900.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           owensensis OL]
 gi|311775613|gb|ADQ05100.1| membrane-associated zinc metalloprotease [Caldicellulosiruptor
           owensensis OL]
          Length = 349

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 94/353 (26%), Positives = 168/353 (47%), Gaps = 29/353 (8%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
            +L  + L I++++HEFGH++V +L  + V  F++GFGP+L  I  +    + V    +G
Sbjct: 3   LILALIVLTIVILVHEFGHFIVCKLSGVLVEEFAIGFGPKLFSIKGKE-TEYSVRAFLIG 61

Query: 67  GYVSFSEDEKDM---RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVS 123
           GYV    ++KD+   R+   A  +K+IL VL GP+ N ++AI+      Y  G     + 
Sbjct: 62  GYVKPLGEDKDIDHPRALNNAKVYKRILMVLMGPVMNFILAIIIMMGIGYFIGFGTNTIG 121

Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVR-ENPLH---EISLVLYREHVGV 179
            V P  PA  AG++ GD I++LD   V  +++V+ Y+   N L+   E+ + + R+    
Sbjct: 122 RVEPNMPAYEAGIRSGDRIVALDKNRVYVWDQVSFYLAVHNMLYKDREVEIKVLRDGKQY 181

Query: 180 LHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFL 239
           +  +VMP+            +   +GI+     +K+  +    S   G+    +  +G +
Sbjct: 182 I-FRVMPKYDPNT-------KTKRIGIA-----SKISRKNFFDSIYYGVFGTYAEIKGTI 228

Query: 240 GVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA--------FLAMFSWAIGFMN 291
             +          ++I GPVG+ +      + GF   +          + + S  +G +N
Sbjct: 229 YSVVLMITGRVSASEIMGPVGMVKTIGEAANVGFKQSVLSGLLNILWLMQLISVNLGVIN 288

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           L+P P LDG  L+ +L E +  K        +I  +G  ++LFL  +   NDI
Sbjct: 289 LIPFPALDGSRLVFYLYEAVARKPFNREKEALIHTIGFVLLLFLLIIVTFNDI 341


>gi|229006096|ref|ZP_04163784.1| Zinc metalloprotease rasP [Bacillus mycoides Rock1-4]
 gi|228755172|gb|EEM04529.1| Zinc metalloprotease rasP [Bacillus mycoides Rock1-4]
          Length = 420

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 135/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F       G  V KP+V  V   S A  AG+
Sbjct: 160 RQFGSKTLGQRALTIFAGPAMNFILAFVIFVIIGLVQGIPVDKPMVGKVMKDSVAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   + +++V   VRE+P  EI+L + R+    L++KV P    + D+ G
Sbjct: 220 KQDDTIQAIDGKDTNTWKDVVTIVREHPNKEITLHVKRDS-KQLNVKVTP----SADKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +++L S   G ++  + T+     L         +N +S
Sbjct: 275 -KEEVGRIGVYSPVE------KSILGSIKSGFEQTYTWTKLIFDSLVKLVTGQFSINDLS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFIRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 45.8 bits (107), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 58/139 (41%), Gaps = 24/139 (17%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           +V  HE GH   A+   I    F++GFGP++        V + V L+PLGGYV  + ++ 
Sbjct: 16  LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTVRLLPLGGYVRMAGEDA 74

Query: 77  DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGV 136
           +        P KK+  VL                   N  VMK V+          +  V
Sbjct: 75  ETVEL---KPGKKVGLVLN-----------------ENEEVMKLVLDGREKYPNVRVIEV 114

Query: 137 KKGDCIISLDGITVSAFEE 155
           ++ D   +L   T++ +EE
Sbjct: 115 EQADLEHNL---TIAGYEE 130


>gi|16330353|ref|NP_441081.1| hypothetical protein slr1821 [Synechocystis sp. PCC 6803]
 gi|2496803|sp|P73714|Y1821_SYNY3 RecName: Full=Putative zinc metalloprotease slr1821
 gi|1652842|dbj|BAA17761.1| slr1821 [Synechocystis sp. PCC 6803]
          Length = 366

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 155/326 (47%), Gaps = 40/326 (12%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L +++ +HE GH+  ARL  I V  F++GFGP L+         + +  IPLGGYV+F +
Sbjct: 13  LAVLIAVHELGHFAAARLQGIHVTRFALGFGPPLLKYQGAE-TEYSIRAIPLGGYVAFPD 71

Query: 74  DEKDMR------SFFCAAP-WKKILTVLAGPLANCVMAILFF-----TFFFYNTGVMKP- 120
           D+ D        +     P   + + + AG +AN V A         T  F N   ++P 
Sbjct: 72  DDPDSEIPADDPNLLKNRPILDRAIVISAGVIANLVFAYFLLIGQVSTIGFQN---IQPG 128

Query: 121 -VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPY----VRENPLHEISLVLYR- 174
            V+  V  AS A +AG++ GD ++SL G T+  F +        VR +P   I++ + R 
Sbjct: 129 LVIPQVDSASAAQVAGMEPGDIVLSLQGNTLPGFPDATTQFIDIVRRSPSVPITVEVQRG 188

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI 234
           E    L +   P  +    + G+   +P+V       ETK  S   L++ +   +    I
Sbjct: 189 EETKTLTITPTPDAEGK-GKIGVAL-LPNV-------ETKRASNP-LEALTYSAEAFERI 238

Query: 235 ----TRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
               T+GF  ++S+ F  +   +Q++GPV I     N      +    F A+ S  +  +
Sbjct: 239 VKLTTQGFWQLISN-FADNA--SQVAGPVKIVEYGANIARSDASNLFQFGALISINLAVI 295

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSL 316
           N+LP+P LDGG L+  L+E + GK L
Sbjct: 296 NILPLPALDGGQLVFLLIEGLLGKPL 321


>gi|255577577|ref|XP_002529666.1| Protease ecfE, putative [Ricinus communis]
 gi|223530846|gb|EEF32708.1| Protease ecfE, putative [Ricinus communis]
          Length = 447

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 97/351 (27%), Positives = 168/351 (47%), Gaps = 31/351 (8%)

Query: 14  LIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSE 73
           L  I+++HE GH++ A L  I V  F+VGFGP L    +++ V + V   PLGG+V F +
Sbjct: 95  LTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFNAKN-VEYSVRAFPLGGFVGFPD 153

Query: 74  DEK------DMRSFFCAAP-WKKILTVLAGPLANCVMA--ILFFTFFFYNTGVMKP---- 120
           ++       D ++     P   +++ + AG +AN + A  I+F         V +     
Sbjct: 154 NDPESDIPPDDKNLLKNRPILDRVIVISAGVIANIIFAYAIIFVQVLSVGLPVQEAFPGV 213

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITV-----SAFEEVAPYVRENPLHEISLVLYRE 175
           +V  V   S A+  G+  GD I++++GI +     S+  EV   ++ NP   + L + R 
Sbjct: 214 LVPEVRAFSAASRDGLLPGDVILAINGIDLPKTGPSSVSEVVDVIKRNPKRNVLLTVGR- 272

Query: 176 HVGVLHLKVMPRLQ-DTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSI 234
               L + V P    D   + G++   P+V I      TKL ++ VL++ +    E + +
Sbjct: 273 GAQALEIGVTPDENFDGTGKIGVQLS-PNVKI------TKLVAKNVLEAINFAGKEFAGL 325

Query: 235 TRGFLGVLSSAFGK-DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLL 293
           +   L  L   F       +++SGPV I  +         +    F A+ +  +  +NLL
Sbjct: 326 SSNVLDSLKQTFLNFSQSASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLL 385

Query: 294 PIPILDGGHLITFLLEMIR-GKSLGVSVTRVITRMGLCIILFL-FFLGIRN 342
           P+P LDGG L   L+E  R G+ L + + + I   G+ +++ L  FL +R+
Sbjct: 386 PLPALDGGSLALILIEAARGGRKLPLEIEQRIMSSGIMLVILLGLFLIVRD 436


>gi|228998596|ref|ZP_04158183.1| Zinc metalloprotease rasP [Bacillus mycoides Rock3-17]
 gi|228761064|gb|EEM10023.1| Zinc metalloprotease rasP [Bacillus mycoides Rock3-17]
          Length = 420

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 135/268 (50%), Gaps = 14/268 (5%)

Query: 79  RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG--VMKPVVSNVSPASPAAIAGV 136
           R F      ++ LT+ AGP  N ++A + F       G  V KP+V  V   S A  AG+
Sbjct: 160 RQFGSKTLGQRALTIFAGPAMNFILAFVIFVIIGLVQGIPVDKPMVGKVMKDSVAEQAGL 219

Query: 137 KKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFG 196
           K+ D I ++DG   + +++V   VRE+P  EI+L + R+    L++KV P    + D+ G
Sbjct: 220 KQDDTIQAIDGKDTNTWKDVVTIVREHPNKEITLHVKRDSEQ-LNVKVTP----SADKEG 274

Query: 197 IKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQIS 256
            K +V  +G+    +      +++L S   G ++  + T+     L         +N +S
Sbjct: 275 -KEEVGRIGVYSPVE------KSILGSIKSGFEQTYTWTKLIFDSLVKLVTGQFSINDLS 327

Query: 257 GPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSL 316
           GPVGI  +     D+GF   ++  A+ S  +G  NLLP+P LDGG L  FL+E +RGK +
Sbjct: 328 GPVGIYNLTDQVVDYGFIRVLSLAAVLSINLGLFNLLPVPALDGGRLFFFLIEALRGKPI 387

Query: 317 GVSVTRVITRMGLCIILFLFFLGIRNDI 344
                 ++  +G  +++ L  +   NDI
Sbjct: 388 DRQKEGMVHFIGFALLMLLMLVVTWNDI 415



 Score = 46.2 bits (108), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 58/139 (41%), Gaps = 24/139 (17%)

Query: 17  IVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEK 76
           +V  HE GH   A+   I    F++GFGP++        V + V L+PLGGYV  + ++ 
Sbjct: 16  LVFFHELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETV-YTVRLLPLGGYVRMAGEDA 74

Query: 77  DMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGV 136
           +        P KK+  VL                   N  VMK V+          +  V
Sbjct: 75  ETVEL---KPGKKVGLVLN-----------------ENEEVMKLVLDGREKYPNVRVIEV 114

Query: 137 KKGDCIISLDGITVSAFEE 155
           ++ D   +L   T++ +EE
Sbjct: 115 EQADLEHNL---TIAGYEE 130


>gi|148360880|ref|YP_001252087.1| membrane associated zinc metalloprotease [Legionella pneumophila
           str. Corby]
 gi|148282653|gb|ABQ56741.1| membrane associated zinc metalloprotease [Legionella pneumophila
           str. Corby]
          Length = 450

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 120/228 (52%), Gaps = 1/228 (0%)

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
            + P+V  V P SPA  AG+K GD IIS++G   + +  +  YVRE P  +I+L + R+ 
Sbjct: 219 TIPPIVGEVVPDSPAEKAGLKIGDEIISVNGQHFNDWLYLVSYVRERPNSQINLDIKRQG 278

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +L + V    QD   +      V S  + +     +L  +  + +      +   +T 
Sbjct: 279 -KLLKITVHTGSQDNNGKLEGLIGVRSQKVDWPAHWLRLEQQPPISALGTAFKQTIQLTG 337

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
               ++         LN ISGPVGIA+ A +    G  +Y+ FLA+ S ++G +NLLPIP
Sbjct: 338 TTFILMGRLVTGKLGLNSISGPVGIAQGAGDSGRGGLVSYLFFLALVSISLGALNLLPIP 397

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +LDGGHL+ ++LE+IR K L   V  V    GL +++ L F+ + NDI
Sbjct: 398 MLDGGHLLYYVLEIIRRKPLSDGVKSVGIYFGLLLLVALMFVALSNDI 445



 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 18  VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF------ 71
           V IHE+GH+ VAR C ++VL FS GFG  L     + G  +  SL PLGGYV        
Sbjct: 16  VTIHEYGHFQVARWCGVKVLRFSFGFGKILARFYDKKGTEYAWSLFPLGGYVKMLDETEG 75

Query: 72  --SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNVSPA 128
             SE EK   +F   +   +I  V+AGPL N + A +  +         + P++ +V P 
Sbjct: 76  EVSEKEKPF-AFNNQSVLVRIAIVVAGPLFNFIFAFVALWLVLVIGMHSLAPMIESVKPN 134

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEE 155
           S AA AG+     I++L+G+ ++++ +
Sbjct: 135 SIAARAGLLPKQEILALNGVKINSWRD 161


>gi|169824426|ref|YP_001692037.1| membrane-associated Zn-dependent protease [Finegoldia magna ATCC
           29328]
 gi|167831231|dbj|BAG08147.1| membrane-associated Zn-dependent protease [Finegoldia magna ATCC
           29328]
          Length = 334

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 91/302 (30%), Positives = 154/302 (50%), Gaps = 23/302 (7%)

Query: 21  HEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFS-EDEKDM- 78
           HEFGH++VA++  + VL FS+G GP+L    S +G  + + L+P+GGY     EDE++  
Sbjct: 18  HEFGHFIVAKMNGVSVLEFSIGMGPKLFQKES-NGTLYSLRLLPVGGYCQLEGEDEENDS 76

Query: 79  -RSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVK 137
             S    +P+ ++  +LAG + N ++A +        + V   V S V   SPA  +G++
Sbjct: 77  PNSLNNQSPFVRLKVILAGAIMNFILAFILLILLMSVSRVSTEV-SGVLENSPAYSSGIQ 135

Query: 138 KGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGI 197
           +GD I+S++G  +   E+V   ++++   ++ +VL R      ++KV PRL++   + G+
Sbjct: 136 EGDKIVSINGQMLEDGEQVLESIKKSK-GDLDIVLLRNEKSK-NIKVTPRLENNNRKIGV 193

Query: 198 KRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSIT---RGFLGVLSSAFGKDTRLNQ 254
             Q          +E  + +  +++ F +G+    ++T     FLG+L +  GK      
Sbjct: 194 NFQ----------EEYNIKNFNIIKGFKKGIATFLNLTGMLYKFLGMLIT--GKLGLGGV 241

Query: 255 ISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGK 314
                 +  I  N    G    I  LA  +  +G  NLLPIP LDGG  I  L+EMI GK
Sbjct: 242 SGPVGVVKEIG-NAAKTGVANLIFLLAYININLGVFNLLPIPALDGGRAIFILIEMIFGK 300

Query: 315 SL 316
            +
Sbjct: 301 KI 302


>gi|325267073|ref|ZP_08133742.1| RIP metalloprotease RseP [Kingella denitrificans ATCC 33394]
 gi|324981426|gb|EGC17069.1| RIP metalloprotease RseP [Kingella denitrificans ATCC 33394]
          Length = 466

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 126/237 (53%), Gaps = 18/237 (7%)

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
            +  V P S A  AG+KKGD II+++ +    +E  +  VREN    + +   R++   +
Sbjct: 235 AIGAVEPGSAADRAGLKKGDRIIAINNVPTPTWESWSKIVRENAGANLDVRFVRDN-DTM 293

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYD-----ETKLHSR-TVLQSFSRGLDEISSI 234
            +K+MP   +  D+  I   +   G+    D     + ++H + + LQ+   G  +++  
Sbjct: 294 QVKLMPTPIELPDKSQI---IGMAGVRQGSDPEWAKQVRVHYQPSSLQALQHGWQKMTD- 349

Query: 235 TRGFLGVLSSAFGK----DTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFM 290
              + G+  S FGK    +  L+ ISGP+ IA +A      G+  Y+ FLA+ S ++G M
Sbjct: 350 ---YSGMTFSFFGKLITGNASLSHISGPLTIAEVAGATAQIGWQPYVEFLALVSISLGVM 406

Query: 291 NLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGL 347
           NLLPIP+LDGGHL+ + +E++RG+ L   +  +  R+GL  +L +  L   NDI  L
Sbjct: 407 NLLPIPVLDGGHLVFYTIELLRGRPLSKRIQDMGLRLGLAAMLTMMILAFFNDITRL 463



 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 85/148 (57%), Gaps = 10/148 (6%)

Query: 18  VVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSED--- 74
           V +HE GH +VARLC I+VL FSVGFG        R+ + W ++ IPLGGYV   +    
Sbjct: 32  VSLHELGHLLVARLCGIKVLRFSVGFGTPFYTKRWRN-IDWCLAPIPLGGYVKMVDTREG 90

Query: 75  ---EKDMR-SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGV--MKPVVSNVSPA 128
              E+D+  +F    P K+I TV AGPL N ++A+L +   F   G+  ++P+V  V P 
Sbjct: 91  NVAEEDLPYAFDRQHPLKRIATVAAGPLTNLLLAVLLYWISFGIGGIHELRPMVGTVYPK 150

Query: 129 SPAAIAGVKKGDCIISLDGITVSAFEEV 156
           S AA AG + GD I+ ++G  +  F + 
Sbjct: 151 SIAAQAGFQPGDQILRVNGKPIRHFSDA 178


>gi|208434204|ref|YP_002265870.1| hypothetical protein HPG27_237 [Helicobacter pylori G27]
 gi|208432133|gb|ACI27004.1| hypothetical protein HPG27_237 [Helicobacter pylori G27]
          Length = 350

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 93/357 (26%), Positives = 176/357 (49%), Gaps = 23/357 (6%)

Query: 7   FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66
           F++  + L  ++ +HE GH+ +AR+C ++V  FS+GFG +L       G ++ +SLIPLG
Sbjct: 2   FIIAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC-FFKLFGTQFALSLIPLG 60

Query: 67  GYVSF-----SEDEKDMR-----SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116
           GYV        E+E++       S+   +P++K+  +  G   N + AIL + FF   +G
Sbjct: 61  GYVKLKGMDKEENEENKTHQANDSYAQKSPFQKLWILFGGAFFNFLFAILVY-FFLALSG 119

Query: 117 --VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYR 174
             V+ PV+  +     A  AG+ KGD I+S++   +++F E+   V      E+ L + R
Sbjct: 120 EKVLLPVIGGLE--KNALEAGLLKGDKILSINHKKIASFGEIRSVVAR-ARGELVLEIER 176

Query: 175 EHVGVLHLKVMPRLQDTVDRFGIKRQV---PSVGISFSYDETKLHSRTVLQSFSRGLDEI 231
            +  +L  ++ P++   +       ++    ++GI     +  + S +++Q+F + L   
Sbjct: 177 NN-QILEKRLTPKIVAVISESNDPNEMIRYKAIGIKPDMQKMGVVSYSLIQAFKQALSRF 235

Query: 232 SSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMN 291
                  +  L         + ++SG +GI     +   +  +  + F A  S  +G +N
Sbjct: 236 KEGVVLIVDSLRRLIMGSASVKELSGVIGIVGALSH--ANSLSMLLLFGAFLSINLGILN 293

Query: 292 LLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLM 348
           LLPIP LDG  ++  + + I   +L   +   +   G+  ++F+ FLG+ NDI  L+
Sbjct: 294 LLPIPALDGAQMLGVVFKNIFHITLPTPIQNALWLAGVGFLVFVMFLGLFNDITRLL 350


>gi|296106054|ref|YP_003617754.1| membrane associated zinc metalloprotease [Legionella pneumophila
           2300/99 Alcoy]
 gi|295647955|gb|ADG23802.1| membrane associated zinc metalloprotease [Legionella pneumophila
           2300/99 Alcoy]
          Length = 417

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 120/228 (52%), Gaps = 1/228 (0%)

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREH 176
            + P+V  V P SPA  AG+K GD IIS++G   + +  +  YVRE P  +I+L + R+ 
Sbjct: 186 TIPPIVGEVVPDSPAEKAGLKIGDEIISVNGQHFNDWLYLVSYVRERPNSQINLDIKRQG 245

Query: 177 VGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITR 236
             +L + V    QD   +      V S  + +     +L  +  + +      +   +T 
Sbjct: 246 -KLLKITVHTGSQDNNGKLEGLIGVRSQKVDWPAHWLRLEQQPPISALGTAFKQTIQLTG 304

Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296
               ++         LN ISGPVGIA+ A +    G  +Y+ FLA+ S ++G +NLLPIP
Sbjct: 305 TTFILMGRLVTGKLGLNSISGPVGIAQGAGDSGRGGLVSYLFFLALVSISLGALNLLPIP 364

Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDI 344
           +LDGGHL+ ++LE+IR K L   V  V    GL +++ L F+ + NDI
Sbjct: 365 MLDGGHLLYYVLEIIRRKPLSDGVKSVGIYFGLLLLVALMFVALSNDI 412



 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 64/129 (49%), Gaps = 10/129 (7%)

Query: 36  VLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF--------SEDEKDMRSFFCAAPW 87
           +L FS GFG  L     + G  +  SL PLGGYV          SE EK   +F   +  
Sbjct: 1   MLRFSFGFGKILARFYDKKGTEYAWSLFPLGGYVKMLDETEGEVSEKEKPF-AFNNQSVL 59

Query: 88  KKILTVLAGPLANCVMA-ILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLD 146
            +I  V+AGPL N + A +  +         + P++ +V P S AA AG+     I++L+
Sbjct: 60  VRIAIVVAGPLFNFIFAFVALWLVLVIGMHSLAPMIESVKPNSIAARAGLLPKQEILALN 119

Query: 147 GITVSAFEE 155
           G+ ++++ +
Sbjct: 120 GVKINSWRD 128


>gi|119471160|ref|ZP_01613692.1| membrane-associated protease [Alteromonadales bacterium TW-7]
 gi|119445816|gb|EAW27098.1| membrane-associated protease [Alteromonadales bacterium TW-7]
          Length = 450

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 124/438 (28%), Positives = 188/438 (42%), Gaps = 104/438 (23%)

Query: 10  YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69
           + ++L I+V +HE+GH+ VAR   ++VL FS+GFG  LI    +    + ++ IPLGGYV
Sbjct: 11  FILALGILVTVHEYGHFWVARKAGVKVLRFSIGFGKPLIKWHDKYNTEYVIAAIPLGGYV 70

Query: 70  SFSEDEKD-------MRSFFCAA