RPSBLAST alignment for GI: 254780773 and conserved domain: TIGR02037
>gnl|CDD|162670 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. Length = 428
Score = 42.6 bits (101), Expect = 2e-04
Identities = 16/39 (41%), Positives = 26/39 (66%)
Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYV 160
V+ V P SPA AG+K GD I+S++G +S+F ++ +
Sbjct: 261 VAQVLPGSPAEKAGLKAGDVILSVNGKPISSFADLRRAI 299