BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780774|ref|YP_003065187.1| phosphatidate cytidylyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] (269 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780774|ref|YP_003065187.1| phosphatidate cytidylyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 269 Score = 525 bits (1351), Expect = e-151, Method: Compositional matrix adjust. Identities = 269/269 (100%), Positives = 269/269 (100%) Query: 1 MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKI 60 MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKI Sbjct: 1 MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKI 60 Query: 61 LGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALS 120 LGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALS Sbjct: 61 LGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALS 120 Query: 121 SLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGV 180 SLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGV Sbjct: 121 SLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGV 180 Query: 181 GVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMD 240 GVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMD Sbjct: 181 GVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMD 240 Query: 241 RVDGLVFSCFLMSAISFFGIATEMIGVLK 269 RVDGLVFSCFLMSAISFFGIATEMIGVLK Sbjct: 241 RVDGLVFSCFLMSAISFFGIATEMIGVLK 269 >gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 29.3 bits (64), Expect = 0.076, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 24 WIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKI 60 ++ +W L + +LC Y+EWKI T S SE I Sbjct: 400 YLSSVWLPLSPISKTLC-YFEWKIPTKSPEYISSENI 435 >gi|254781206|ref|YP_003065619.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter asiaticus str. psy62] Length = 1246 Score = 25.0 bits (53), Expect = 1.5, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 54 LSLSEKIL-GLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFW 104 +S SEKIL G +TF + + + F S++ L + DW + +K +W Sbjct: 806 ISGSEKILQGDYTFPPLSSLDVQSKFDSSYSKLFEIFYGDWTNNAIKEERYW 857 >gi|254780799|ref|YP_003065212.1| DNA translocase FtsK [Candidatus Liberibacter asiaticus str. psy62] Length = 806 Score = 22.3 bits (46), Expect = 9.8, Method: Compositional matrix adjust. Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 6 KWRIVTGLVMACSFILISWIGGIW 29 K +IV GL++ C+ I+ G W Sbjct: 25 KMKIVAGLILLCTVFAITLALGTW 48 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.334 0.147 0.484 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 174,164 Number of Sequences: 1233 Number of extensions: 7183 Number of successful extensions: 42 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 36 Number of HSP's gapped (non-prelim): 11 length of query: 269 length of database: 328,796 effective HSP length: 72 effective length of query: 197 effective length of database: 240,020 effective search space: 47283940 effective search space used: 47283940 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 37 (18.9 bits)