HHsearch alignment for GI: 254780781 and conserved domain: cd04652

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B gamma subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH domain with 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.
Probab=98.48  E-value=4.1e-07  Score=64.17  Aligned_cols=64  Identities=30%  Similarity=0.504  Sum_probs=33.2

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEE
Q ss_conf             367720156612322047306868812321121005776564487258478218578468884588566300465
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI  214 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vi  214 (285)
T Consensus         2 IG~~~~Ig~~~~I~~-SvIG~nc~Ig~~~~i~~---------sii~~~v~I~~~~~i-~~sIIg~~~~Ig~~~~l   65 (81)
T cd04652           2 VGENTQVGEKTSIKR-SVIGANCKIGKRVKITN---------CVIMDNVTIEDGCTL-ENCIIGNGAVIGEKCKL   65 (81)
T ss_pred             CCCCCEECCCCEEEC-CEECCCCEECCCCEEEC---------CEEECCCEECCCCEE-ECCEEECCCEECCCCEE
T ss_conf             879889999998967-99979999999968968---------999698798999899-74999097999999999