HHsearch alignment for GI: 254780781 and conserved domain: cd03356

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma. Most members of this family contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold, followed by a LbH fold domain with at least 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). eIF-2B epsilon contains an additional domain of unknown function at the C-terminus. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=98.43  E-value=7.6e-07  Score=62.51  Aligned_cols=77  Identities=31%  Similarity=0.444  Sum_probs=44.8

Q ss_pred             ECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEE
Q ss_conf             03564006651462010302353367720156612322047306868812321121005776564487258478218578
Q gi|254780781|r  117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       117 vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I  196 (285)
T Consensus         2 IG~~~~Ig~~~~I~~sv------IG~~c~Ig~~~~I~~-Sii~~~~~Ig~~~~i~~---------sII~~~~~Ig~~~~i   65 (79)
T cd03356           2 IGESTVIGENAIIKNSV------IGDNVRIGDGVTITN-SILMDNVTIGANSVIVD---------SIIGDNAVIGENVRV   65 (79)
T ss_pred             CCCCCEECCCCEEECCE------ECCCCEECCCCEEEE-EEEECCCEECCCCEEEC---------CEECCCCEECCCCEE
T ss_conf             98979999999995999------999999999969961-09979799999999969---------999498999999999


Q ss_pred             ECCEEECCCCEEE
Q ss_conf             4688845885663
Q gi|254780781|r  197 VEGCIIREGSVLG  209 (285)
Q Consensus       197 ~~Gv~Ig~gavIg  209 (285)
T Consensus        66 ~~~~viG~~~~I~   78 (79)
T cd03356          66 VNLCIIGDDVVVE   78 (79)
T ss_pred             ECCCEECCCCEEC
T ss_conf             2883997995988