PSIBLAST alignment of GI: 254780779 and protein with PDB id: 3fic

>gi|224510685|pdb|3FIC|B Chain B, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 235
 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 102/221 (46%), Positives = 146/221 (66%), Gaps = 1/221 (0%)

Query: 8   IRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVISDTVARGG 67
           +++LLE+GV FGH    WNPK  RYI+ ERN  HIIDL +T+  L++  + I D   RGG
Sbjct: 1   VKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGG 60

Query: 68  RILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLEE-LLNKE 126
            ILFV TK QA D V   A+R+    VN +WLGGM+TN+KT+SQ + +L +LE    + E
Sbjct: 61  TILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPE 120

Query: 127 NQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRLRIPIVA 186
            +   KKE++ ++ + ++L++ L G R +  LPD +FVVD  +E +A++EAR+L IP++A
Sbjct: 121 IEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIA 180

Query: 187 VVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIA 227
           + DT+S+PDLVDY+IPGNDD+ RSI L         I    
Sbjct: 181 LADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARG 221