HHsearch alignment for GI: 254780781 and conserved domain: TIGR03536

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (DapD) is involved in the succinylated branch of the "lysine biosynthesis via diaminopimelate (DAP)" pathway (GenProp0125). This model represents a clade of DapD sequences most closely related to the actinobacterial DapD family represented by the TIGR03535 model. All of the genes evaluated for the seed of this model are found in genomes where the downstream desuccinylase is present, but known DapD genes are absent. Additionally, many of the genes identified by this model are found proximal to genes involved in this lysine biosynthesis pathway.
Probab=97.49  E-value=0.00018  Score=48.01  Aligned_cols=152  Identities=20%  Similarity=0.314  Sum_probs=75.0

Q ss_pred             EEHHHHHHHHHEEECC-CCEEEECC----CCCCCHHHCCCCCCCCCCHHHHH--HCCCCCCCCCE---ECCCCCCCC-CC
Q ss_conf             6078862322206426-74476247----76420110177532365202344--24751025431---035640066-51
Q gi|254780781|r   59 THQWIKKAILLSFQIN-PTKIISDG----NGYSTWWDKIPAKFDDWKTKDFE--KHNFRIIPGTI---VRHSAYIGP-KA  127 (285)
Q Consensus        59 VNeWvKKAILL~Fri~-~~~~i~~g----~~~~~~~DKvp~Kf~~~~~~~f~--~~g~rv~P~a~---vr~ga~Ig~-g~  127 (285)
T Consensus       101 ~~ayLkL-hlLS~rlv~P~~~nL~g~F~~L~nvaWTn~gp~~~~~~~~~~~~~~~~g~~~~v~~vDkfPrm~dyvvP~gv  179 (341)
T TIGR03536       101 PEGYLKL-QLISHRLVKPHGVNLDGIFGLLPNVAWTNQGAIDLDELAERQLEARLNGEVLEVDCVDKFPKMTDYVVPKGV  179 (341)
T ss_pred             HHHHHHH-HHHHHCCCCCCCCCHHHHHHHCCHHEECCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHEECCCCC
T ss_conf             9999999-987606646670256777765404305178874788999999986247995599982457414314567883


Q ss_pred             EEE-CCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC--------
Q ss_conf             462-01030235336772015661232204730686881232112100577656448725847821857846--------
Q gi|254780781|r  128 VLM-PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE--------  198 (285)
Q Consensus       128 vim-p~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~--------  198 (285)
T Consensus       180 RIad~~rVRLGA~L~~GTtvmhegfvnfNA----------GTlG~~mvEGRiS~GVvVg~gsDiGGgaSimGtLSGGg~~  249 (341)
T TIGR03536       180 RIADTARVRLGAYVGEGTTVMHEGFINFNA----------GTEGPSMVEGRISAGVMVGKGSDLGGGCSTMGTLSGGGNI  249 (341)
T ss_pred             EECCCCCEEEEEEECCCEEEECCCEEECCC----------CCCCCCEEEEEEECCEEECCCCCCCCCEEEEEEECCCCCE
T ss_conf             761566344300775881770221475047----------7766424530440346966787667750247763589823


Q ss_pred             CEEECCCCEEEEEEEECCCCEEEEC
Q ss_conf             8884588566300465278336871
Q gi|254780781|r  199 GCIIREGSVLGMGVFIGKSTKIIDR  223 (285)
Q Consensus       199 Gv~Ig~gavIgaG~vit~st~i~d~  223 (285)
T Consensus       250 ~isiG~~cLlGANsg~G--I~LGD~  272 (341)
T TIGR03536       250 VISVGEGCLLGANAGIG--IPLGDR  272 (341)
T ss_pred             EEEECCCCCCCCCCCCC--CCCCCC
T ss_conf             68887322014445557--424898