HHsearch results for GI: 254780775 and protein with PDBid: 2vg3_A

>2vg3_A Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, cell shape, cell division; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A
Probab=100.00  E-value=0  Score=636.96  Aligned_cols=237  Identities=37%  Similarity=0.706  Sum_probs=232.0

Q ss_pred             HHHCCCCCCCEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHH
Q ss_conf             35206898826999848851899975998779899999999999999997698689997202336532301248888988
Q gi|254780775|r    3 ASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLI   82 (243)
Q Consensus         3 ~~~~~~~~P~HIaiImDGNrRwAk~~gl~~~~Gh~~G~~~l~~ii~~~~~~gI~~lTvyafS~eN~~R~~~Ev~~L~~l~   82 (243)
                      ..|.+.++|+|||||||||||||+++|++..+||++|++++.++++||.++||++|||||||+|||+|+++||++||+|+
T Consensus        48 ~~~~~~~lP~HVAiImDGNrRwAk~~gl~~~~GH~~G~~~l~~ii~~~~~~GI~~LTvYaFStEN~~R~~~EV~~L~~L~  127 (284)
T 2vg3_A           48 PRIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFN  127 (284)
T ss_dssp             CCCCTTTSCSEEEEECCCHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHTCCEEEEEEEETTGGGSCHHHHHHHHHHH
T ss_pred             CCCCCCCCCCEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHCCCCHHHHHHHHHH
T ss_conf             98980018884799644868999877997779999999999999999998699789999752234235648999999999


Q ss_pred             HHHHHHCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             86310000100002832631387445100002358999874202543115897248815789987787643676489687
Q gi|254780775|r   83 KSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCS  162 (243)
Q Consensus        83 ~~~l~~~~~~~~~~~iki~~iGd~~~lp~~i~~~i~~~e~~T~~n~~~~Lnia~~Yggr~EI~~A~k~l~~~~~~~~~~~  162 (243)
                      ..++.+..+.+.+++|++++|||++.||+++++.+.++|+.|++|++++||||++||||+||++|++++++++..+..++
T Consensus       128 ~~~l~~~~~~~~~~~irvr~iGd~~~lp~~l~~~i~~~e~~T~~n~~l~Lniai~YgGR~EIv~A~k~l~~~~~~~~~~~  207 (284)
T 2vg3_A          128 RDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNP  207 (284)
T ss_dssp             HHHHHHHHHHHHHTTEEEEEESCCTTSCHHHHHHHHHHHHHHTTCCSEEEEEEEEECHHHHHHHHHHHHHHHHHTTSSCG
T ss_pred             HHHHHHHHHHHHHHCCCEEECCCCCCCCHHHHHHHHHHEEECCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCH
T ss_conf             99999998888873754131245556866765323201010245654237888424738899999999999876344667


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCEEEECCCCEECCCCCCCHHCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             78115531011336787765269945785213365640113553886368788889899999999986300505884
Q gi|254780775|r  163 HDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGL  239 (243)
Q Consensus       163 ~~I~~~~i~~~L~~~~~p~pDLlIRTsGe~RLSnFllwq~~ysEl~F~~~lWPdf~~~dl~~~i~~y~~r~RrfG~~  239 (243)
                      ++|+++.|+++|+++++||||||||||||+|||||||||++||||||+++|||||+..||.+||.+|++|+|||||-
T Consensus       208 e~i~~~~i~~~L~~~~~pdpDLlIRTsGe~RLSnFLlwQ~ayaEl~F~~~lWPdf~~~dl~~ai~~y~~R~RRfG~a  284 (284)
T 2vg3_A          208 ERITESTIARHLQRPDIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA  284 (284)
T ss_dssp             GGCCHHHHHHHSSSTTCCCCSEEEECTTCCCCTTTTTTTTTTCEEEECCSCGGGCCHHHHHHHHHHHHHSCCCSSCC
T ss_pred             HHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCHHHHCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             67589999975268998898758864786202452102104604896778886599999999999998600657899