HHsearch alignment for GI: 254780781 and conserved domain: TIGR01173

>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2.7.7.23 from EC) is a trimeric bifunctional enzyme that catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-GlcNAc. The X-ray crystal structure of Escherichia coli GlmU in complex with UDP-GlcNAc and CoA has been determined to 2.1 A resolution and reveals a two-domain architecture that is responsible for these two reactions . The C-terminal domain is responsible for the CoA-dependent acetylation of Glc-1-PO(4) to GlcNAc-1-PO(4) and displays the longest left-handed parallel beta-helix observed to date. The acetyltransferase active site defined by the binding site for CoA makes use of residues from all three subunits and is positioned beneath an open cavity large enough to accommodate the Glc-1-PO(4) acetyl acceptor. The N-terminal domain catalyzes uridyl transfer from UTP to GlcNAc-1-PO(4) to form the final products UDP-GlcNAc and pyrophosphate. This domain is composed of a central seven-stranded beta-sheet surrounded by six alpha-helices in a Rossmann fold-like topology. ; GO: 0003977 UDP-N-acetylglucosamine diphosphorylase activity, 0009103 lipopolysaccharide biosynthetic process.
Probab=99.33  E-value=4.9e-12  Score=94.30  Aligned_cols=209  Identities=23%  Similarity=0.312  Sum_probs=109.6

Q ss_pred             CCCHHHHHHHHHHHHHHH-CC-CEEEEEECCCCC-EEEEHHHHHHHHHEE---ECCCCEEEECC----CCCCCHHHC-CC
Q ss_conf             441789999999999730-79-379988759996-886078862322206---42674476247----764201101-77
Q gi|254780781|r   25 SIPQDVKDAVQSTLDLLD-RG-IIRIASRDDNGH-WNTHQWIKKAILLSF---QINPTKIISDG----NGYSTWWDK-IP   93 (285)
Q Consensus        25 ~~~~~~~~aI~~~I~~LD-~G-~iRVAEk~~nG~-W~VNeWvKKAILL~F---ri~~~~~i~~g----~~~~~~~DK-vp   93 (285)
T Consensus       197 NaqgEYY--LTD~ia~a~~~g~~v~~~~~~d~~E~~GvNdR~qLa~lE~~~q~r~~~-~l~~~GVt~~dP~~~~i~~~v~  273 (461)
T TIGR01173       197 NAQGEYY--LTDVIALAVADGEEVRAVQVDDSEEVLGVNDRLQLAQLERILQRRIAK-KLLLQGVTLIDPARTDIRGTVE  273 (461)
T ss_pred             CCCCCCC--HHHHHHHHHCCCCEEEEEEECCHHHHCCCCCHHHHHHHHHHHHHHHHH-HHHHCCCEEECCCEEEECCCEE
T ss_conf             0444314--789999985089478999808759833667988999999999999999-8985892998683378735479


Q ss_pred             CCCCCCCHHHH-HHCCCCCCCCCEECCCCCCCCCCEEECCEEEC-----------CCCCCCCCCCCCCCEECCEEEECCC
Q ss_conf             53236520234-42475102543103564006651462010302-----------3533677201566123220473068
Q gi|254780781|r   94 AKFDDWKTKDF-EKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNM-----------GAYIGEGSMIDTWSTVGSCAQIGKN  161 (285)
Q Consensus        94 ~Kf~~~~~~~f-~~~g~rv~P~a~vr~ga~Ig~g~vimp~~Vni-----------GA~Ig~gt~I~~~a~IG~~a~IG~~  161 (285)
T Consensus       274 ~G------~Dv~I~~~v~leG~v~iG~~v~IGp~~~I~ns~I~~~~~I~~~s~~e~~~ig~~~~vGPFArLRP~~~L~~~  347 (461)
T TIGR01173       274 IG------QDVVIDPNVILEGKVQIGDDVVIGPGCVIKNSVIGSNAVIKPYSVLEGSEIGEGCDVGPFARLRPGSVLGAG  347 (461)
T ss_pred             EC------CEEEECCCCEECCEEEECCCEEECCCCEEEEEEECCCCEEEEEEECCCCEECCCCEECCCCCCCCCCHHHCC
T ss_conf             87------716975583883407987870788985899728868855888884146786156402773001864321177


Q ss_pred             CEEECCC-----EECC-E----ECCCCCCCEEECCCCEEECCCEEEC--C-----EEECCCCEEEEEEEECCCCEEEE--
Q ss_conf             6881232-----1121-0----0577656448725847821857846--8-----88458856630046527833687--
Q gi|254780781|r  162 VHISGGV-----GIGG-V----LEPIQTGPTIIEDNCFIGARSEIVE--G-----CIIREGSVLGMGVFIGKSTKIID--  222 (285)
Q Consensus       162 vhI~~g~-----~IGG-v----lep~~a~pviIeD~v~IGa~s~I~~--G-----v~Ig~gavIgaG~vit~st~i~d--  222 (285)
T Consensus       348 ~hiGNFVE~Kna~iG~gsKA~HLsY--lGDAeiG~~vNiGAGtITcNYDG~nK~~T~IGd~VFiGSnt~LVAPV~iG~gA  425 (461)
T TIGR01173       348 VHIGNFVEVKNARIGEGSKAGHLSY--LGDAEIGSNVNIGAGTITCNYDGVNKHKTIIGDGVFIGSNTQLVAPVKIGDGA  425 (461)
T ss_pred             CEEEEEEEEECCEECCCCCCCCCCE--EEEEEECCCCEECCEEEEEECCCCCCCCCEECCCCEECCCCEEECCEEECCCC
T ss_conf             8160258652476188644231433--32025079600323168993279622034864887877676045543943811


Q ss_pred             -CCCCCEEEEECCCCCEEECCCC
Q ss_conf             -1588146445499878960564
Q gi|254780781|r  223 -RNTGEITYGEVPSYSVVVPGSY  244 (285)
Q Consensus       223 -~~~~~~~~g~vP~~~vvvpg~~  244 (285)
T Consensus       426 ~iaAGstvt~DVp~g~La~~R~~  448 (461)
T TIGR01173       426 TIAAGSTVTKDVPEGALAIARAR  448 (461)
T ss_pred             EECCCCEEECCCCCCCCEEECCC
T ss_conf             87124148023488852662455