PSIBLAST alignment of GI: 254780775 and protein with PDB id: 2d2r

>gi|116666971|pdb|2D2R|A Chain A, Crystal Structure Of Helicobacter Pylori Undecaprenyl Pyrophosphate Synthase Length = 245
>gi|116666972|pdb|2D2R|B Chain B, Crystal Structure Of Helicobacter Pylori Undecaprenyl Pyrophosphate Synthase Length = 245
 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 87/234 (37%), Positives = 137/234 (58%), Gaps = 1/234 (0%)

Query: 8   SSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINN 67
            S   H+ IIMDGNGRWA  +   R  GH+KG++   +I    A   ++ LT++AFS  N
Sbjct: 13  DSTLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTEN 72

Query: 68  WRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLN 127
           W+RP SE+  L+K++K +LK    +   NNI+ R IG+      ++   + + E+ TR  
Sbjct: 73  WKRPKSEVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHF 132

Query: 128 TGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIR 187
                 +A NY S++E+SRA K++ +   S  +   +   + I+  LDT ++P+ DL++R
Sbjct: 133 KDFTQVLALNYGSKNELSRAFKSLLESPPSN-ISLLESLENEISNRLDTRNLPEVDLLLR 191

Query: 188 TGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSK 241
           TGGE RLS+FLLWQ +Y+E  F P  WPDF+ +   + ++ +  R R+FG L  
Sbjct: 192 TGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGELKA 245