HHsearch alignment for GI: 254780781 and conserved domain: COG4801

>COG4801 Predicted acyltransferase [General function prediction only].
Probab=92.67  E-value=0.36  Score=27.73  Aligned_cols=45  Identities=20%  Similarity=0.228  Sum_probs=27.4

Q ss_pred             CCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEE
Q ss_conf             644872584782185784688845885663004652783368715881464
Q gi|254780781|r  180 GPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITY  230 (285)
Q Consensus       180 ~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~  230 (285)
T Consensus       152 ~pl~Ip~~~~vs-----deri~vg~da~Vg~~c~l~Gnvka~~i~-g~~~~  196 (277)
T COG4801         152 GPLIIPADYIVS-----DERIKVGDDAFVGTVCRLEGNVKAGVIS-GCGYY  196 (277)
T ss_pred             CCEEECCCCEEC-----HHHEEECCCCEECCEEEEECCEEEEEEE-CCEEE
T ss_conf             964510665615-----4318706884613205997450321440-53258