HHsearch alignment for GI: 254780781 and conserved domain: cd04651

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase. It catalyzes the first committed and rate-limiting step in starch biosynthesis in plants and glycogen biosynthesis in bacteria. It is the enzymatic site for regulation of storage polysaccharide accumulation in plants and bacteria. The enzyme is a homotetramer, with each subunit containing an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain with at 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The LbH domain is involved in cooperative allosteric regulation and oligomerization.
Probab=97.94  E-value=3e-05  Score=52.73  Aligned_cols=56  Identities=18%  Similarity=0.144  Sum_probs=23.5

Q ss_pred             CCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEE
Q ss_conf             25431035640066514620103023533677201566123220473068688123211
Q gi|254780781|r  112 IPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGI  170 (285)
Q Consensus       112 ~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~I  170 (285)
T Consensus         5 ~~~~~v~-~S~Ig~Gc~I~~~~V~-~SVIg~~~~Ig~~a~I~~-svi~~~~~Ig~~~~l   60 (104)
T cd04651           5 GRRGEVK-NSLVSEGCIISGGTVE-NSVLFRGVRVGSGSVVED-SVIMPNVGIGRNAVI   60 (104)
T ss_pred             CCCCEEE-ECEECCCCEEECCEEE-CCEECCCCEECCCCEEEC-CEEECCCEECCCCEE
T ss_conf             8994898-4998899799599998-089729979999989960-099655689999999