HHsearch alignment of GI: 254780779 and MMDB domain: 2zkq_b_

>2zkq_b (b:) 40S ribosomal protein SA; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}
Probab=100.00  E-value=0  Score=487.91  Aligned_cols=187  Identities=20%  Similarity=0.319  Sum_probs=177.5

Q ss_pred             CCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC-CCEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHH
Q ss_conf             9866245899986088607547765788562102001-881675389999999999999998610788169960782357
Q gi|254780779|r    1 MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCER-NNTHIIDLSQTVPMLQKALQVISDTVARGGRILFVATKSQAS   79 (278)
Q Consensus         1 m~m~~~t~~~Ll~ag~H~Gh~~~~wnPkM~~yI~g~r-ngihIIdL~kT~~~L~~A~~~i~~i~~~gg~ILFVgTk~~~~   79 (278)
                      |+|+.+++++||+||+||||++  |||+|++||||.| ||+|||||+||+.+|++|++||..+ .++|.|||||||++++
T Consensus         8 ~~~~~~~i~~ll~ag~H~G~~~--wnp~m~~yI~~~R~~gi~IidL~kT~~~l~~A~~~i~~i-~~~~~ilfV~tk~~~~   84 (295)
T 2zkq_b            8 LQMKEEDVLKFLAAGTHLGGTN--LDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAI-ENPADVSVISSRNTGQ   84 (295)
T ss_dssp             -----CCHHHHHHHTTTBCCSC--CCTGGGGGEEEECTTSCEEECHHHHHHHHHHHHHHHHHS-SCGGGEEEEECSHHHH
T ss_pred             CCCCHHHHHHHHHHCEECCCCC--CCCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHHHHHHH-CCCCCEEEEECCHHHH
T ss_conf             0679999999998487317678--787751303160689748960999999999999999974-5898679997552688


Q ss_pred             HHHHHHHHHCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999986339831423345873234266655567789988763012126774678876655677764344332211359
Q gi|254780779|r   80 DCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLP  159 (278)
Q Consensus        80 ~~i~~~A~~~~~~yV~~RWlGG~LTN~~ti~~si~~l~~l~~~~~~~~~~~tkKe~~~~~r~~~kl~k~lgGi~~m~~lP  159 (278)
                      ++|+++|++||++||++||+|||||||+|+++                                             ++|
T Consensus        85 ~~i~~~a~~~g~~~v~~Rw~gG~lTN~~~~~~---------------------------------------------~~P  119 (295)
T 2zkq_b           85 RAVLKFAAATGATPIAGRFTPGTFTNQIQAAF---------------------------------------------REP  119 (295)
T ss_dssp             HHHHHHHHHHCCEEEESSCCCC-CCCTTCSSC---------------------------------------------CCC
T ss_pred             HHHHHHHHHCCCCEECCEECCCCCCCHHHHHC---------------------------------------------CCC
T ss_conf             99999999818934513404776663122202---------------------------------------------367


Q ss_pred             CEEEEECCCCCCHHHHHHHHCCCEEEEECCCCCCCHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             5799943887712321234339814540367767001152032157726899999999999999999974431011
Q gi|254780779|r  160 DLMFVVDTNREKLAIQEARRLRIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGA  235 (278)
Q Consensus       160 ~~iiv~d~~~e~~Av~EA~kl~IPvIaivDTn~dp~~idypIP~NDds~~si~l~~~~i~~ai~~g~~~~~~~~~~  235 (278)
                      +++||+||..|++||+||.+|||||||||||||||++|||||||||||++||.|||++|+++|++|+..+......
T Consensus       120 ~~iiv~dp~~~~~ai~Ea~~l~IPvIai~DTn~~p~~idy~IP~Ndds~~sI~li~~lla~ail~~~~~~~~~~~~  195 (295)
T 2zkq_b          120 RLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPW  195 (295)
T ss_dssp             SEEEESCTTTTHHHHHHHHHHTCCEEEEECTTCCCTTCSEEEESCSSCHHHHHHHHHHHHHHHHHCCSSSSCCCCC
T ss_pred             CEEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             7027766663158899987549998998037898645776774777317789999999999999972885645653