HHsearch alignment for GI: 254780781 and conserved domain: PRK11132

>PRK11132 cysE serine acetyltransferase; Provisional.
Probab=99.65  E-value=3.9e-16  Score=119.40  Aligned_cols=97  Identities=29%  Similarity=0.382  Sum_probs=80.2

Q ss_pred             CCCCCCCCCCC--CCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEE
Q ss_conf             35336772015--6612322047306868812321121005776564487258478218578468884588566300465
Q gi|254780781|r  137 GAYIGEGSMID--TWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI  214 (285)
Q Consensus       137 GA~Ig~gt~I~--~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vi  214 (285)
T Consensus       147 ~A~iG~gi~iDH~~GvVIGETavigd~vsi~~~VTLGgt~~~~g~RHP~i~~~v~igaga~iLG~i~iG~~a~igA~svV  226 (273)
T PRK11132        147 AAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVV  226 (273)
T ss_pred             CCEECCCEEEECCCCEEECCEEEECCCEEEECCEEEECCCCCCCCCCCCCCCCEEECCCCEEECCEEECCCCEECCCCEE
T ss_conf             65116856883476358756468668548951235403556688989804888487548889718588999888678668


Q ss_pred             CCCCEEEECCCCCEEEEECCCCCEE
Q ss_conf             2783368715881464454998789
Q gi|254780781|r  215 GKSTKIIDRNTGEITYGEVPSYSVV  239 (285)
Q Consensus       215 t~st~i~d~~~~~~~~g~vP~~~vv  239 (285)
T Consensus       227 l~-----dvp~~~tv~G-vPa~~vg  245 (273)
T PRK11132        227 LQ-----PVPPHTTAAG-VPARIVG  245 (273)
T ss_pred             CC-----CCCCCCEEEC-CCCEEEC
T ss_conf             64-----3799987966-6720308