HHsearch alignment for GI: 254780781 and conserved domain: COG0110

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only].
Probab=98.39  E-value=3.4e-06  Score=58.56  Aligned_cols=60  Identities=27%  Similarity=0.272  Sum_probs=30.0

Q ss_pred             CEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHH
Q ss_conf             88845885663004652783368715881464454998789605644556776657764467279896120246
Q gi|254780781|r  199 GCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTR  272 (285)
Q Consensus       199 Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~  272 (285)
T Consensus       124 ~v~IG~~vwIG~~a~IlpGV~IG~ga-------vigagsVVtk-dvp~~~---iv~G---~Pa~vir~~~~~~~  183 (190)
T COG0110         124 PVTIGEDVWIGAGAVILPGVTIGEGA-------VIGAGSVVTK-DVPPYG---IVAG---NPARVIRKRDVVAK  183 (190)
T ss_pred             CCEECCCCEECCCCEECCCEEECCCE-------EEECCEEEEC-CCCCCE---EEEC---CCCEEEEECCHHHH
T ss_conf             97889985877897897985989981-------9978858957-779982---8979---99889874160555