HHsearch alignment for GI: 254780781 and conserved domain: PRK10191

>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional.
Probab=99.66  E-value=3.8e-16  Score=119.47  Aligned_cols=93  Identities=19%  Similarity=0.232  Sum_probs=72.5

Q ss_pred             CCCCCCCCCCCCC--CEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEE
Q ss_conf             3533677201566--12322047306868812321121005776564487258478218578468884588566300465
Q gi|254780781|r  137 GAYIGEGSMIDTW--STVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI  214 (285)
Q Consensus       137 GA~Ig~gt~I~~~--a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vi  214 (285)
T Consensus        47 ~a~IG~gl~I~H~~GiVIg~~~~IG~n~~I~q~VTiG~~~~~~~~~P~-Ig~~V~Igaga~IlG~i~IG~~~~IGA~svV  125 (146)
T PRK10191         47 AATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRGADNMACPH-IGNGVELGANVIILGDITLGNNVTVGAGSVV  125 (146)
T ss_pred             CCEECCCEEEECCEEEEECCCEEECCCEEEECCEEECCCCCCCCCCCE-ECCCEEEECCCEEECCCEECCCCEECCCCEE
T ss_conf             988789879837825899997198998099488788886787789898-7999599289999648599999999989589


Q ss_pred             CCCCEEEECCCCCEEEEECCCC
Q ss_conf             2783368715881464454998
Q gi|254780781|r  215 GKSTKIIDRNTGEITYGEVPSY  236 (285)
Q Consensus       215 t~st~i~d~~~~~~~~g~vP~~  236 (285)
T Consensus       126 ~~-----dvp~~~~v~G-~Par  141 (146)
T PRK10191        126 LD-----SVPDNALVVG-EKAR  141 (146)
T ss_pred             CC-----CCCCCCEEEE-ECCE
T ss_conf             70-----3599999997-6809