RPSBLAST alignment for GI: 254780775 and conserved domain: PRK14827

>gnl|CDD|173288 PRK14827, PRK14827, undecaprenyl pyrophosphate synthase; Provisional. Length = 296
 Score =  189 bits (481), Expect = 6e-49
 Identities = 87/227 (38%), Positives = 137/227 (60%)

Query: 11  PDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRR 70
           P+H+ I+MDGNGRWA  RGL R  GH+ G  V  +I   A E+GIK L+++AFS  NW+R
Sbjct: 68  PNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKR 127

Query: 71  PVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGL 130
              E+  L+   +  +++   +L K  +++R +G+R  L   ++  L  AE+ T+ N  +
Sbjct: 128 SPEEVRFLMGFNRDVVRRRRDNLNKMGVRIRWVGSRPRLWRSVINELAIAEEMTKSNDVI 187

Query: 131 NLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGG 190
            +    NY  R EI+ A + I ++  +G +    +  S IA++L   D+PD DL +RT G
Sbjct: 188 TINYCVNYGGRTEITEATREIAREAAAGRLNPERITESTIARHLQRPDIPDVDLFLRTSG 247

Query: 191 EKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFG 237
           E+R S+F+LWQ AY+E++F  + WPD+ R   + A  +Y  R+RRFG
Sbjct: 248 EQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRNRRFG 294