HHsearch alignment for GI: 254780781 and conserved domain: PRK11830

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional.
Probab=98.41  E-value=1.2e-06  Score=61.25  Aligned_cols=161  Identities=19%  Similarity=0.301  Sum_probs=83.3

Q ss_pred             HHHHHHHHHHHHHHH--------CCC--CCCHHHHHHHHHHHHHHHCCCE------EEEEECCC--CCEEEEHHHHHHHH
Q ss_conf             999999999750531--------682--4417899999999997307937------99887599--96886078862322
Q gi|254780781|r    7 TLEEIIDSFFEESNS--------KNE--SIPQDVKDAVQSTLDLLDRGII------RIASRDDN--GHWNTHQWIKKAIL   68 (285)
Q Consensus         7 ~L~~~Ie~awe~r~~--------l~~--~~~~~~~~aI~~~I~~LD~G~i------RVAEk~~n--G~W~VNeWvKKAIL   68 (285)
T Consensus        19 evr~aI~e~I~lLD~G~iRVAEk~dg~W~VNqWvKKAILLsFrl~~~~~~~~Gp~~~~~DKVplKf~~w~~~~f~~----   94 (265)
T PRK11830         19 EVREAVEEVIDLLDSGELRVAEKIDGEWVVNQWVKKAILLSFRLNDNQVIEGGPESRFYDKVPSKFAGWDEARFKE----   94 (265)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCEEEEEHHHHHHHHHEEECCCCEEECCCCCCCCEECCCCCCCCCCHHHHHH----
T ss_conf             8999999999873388679878529988873999886652375257668626887500440454237999899976----


Q ss_pred             HEEECCCCEEEECCCCCCCHHHCCCCCCCCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEE-CCEEECCCCCCCCCCCC
Q ss_conf             20642674476247764201101775323652023442475102543103564006651462-01030235336772015
Q gi|254780781|r   69 LSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM-PSFVNMGAYIGEGSMID  147 (285)
Q Consensus        69 L~Fri~~~~~i~~g~~~~~~~DKvp~Kf~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vim-p~~VniGA~Ig~gt~I~  147 (285)
T Consensus        95 ~gvRvVP~a~vR~G--------------------ayi~~~vVlMP-s~VNiGAyv~~gtmiDtwatvGScAqiGknvhls  153 (265)
T PRK11830         95 AGVRVVPGAVVRRG--------------------AYIAKNVVLMP-SYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLS  153 (265)
T ss_pred             CCEEECCCCEEEEC--------------------EEECCCCEEEE-EEEEEEEEECCCCEEECCCCEECHHEECCCEEEC
T ss_conf             79088788537603--------------------05459958864-1777603984895480476241153237833687


Q ss_pred             CCCEECC--------EEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCE
Q ss_conf             6612322--------0473068688123211210057765644872584782185784688
Q gi|254780781|r  148 TWSTVGS--------CAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGC  200 (285)
Q Consensus       148 ~~a~IG~--------~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv  200 (285)
T Consensus       154 ~g~gigGvleP~~a~p~iied~~fiGa~~~v~--------eGv~v~~~avl~~gv~l~~st  206 (265)
T PRK11830        154 GGVGIGGVLEPLQANPVIIEDNCFIGARSEVV--------EGVIVEEGAVIGMGVFLGQST  206 (265)
T ss_pred             CCCEEEEEECCCCCCCEEEECCCEECCCCEEE--------EEEEEECCCEECCEEEECCCC
T ss_conf             87414265247667987983682873574796--------139994586972104760671