HHsearch alignment for GI: 254780781 and conserved domain: COG1207

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane].
Probab=99.84  E-value=1.2e-20  Score=147.05  Aligned_cols=134  Identities=28%  Similarity=0.368  Sum_probs=112.8

Q ss_pred             HHHHHHCCCCCCCCCEECCCCCCCCCCEEECCEEEC-CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCC
Q ss_conf             023442475102543103564006651462010302-3533677201566123220473068688123211210057765
Q gi|254780781|r  101 TKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNM-GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQT  179 (285)
Q Consensus       101 ~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp~~Vni-GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a  179 (285)
T Consensus       319 e~s~vg~~~~VGPfA~LRPg~~L~~~~hI-GNFVEvK~a~ig~gsKa~HLtYlGD-A~iG~~~NiGAGtIt-cNYDG~nK  395 (460)
T COG1207         319 EGSTVGEGATVGPFARLRPGAVLGADVHI-GNFVEVKKATIGKGSKAGHLTYLGD-AEIGENVNIGAGTIT-CNYDGKNK  395 (460)
T ss_pred             ECCEECCCCCCCCCCCCCCCCCCCCCCEE-EEEEEEECCCCCCCCCCCCEEEECC-CEECCCCEECCCEEE-ECCCCCCC
T ss_conf             05585479633783101796852679767-4259984356068863353234213-320687421442599-84788633


Q ss_pred             CCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCC
Q ss_conf             64487258478218578468884588566300465278336871588146445499878960564
Q gi|254780781|r  180 GPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY  244 (285)
Q Consensus       180 ~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~  244 (285)
T Consensus       396 ~~T~IGd~vFiGSns~LVAPV~IGd~a~iaAGStIT~-----DVp~~aLai~R--arQ~~~egw~  453 (460)
T COG1207         396 FKTIIGDNVFIGSNSQLVAPVTIGDGATIAAGSTITK-----DVPEGALAISR--ARQTNKEGWV  453 (460)
T ss_pred             CEEEECCCCEECCCCCEEEEEEECCCCEECCCCEECC-----CCCCCCEEEEE--CCEEECCCCC
T ss_conf             2006468857766871886489669848814636836-----57998446740--4414324421