RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780775|ref|YP_003065188.1| undecaprenyl diphosphate
synthase [Candidatus Liberibacter asiaticus str. psy62]
         (243 letters)



>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase
           {Escherichia coli [TaxId: 562]}
          Length = 228

 Score =  216 bits (550), Expect = 2e-57
 Identities = 84/228 (36%), Positives = 136/228 (59%)

Query: 6   MSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSI 65
           + +    H+ IIMDGNGRWA  +G  R  GH+ G +     V+ AA  GI+ LT++AFS 
Sbjct: 1   LPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSS 60

Query: 66  NNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTR 125
            NW RP  E+S L++L    L     SL ++N+++R+IG+    +  +   ++++E  T 
Sbjct: 61  ENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTA 120

Query: 126 LNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLI 185
            NTGL L IA NY  R +I + ++ + + ++ G++    +D  ++ +++   ++   DL+
Sbjct: 121 GNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLV 180

Query: 186 IRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRD 233
           IRTGGE R+S+FLLWQ+AY+E  F    WPDF  + F  ALN +  R+
Sbjct: 181 IRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE 228


>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase
           {Micrococcus luteus [TaxId: 1270]}
          Length = 229

 Score =  204 bits (519), Expect = 7e-54
 Identities = 97/222 (43%), Positives = 141/222 (63%)

Query: 11  PDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRR 70
           P HI IIMDGNGRWA  + +PR  GH +G++   +I   A+++G+K LT++AFS  NW R
Sbjct: 8   PKHIAIIMDGNGRWAKQKKMPRIKGHYEGMQTVRKITRYASDLGVKYLTLYAFSTENWSR 67

Query: 71  PVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGL 130
           P  E++ L+KL   FL      L + N+KV  IG    L D     + EA+++T+ NTGL
Sbjct: 68  PKDEVNYLMKLPGDFLNTFLPELIEKNVKVETIGFIDDLPDHTKKAVLEAKEKTKHNTGL 127

Query: 131 NLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGG 190
            L  A NY  R EI  A++ I +  +SG +   ++  +   +YL T+++PDP+L+IRT G
Sbjct: 128 TLVFALNYGGRKEIISAVQLIAERYKSGEISLDEISETHFNEYLFTANMPDPELLIRTSG 187

Query: 191 EKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLR 232
           E+RLS+FL+WQ +YSEFVFI E+WPDF+ E     ++ Y  R
Sbjct: 188 EERLSNFLIWQCSYSEFVFIDEFWPDFNEESLAQCISIYQNR 229


>d1xr4a1 c.124.1.2 (A:1-236) Putative citrate lyase alpha chain,
           citF2 {Salmonella typhimurium [TaxId: 90371]}
          Length = 236

 Score = 38.9 bits (91), Expect = 4e-04
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 6/48 (12%)

Query: 37  RKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKS 84
           R G +V N ++A  AE+G ++LT+ + S+ +   P      L++ IK+
Sbjct: 68  RGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWP------LIEHIKN 109


>d1vk1a_ d.268.1.2 (A:) Hypothetical protein PF0380 {Pyrococcus
           furiosus [TaxId: 2261]}
          Length = 232

 Score = 30.4 bits (68), Expect = 0.16
 Identities = 20/119 (16%), Positives = 39/119 (32%), Gaps = 10/119 (8%)

Query: 16  IIMDGNGRWAAARGLPRCAGHRK----GIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRP 71
           +I+DG+ RWA  + L    G ++     ++ F+E V            +           
Sbjct: 56  LIVDGHHRWAGLQKL----GAKRAPSVILDYFDEGVKVYTWYPAFKGDVNKVIERLKAEG 111

Query: 72  VSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGL 130
           +  I +  +  +   +KG  +      K   I   L     +  VL E +    +    
Sbjct: 112 LEVIED--EKAEEKAEKGEIAFALIGEKSFAIPGGLEEQKKVSKVLDEMDQAKEIELVY 168


>d1wfya_ d.15.1.5 (A:) Regulator of G-protein signaling 14, RGS14
           {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 104

 Score = 28.2 bits (63), Expect = 0.64
 Identities = 12/68 (17%), Positives = 26/68 (38%), Gaps = 6/68 (8%)

Query: 47  VAAAAEVGIKNLTIFAFSINNWRRPVSEISELVK----LIKSFLKKGFYSLKKNNIKVRV 102
            +   EV ++N   F   +    R V   ++  K     ++  L K  + L  + + +  
Sbjct: 5   SSGDQEVRLENRITFQLELVGLERVVRISAKPTKRLQEALQPILAK--HGLSLDQVVLHR 62

Query: 103 IGNRLSLD 110
            G +  +D
Sbjct: 63  PGEKQPMD 70


>d1gcca_ d.10.1.2 (A:) GCC-box binding domain {Mouse-ear cress
          (Arabidopsis thaliana) [TaxId: 3702]}
          Length = 63

 Score = 25.0 bits (55), Expect = 6.2
 Identities = 10/36 (27%), Positives = 14/36 (38%)

Query: 15 GIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAA 50
          G+     G++AA    P   G R  +  F     AA
Sbjct: 5  GVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAA 40


>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast
           (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 511

 Score = 24.7 bits (53), Expect = 6.9
 Identities = 7/28 (25%), Positives = 13/28 (46%)

Query: 209 FIPEYWPDFSRELFFHALNQYNLRDRRF 236
           FIP   P   +   F+  ++ + +D  F
Sbjct: 35  FIPPTIPQVDQATLFNDWSKLSFQDLAF 62


>d1x8da1 d.58.4.21 (A:1-104) L-rhamnose mutarotase YiiL
          {Escherichia coli [TaxId: 562]}
          Length = 104

 Score = 24.7 bits (54), Expect = 8.1
 Identities = 6/27 (22%), Positives = 10/27 (37%)

Query: 41 EVFNEIVAAAAEVGIKNLTIFAFSINN 67
           ++ E+ A     G  N  I+     N
Sbjct: 24 PIWPELEAVLKSHGAHNYAIYLDKARN 50


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.322    0.139    0.413 

Gapped
Lambda     K      H
   0.267   0.0676    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 955,855
Number of extensions: 45511
Number of successful extensions: 131
Number of sequences better than 10.0: 1
Number of HSP's gapped: 131
Number of HSP's successfully gapped: 10
Length of query: 243
Length of database: 2,407,596
Length adjustment: 83
Effective length of query: 160
Effective length of database: 1,268,006
Effective search space: 202880960
Effective search space used: 202880960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (23.9 bits)