HHsearch alignment for GI: 254780781 and conserved domain: cd05787

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B epsilon subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold, a central LbH domain containing 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), and a C-terminal domain of unknown function that is present in eIF-4 gamma, eIF-5, and eIF-2B epsilon. The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.
Probab=98.71  E-value=4.6e-08  Score=69.94  Aligned_cols=77  Identities=30%  Similarity=0.434  Sum_probs=36.3

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCE
Q ss_conf             36772015661232204730686881232112100577656448725847821857846888458856630046527833
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTK  219 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~  219 (285)
T Consensus         2 IG~~t~Ig~~~~I~~-svIG~nc~Ig~~~~I~~s---vi~d~~~Ig~~~~i-~~siI~~~~~Ig~~~~i~~g~vIg~~~~   76 (79)
T cd05787           2 IGRGTSIGEGTTIKN-SVIGRNCKIGKNVVIDNS---YIWDDVTIEDGCTI-HHSIVADGAVIGKGCTIPPGSLISFGVV   76 (79)
T ss_pred             CCCCCEECCCCEEEC-CEECCCCEECCCCEEECC---EEECCCEECCCCEE-CCCEECCCCEECCCCEECCCCEECCCCE
T ss_conf             999899999999959-998999999999889489---99197899999999-0899979899999999999999979979


Q ss_pred             EE
Q ss_conf             68
Q gi|254780781|r  220 II  221 (285)
Q Consensus       220 i~  221 (285)
T Consensus        77 Ig   78 (79)
T cd05787          77 IG   78 (79)
T ss_pred             EC
T ss_conf             69