>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma. Most members of this family contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold, followed by a LbH fold domain with at least 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). eIF-2B epsilon contains an additional domain of unknown function at the C-terminus. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.

Probab=98.48  E-value=4.3e-07  Score=64.05  Aligned_cols=30  Identities=40%  Similarity=0.638  Sum_probs=14.0

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEE
Q ss_conf             3677201566123220473068688123211
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGI  170 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~I  170 (285)
T Consensus         2 IG~~~~Ig~~~~I~~-svIG~~c~Ig~~~~I   31 (79)
T cd03356           2 IGESTVIGENAIIKN-SVIGDNVRIGDGVTI   31 (79)
T ss_pred             CCCCCEECCCCEEEC-CEECCCCEECCCCEE
T ss_conf             989799999999959-999999999999699