RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780773|ref|YP_003065186.1| zinc metallopeptidase [Candidatus Liberibacter asiaticus str. psy62] (349 letters) >gnl|CDD|31093 COG0750, COG0750, Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane]. Length = 375 Score = 165 bits (418), Expect = 2e-41 Identities = 116/370 (31%), Positives = 185/370 (50%), Gaps = 28/370 (7%) Query: 7 FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66 + + ++L ++V +HE GH+ VAR C ++V FS+GFGP+L + G + +S IPLG Sbjct: 5 IIAFIIALGVLVFVHELGHFWVARRCGVKVERFSIGFGPKLFSRKDKGGTEYVLSAIPLG 64 Query: 67 GYVSF----------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTG 116 GYV E R+F + W++I V AGPL N ++AI+ F F+ G Sbjct: 65 GYVKMLGEDAEEVVLKGPEPRPRAFNAKSVWQRIAIVFAGPLFNFILAIVLFVVLFFVIG 124 Query: 117 ---VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISL--V 171 V PVV V+P S AA+AG++ GD I+++DG V+++++V + +L + Sbjct: 125 LVPVASPVVGEVAPKSAAALAGLRPGDRIVAVDGEKVASWDDVRRLLVAAAGDVFNLLTI 184 Query: 172 LYREHVGVLHLKVMPRLQDT----------VDRFGIKRQVPSVGISFSYDETKLHSR--- 218 L G H ++ + V ++G+S + + Sbjct: 185 LVIRLDGEAHAVAAEIIKSLGLTPVVIPLKPGDKIVAVDVGAIGLSPNGEPDVGKVLVKY 244 Query: 219 TVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIA 278 L++ +++ + + L +L D L +SGP+GIA+IA G + Sbjct: 245 GPLEAVGLAVEKTGRLVKLTLKMLKKLITGDLSLKNLSGPIGIAKIAGAAASLGLINLLF 304 Query: 279 FLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFL 338 FLA+ S +G +NLLPIP LDGGHL+ +LLE +RGK L V + R+GL ++L L L Sbjct: 305 FLALLSINLGILNLLPIPPLDGGHLLFYLLEALRGKPLSERVEAALYRIGLALLLLLMLL 364 Query: 339 GIRNDIYGLM 348 ND+ L Sbjct: 365 ATFNDLLRLF 374 >gnl|CDD|100084 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP. Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.. Length = 182 Score = 130 bits (330), Expect = 5e-31 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 9/115 (7%) Query: 7 FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66 L + + L I++ +HE GH++VA+L ++V FS+GFGP+L + + +S IPLG Sbjct: 1 ILAFILVLGILIFVHELGHFLVAKLFGVKVEEFSIGFGPKLFSFK-KGETEYSISAIPLG 59 Query: 67 GYVSF--------SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFY 113 GYV ++ E D RSF W++IL V AGPLAN ++AI+ F Sbjct: 60 GYVKMLGEDPEEEADPEDDPRSFNSKPVWQRILIVFAGPLANFLLAIVLFAVLLS 114 Score = 87.1 bits (217), Expect = 6e-18 Identities = 32/72 (44%), Positives = 44/72 (61%) Query: 273 FNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCII 332 F ++FLA+ S +G +NLLPIP LDGGHL+ L+E IRG+ L V +I +G ++ Sbjct: 109 FAVLLSFLALLSINLGILNLLPIPALDGGHLLFLLIEAIRGRPLSEKVEEIIQTIGFALL 168 Query: 333 LFLFFLGIRNDI 344 L L NDI Sbjct: 169 LGLMLFVTFNDI 180 >gnl|CDD|100078 cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-binding proteins (SREBPs) from membranes of the ER. These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD superfamily. Prokaryotic S2P/M50 homologs have been shown to regulate stress responses, sporulation, cell division, and cell differentiation. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses, and in Bacillus subtilis, the S2P homolog SpoIVFB is involved in the pro-sigmaK pathway of spore formation. Some of the subfamilies within this hierarchy contain one or two PDZ domain insertions, with putative regulatory roles, such as the inhibition of substrate cleavage as seen by the RseP PDZ domain.. Length = 180 Score = 86.9 bits (216), Expect = 7e-18 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 7/121 (5%) Query: 8 LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67 L + ++L+I V +HE GH +VAR ++V FS GF + G + + LIPLGG Sbjct: 1 LAFILALLISVTVHELGHALVARRLGVKVARFSGGF----TLNPLKHGDPYGIILIPLGG 56 Query: 68 YVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSP 127 Y + F W+++L LAGPLAN ++A+L G+ V + Sbjct: 57 YAKPVGENPRA---FKKPRWQRLLVALAGPLANLLLALLLLLLLLLLGGLPPAPVGQAAS 113 Query: 128 A 128 + Sbjct: 114 S 114 Score = 58.8 bits (143), Expect = 2e-09 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 5/71 (7%) Query: 272 GFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCI 331 G +AFLA+ + + NLLPIP LDGG ++ LLE IRG+ + G I Sbjct: 115 GLANLLAFLALINLNLAVFNLLPIPPLDGGRILRALLEAIRGRVEE-----RLEAYGFAI 169 Query: 332 ILFLFFLGIRN 342 +L L L + N Sbjct: 170 LLGLLLLLLLN 180 >gnl|CDD|111095 pfam02163, Peptidase_M50, Peptidase family M50. Length = 205 Score = 74.4 bits (183), Expect = 4e-14 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 7/125 (5%) Query: 12 VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71 ++L+I VV+HE GH +VAR ++V F++GFGP L + + G Sbjct: 4 LALLISVVVHELGHALVARRFGVKVERFAIGFGPLLFLHLDGATEYTIRLMFGAFGAP-- 61 Query: 72 SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPA 131 R F + +++ LAGPLAN ++A+L G+ P V + Sbjct: 62 -----INREFKKKSRKQRLKISLAGPLANFILALLLLALLLLLPGIPVPPVIGGVVVGSS 116 Query: 132 AIAGV 136 +++G Sbjct: 117 SLSGP 121 Score = 64.0 bits (156), Expect = 5e-11 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 1/107 (0%) Query: 237 GFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIP 296 + V G + +SGPV IA++ G A +AFLA+ + +G NLLPIP Sbjct: 100 PGIPVPPVIGGVVVGSSSLSGPVAIAKVGSTSALSGLIALLAFLALLNLNLGLFNLLPIP 159 Query: 297 ILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRND 343 LDGGH++ LL +RG+ L I +GL ++L L L + ND Sbjct: 160 PLDGGHILRALL-AVRGRPLNERAENYIYLVGLALLLLLILLLLFND 205 >gnl|CDD|29046 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 79 Score = 61.4 bits (149), Expect = 3e-10 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Query: 108 FTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE 167 F ++PV+ V P SPAA AG+K GD I++++G + ++E++ V+ENP Sbjct: 2 ILGFVPGGPPIEPVIGEVVPGSPAAKAGLKAGDRILAINGQKIKSWEDLVDAVQENPGKP 61 Query: 168 ISLVLYREHVGVLHLKVMP 186 ++L + R + L + P Sbjct: 62 LTLTVERNG-ETITLTLTP 79 >gnl|CDD|38132 KOG2921, KOG2921, KOG2921, Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones]. Length = 484 Score = 49.6 bits (118), Expect = 1e-06 Identities = 41/152 (26%), Positives = 63/152 (41%), Gaps = 25/152 (16%) Query: 10 YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69 + SL+I VV+HE GH + A ++V F + ++ I G +V Sbjct: 126 FLTSLVITVVVHELGHALAAASEGVQVNGFGI-----------------FIAAIYPGAFV 168 Query: 70 SFSEDE-KDMRSF-----FCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVS 123 D + + SF FCA W + L LA ++ ++ F+ + GV V Sbjct: 169 DLDNDHLQSLPSFRALRIFCAGIWHNFVFALLCVLALFLLPVILSPFYAHGEGVTVTEVP 228 Query: 124 NVSPASPAAIAGVKKGDCIISLDGITVSAFEE 155 +VSP G+ GD I SLDG V + Sbjct: 229 SVSPLF--GPRGLSVGDVITSLDGCPVHKVSD 258 >gnl|CDD|29044 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 90 Score = 47.6 bits (113), Expect = 5e-06 Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHE-ISLVLYR 174 +V++V P SPAA AG+K GD I++++G V + ++ + E + ++L + R Sbjct: 27 LVASVDPGSPAAKAGLKPGDVILAVNGKPVKSVADLRRALAELKPGDKVTLTVLR 81 >gnl|CDD|29045 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 85 Score = 47.5 bits (113), Expect = 6e-06 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVSA--FEEVAPYVRENPLHEISLVLYREH 176 V+++V P SPAA AG+K GD I+++DG V E+V +R ++ L L R Sbjct: 14 GLVITSVLPGSPAAKAGIKAGDIIVAIDGEPVDGLSLEDVVKLLRGKAGTKVRLTLKRGD 73 Query: 177 VGVLHLKVMPR 187 + + Sbjct: 74 GEPREVTLTRL 84 >gnl|CDD|100082 cd06161, S2P-M50_SpoIVFB, SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.. Length = 208 Score = 45.6 bits (109), Expect = 2e-05 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 31/119 (26%) Query: 7 FLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLG 66 LL + L + V++HE GH +VAR IRV S ++L+P G Sbjct: 30 GLLEALLLFLSVLLHELGHALVARRYGIRVRS---------------------ITLLPFG 68 Query: 67 GYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNV 125 G E+ + P ++ + LAGPL + ++A LF + Y +S++ Sbjct: 69 GVAELEEEPET--------PKEEFVIALAGPLVSLLLAGLF--YLLYLLLPGGGPLSSL 117 Score = 31.4 bits (72), Expect = 0.34 Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 11/94 (11%) Query: 255 ISGPV------GIARIAKNFFDHGFNAY--IAFLAMFSWAIGFMNLLPIPILDGGHLITF 306 ++GP+ G+ + G + FLA + +G NLLP LDGG ++ Sbjct: 88 LAGPLVSLLLAGLFYLLYLLLPGGGPLSSLLEFLAQVNLILGLFNLLPALPLDGGRVLRA 147 Query: 307 LLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGI 340 LL G TR+ R+G + L LG+ Sbjct: 148 LLWRRTGYRRA---TRIAARIGQLFAILLVVLGL 178 >gnl|CDD|29042 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1, a mammalian tight junction protein.. Length = 70 Score = 42.9 bits (101), Expect = 1e-04 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITVSAF--EEVAPYVRENPLHEISLVLY 173 VV +V P SPA AG++ GD I++++G V E+VA +++ +++L + Sbjct: 15 VVVLSVEPGSPAERAGLQAGDVILAVNGTDVKNLTLEDVAELLKKEVGEKVTLTVR 70 >gnl|CDD|38339 KOG3129, KOG3129, KOG3129, 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones]. Length = 231 Score = 43.1 bits (101), Expect = 1e-04 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 6/78 (7%) Query: 115 TGVMKP--VVSNVSPASPAAIAGVKKGDCII---SLDGITVSAFEEVAPYVRENPLHEIS 169 G M+P VV +V P SPA AG+ GD I+ ++ + +A V+ N +S Sbjct: 134 LGPMRPFAVVDSVVPGSPADEAGLCVGDEILKFGNVHSGNFLPLQNIAAVVQSNEDQIVS 193 Query: 170 LVLYREHVGVLHLKVMPR 187 + + RE + L + P+ Sbjct: 194 VTVIREG-QKVVLSLTPK 210 >gnl|CDD|100080 cd06159, S2P-M50_PDZ_Arch, Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.. Length = 263 Score = 42.3 bits (100), Expect = 2e-04 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 23/106 (21%) Query: 12 VSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSF 71 ++L++ VV+HE H ++AR+ I+V S + +IP G +V Sbjct: 115 IALVVGVVVHELSHGILARVEGIKVKSGGLLL-----------------LIIPPGAFVEP 157 Query: 72 SEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFT-FFFYNTG 116 E+E A ++ AG AN V+A++ F FF Y Sbjct: 158 DEEE-----LNKADRRIRLRIFAAGVTANFVVALIAFALFFLYWIF 198 Score = 33.8 bits (78), Expect = 0.069 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 14/77 (18%) Query: 275 AYIAF-LAMFSW------AIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVS-------V 320 A IAF L W +G N LP LDGGH+ LLE + + + Sbjct: 185 ALIAFALFFLYWIFWINFLLGLFNCLPAIPLDGGHVFRDLLEALLRRFPSEKAERVVNAI 244 Query: 321 TRVITRMGLCIILFLFF 337 T ++ + L +LF+ F Sbjct: 245 TYYLSSLVLLSLLFMIF 261 >gnl|CDD|31136 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane]. Length = 406 Score = 41.5 bits (97), Expect = 3e-04 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Query: 119 KPVVSNVSPASPAAIAGVKKGDCIISLDGITVS--AFEEVAPYVRENPLHEISLVLYRE 175 V + SPAA AG+K GD II +DG +V + +E +R P +++L + R Sbjct: 113 GVKVVSPIDGSPAAKAGIKPGDVIIKIDGKSVGGVSLDEAVKLIRGKPGTKVTLTILRA 171 >gnl|CDD|30614 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]. Length = 347 Score = 39.8 bits (92), Expect = 0.001 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 120 PVVSNVSPASPAAIAGVKKGDCIISLDGITV-SAFEEVAPYVRENPLHEISLVLYRE 175 VV V P SPAA AG+K GD I +++G V S + VA P E++L L R Sbjct: 272 AVVLGVLPGSPAAKAGIKAGDIITAVNGKPVASLSDLVAAVASNRPGDEVALKLLRG 328 >gnl|CDD|144258 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF). PDZ domains are found in diverse signaling proteins. Length = 80 Score = 38.4 bits (90), Expect = 0.003 Identities = 16/65 (24%), Positives = 26/65 (40%), Gaps = 11/65 (16%) Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180 VS V P A G++ GD I+S++G + E L L + G + Sbjct: 27 FVSEVLPGGAAEAGGLQVGDRILSINGQDLENMSHD----------EAVLAL-KGSGGEV 75 Query: 181 HLKVM 185 L ++ Sbjct: 76 TLTIL 80 >gnl|CDD|100081 cd06160, S2P-M50_like_2, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.. Length = 183 Score = 36.8 bits (86), Expect = 0.009 Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 3 WLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRV 36 L L + ++L+ I+ IHE GHY+ AR ++ Sbjct: 29 LLLQGLPFALALLAILGIHEMGHYLAARRHGVKA 62 Score = 30.3 bits (69), Expect = 0.79 Identities = 15/65 (23%), Positives = 27/65 (41%), Gaps = 4/65 (6%) Query: 276 YIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFL 335 +A + +NLLP+ LDGGH++ L G+ + + + + L+L Sbjct: 114 GLAVAGWVGLLVTALNLLPVGQLDGGHIVRALF----GRRVAALIGIGLLVALGLLALYL 169 Query: 336 FFLGI 340 F Sbjct: 170 SFSIW 174 >gnl|CDD|38761 KOG3553, KOG3553, KOG3553, Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis]. Length = 124 Score = 36.6 bits (84), Expect = 0.010 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query: 122 VSNVSPASPAAIAGVKKGDCIISLDG--ITVSAFEEVAPYVRENPL 165 V+ VS SPA IAG++ D I+ ++G T+ ++ + + + Sbjct: 63 VTRVSEGSPAEIAGLRIHDKILQVNGWDFTMVTHDQAVKRITKEEV 108 >gnl|CDD|29048 cd00991, PDZ_archaeal_metalloprotease, PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 79 Score = 36.4 bits (84), Expect = 0.013 Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN-PLHEISLVLYREH 176 V+ V SPA A + GD I S++G ++ E+ ++ P I++ + Sbjct: 13 VIVGVIVGSPAENAVLHTGDVIYSINGTPITTLEDFMEALKPTKPGEVITVTVLPST 69 >gnl|CDD|29049 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements. May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases.. Length = 82 Score = 35.6 bits (82), Expect = 0.020 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Query: 118 MKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSA--FEEVAPYVRENPLHEISLVL 172 VS V P PA G++ GD I+ ++G++V EE ++ + E++L + Sbjct: 26 GGIFVSRVEPGGPAERGGLRVGDRILEVNGVSVEGLTHEEAVELLKNSG-DEVTLTV 81 >gnl|CDD|100085 cd06164, S2P-M50_SpoIVFB_CBS, SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 227 Score = 35.2 bits (82), Expect = 0.028 Identities = 25/101 (24%), Positives = 39/101 (38%), Gaps = 29/101 (28%) Query: 8 LLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGG 67 L + L V++HE GH +VAR +G + IT L GG Sbjct: 46 LAAALLLFASVLLHELGHSLVAR-----------RYGIPVRSIT----------LFLFGG 84 Query: 68 YVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFF 108 + P ++ + +AGPL + V+A+LF Sbjct: 85 VARLERE--------PETPGQEFVIAIAGPLVSLVLALLFL 117 >gnl|CDD|32177 COG1994, SpoIVFB, Zn-dependent proteases [General function prediction only]. Length = 230 Score = 35.0 bits (80), Expect = 0.033 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 5/67 (7%) Query: 274 NAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIIL 333 A++A LA+ + + NLLPIP LDGG ++ LL G ++ I L +L Sbjct: 137 FAFLAALALVNLVLALFNLLPIPPLDGGRVLRALLPRRYGAAI-----AAIELAALLGLL 191 Query: 334 FLFFLGI 340 L GI Sbjct: 192 VLILAGI 198 >gnl|CDD|33755 COG3975, COG3975, Predicted protease with the C-terminal PDZ domain [General function prediction only]. Length = 558 Score = 34.6 bits (79), Expect = 0.047 Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVS 151 ++ V P PA AG+ GD I++++GI+ Sbjct: 465 KITFVFPGGPAYKAGLSPGDKIVAINGISDQ 495 >gnl|CDD|29047 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand is presumed to form the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.. Length = 80 Score = 34.1 bits (78), Expect = 0.059 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAF-EEVAPYVRENPLHEISLVLYRE 175 V+ V SPA AG+ GD +++++G V A + + Y +P + L ++R+ Sbjct: 15 KVTFVRDDSPADKAGLVAGDELVAVNGWRVDALQDRLKEYQAGDP---VELTVFRD 67 >gnl|CDD|100079 cd06158, S2P-M50_like_1, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.. Length = 181 Score = 32.9 bits (76), Expect = 0.12 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Query: 273 FNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCII 332 +A+ + + + NLLPIP LDG ++ LL ++ + G I+ Sbjct: 117 LFLMLAYGVLINLVLAVFNLLPIPPLDGSKILAALLPRRLAEAY-----ARLEPYGFLIL 171 Query: 333 LFLFFLGI 340 L L F GI Sbjct: 172 LALLFTGI 179 >gnl|CDD|37352 KOG2141, KOG2141, KOG2141, Protein involved in high osmolarity signaling pathway [Signal transduction mechanisms]. Length = 822 Score = 31.9 bits (72), Expect = 0.28 Identities = 16/83 (19%), Positives = 30/83 (36%), Gaps = 14/83 (16%) Query: 270 DHGFNAYIAFLAM------------FSWAI--GFMNLLPIPILDGGHLITFLLEMIRGKS 315 + +N + A LA+ F +A+ F L + + +L L +I Sbjct: 665 EKTYNPFYALLALKFCEFNKNLKKTFQFALWDRFKELEQLSLFRISNLAKLLASLISNAV 724 Query: 316 LGVSVTRVITRMGLCIILFLFFL 338 L ++V + + M L F Sbjct: 725 LSLTVLKHVDFMELNARRTTFLK 747 >gnl|CDD|38740 KOG3532, KOG3532, KOG3532, Predicted protein kinase [General function prediction only]. Length = 1051 Score = 30.1 bits (67), Expect = 0.99 Identities = 10/76 (13%), Positives = 28/76 (36%), Gaps = 5/76 (6%) Query: 86 PWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISL 145 +L + + + ++F V V S A A K GD ++++ Sbjct: 371 HVVNVLDTFSRYDVSSPIGLVF-----DKNTNRAVKVCTVEDNSLADKAAFKPGDVLVAI 425 Query: 146 DGITVSAFEEVAPYVR 161 + + + + + +++ Sbjct: 426 NNVPIRSERQATRFLQ 441 >gnl|CDD|38758 KOG3550, KOG3550, KOG3550, Receptor targeting protein Lin-7 [Extracellular structures]. Length = 207 Score = 29.6 bits (66), Expect = 1.4 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 18/84 (21%) Query: 125 VSPASPAAIA----GVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180 +S P +A G+K+GD ++S++G++V E HE ++ L + VG + Sbjct: 119 ISRIIPGGVADRHGGLKRGDQLLSVNGVSV-----------EGEHHEKAVELLKAAVGSV 167 Query: 181 HLKV--MPRLQDTVD-RFGIKRQV 201 L V P++ + ++ RF +R Sbjct: 168 KLVVRYTPKVLEEMEARFEKQRSA 191 >gnl|CDD|30714 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism]. Length = 528 Score = 28.7 bits (64), Expect = 2.4 Identities = 20/110 (18%), Positives = 38/110 (34%), Gaps = 20/110 (18%) Query: 81 FFCAAP--WKKILT-VLAGPLANCVMAILFFTFFFYNTGVMKPVVS----NVSPASPAAI 133 F+ ++ W L + PLA+ +L+ FY+ + + + SP + Sbjct: 216 FWNSSDPGWIYGLWYSVFSPLASGATTVLYDGRPFYSPERLWEALEKYKVTIFGTSPTFL 275 Query: 134 AGVKKGDCIISLDG----ITVSAFEEVAPYVRENPLHEISLVLYREHVGV 179 + K D + SA E PL+ + + +GV Sbjct: 276 RRLMKLGLGEPYDLSSLRVLGSAGE---------PLNPEAFEWFYSALGV 316 >gnl|CDD|38750 KOG3542, KOG3542, KOG3542, cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms]. Length = 1283 Score = 28.6 bits (63), Expect = 2.8 Identities = 12/26 (46%), Positives = 18/26 (69%) Query: 122 VSNVSPASPAAIAGVKKGDCIISLDG 147 V+ V P S AA G+K+GD I+ ++G Sbjct: 566 VAEVFPGSKAAREGLKRGDQILEVNG 591 >gnl|CDD|100083 cd06162, S2P-M50_PDZ_SREBP, Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family. This group appears to be limited to eumetazoan proteins and contains one PDZ domain.. Length = 277 Score = 27.8 bits (62), Expect = 4.5 Identities = 25/102 (24%), Positives = 40/102 (39%), Gaps = 22/102 (21%) Query: 10 YTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYV 69 Y +L+I V+HE GH + A +RV GFG +I G YV Sbjct: 130 YFTALLISGVVHEMGHGVAAVREQVRV----NGFG-------------IFFFIIYPGAYV 172 Query: 70 SFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFF 111 D ++ S P +++ AG N V+ ++ + Sbjct: 173 DLFTDHLNLIS-----PVQQLRIFCAGVWHNFVLGLVGYLLL 209 >gnl|CDD|33283 COG3480, SdrC, Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms]. Length = 342 Score = 27.6 bits (61), Expect = 5.1 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 122 VSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVG 178 V +V SP ++ GD II++DG ++ +E+ YV + + Y H Sbjct: 134 VLSVIDNSPF-KGKLEAGDTIIAVDGEPFTSSDELIDYVSSKKPGDEVTIDYERHNE 189 >gnl|CDD|35586 KOG0365, KOG0365, KOG0365, Beta subunit of farnesyltransferase [Posttranslational modification, protein turnover, chaperones]. Length = 423 Score = 27.3 bits (60), Expect = 6.5 Identities = 12/37 (32%), Positives = 17/37 (45%) Query: 64 PLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLAN 100 P GG+ E E D+RS +CA +L + L Sbjct: 186 PDGGFRMHVEGEVDVRSAYCALSVASLLNIPMDELFE 222 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.330 0.145 0.443 Gapped Lambda K H 0.267 0.0791 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,426,161 Number of extensions: 247836 Number of successful extensions: 916 Number of sequences better than 10.0: 1 Number of HSP's gapped: 901 Number of HSP's successfully gapped: 56 Length of query: 349 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 254 Effective length of database: 4,210,882 Effective search space: 1069564028 Effective search space used: 1069564028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 58 (26.0 bits)