HHsearch alignment for GI: 254780781 and conserved domain: cd03352

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc. This constitutes the third step in the lipid A biosynthetic pathway in Gram-negative bacteria. LpxD is a homotrimer, with each subunit consisting of a novel combination of an N-terminal uridine-binding domain, a core lipid-binding left-handed parallel beta helix (LbH) domain, and a C-terminal alpha-helical extension. The LbH domain contains 9 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).
Probab=99.83  E-value=2.2e-20  Score=145.43  Aligned_cols=123  Identities=30%  Similarity=0.420  Sum_probs=77.1

Q ss_pred             CCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCE------------
Q ss_conf             4751025431035640066514620-103023533677201566123220473068688123211210------------
Q gi|254780781|r  107 HNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGV------------  173 (285)
Q Consensus       107 ~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGv------------  173 (285)
T Consensus         6 ~~v~I~~~avI~~~v~Ig~n~~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~vIg~~~f~~~~~~~~~~   85 (205)
T cd03352           6 ENVSIGPNAVIGEGVVIGDGVVIGPGVVIGDGVVIGDDCVIHPNVTIYEGCIIGDRVIIHSGAVIGSDGFGFAPDGGGWV   85 (205)
T ss_pred             CCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCCEECCCCEECCEEEECCCEEECCCCCCCCCCCCCCE
T ss_conf             99999998799999999999999898899999688988366003447278687544777153486213532314798404


Q ss_pred             --------------------------ECC-------------------------------CCCCCEEECCCCEEECCCEE
Q ss_conf             --------------------------057-------------------------------76564487258478218578
Q gi|254780781|r  174 --------------------------LEP-------------------------------IQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       174 --------------------------lep-------------------------------~~a~pviIeD~v~IGa~s~I  196 (285)
T Consensus        86 ~~~~~g~v~Ig~~v~Ig~~~~I~~g~~~~T~IG~~~~i~~~v~igh~~~iG~~~~i~~~~~~~g~~~Igd~~~iG~~s~i  165 (205)
T cd03352          86 KIPQLGGVIIGDDVEIGANTTIDRGALGDTVIGDGTKIDNLVQIAHNVRIGENCLIAAQVGIAGSTTIGDNVIIGGQVGI  165 (205)
T ss_pred             ECCCCCCEEECCCEEECCCCEECCCCCCCCCCCCCCEECCCCCCCCCCCCCCCEEECCCCCCCCCEEECCCCEECCCCEE
T ss_conf             51421318984884988862763664267747877686454525564041587075032000265249743539896488


Q ss_pred             ECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCC
Q ss_conf             468884588566300465278336871588146445499
Q gi|254780781|r  197 VEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPS  235 (285)
Q Consensus       197 ~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~  235 (285)
T Consensus       166 ~~gv~IG~~a~VgagSvVtk-----dVp~~~iv~G-~PA  198 (205)
T cd03352         166 AGHLTIGDGVVIGAGSGVTS-----IVPPGEYVSG-TPA  198 (205)
T ss_pred             CCCCEECCCCEECCCCEECC-----CCCCCCEEEE-EEC
T ss_conf             29939999989986887964-----8699969997-628