HHsearch alignment for GI: 254780781 and conserved domain: cd04647

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.
Probab=98.70  E-value=7.6e-08  Score=68.62  Aligned_cols=93  Identities=25%  Similarity=0.255  Sum_probs=61.7

Q ss_pred             CCCCCCCCCCCEEC--CEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCC
Q ss_conf             36772015661232--2047306868812321121005776564487258478218578468884588566300465278
Q gi|254780781|r  140 IGEGSMIDTWSTVG--SCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKS  217 (285)
Q Consensus       140 Ig~gt~I~~~a~IG--~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~s  217 (285)
T Consensus         4 IG~~~~Ig~~~~I~~~~~i~IG~~~~I~~~~~i~~~-------~~~~~~~~~~~~~~~~~~~v~Ig~~v~IG~~~~I~~g   76 (109)
T cd04647           4 IGDNVYIGPGCVISAGGGITIGDNVLIGPNVTIYDH-------NHDIDDPERPIEQGVTSAPIVIGDDVWIGANVVILPG   76 (109)
T ss_pred             ECCCCEECCCCEEECCCCEEECCCCEECCEEEEEEE-------EEECCCCCEECCCCCEECCEEEECCCEECCCEEEEEC
T ss_conf             999989999999968988799998499350898330-------0132887525267637189799423578898399285


Q ss_pred             CEEEE---CCCCCEEEEECCCCCEE
Q ss_conf             33687---15881464454998789
Q gi|254780781|r  218 TKIID---RNTGEITYGEVPSYSVV  239 (285)
Q Consensus       218 t~i~d---~~~~~~~~g~vP~~~vv  239 (285)
T Consensus        77 v~Ig~~~iIga~SvV~k~i~~~~i~  101 (109)
T cd04647          77 VTIGDGAVVGAGSVVTKDVPPNSIV  101 (109)
T ss_pred             CEECCCCEECCCCEECCCCCCCCEE
T ss_conf             1308986993798891483999899